F141795

General Info

Members Datasets Scaffolds Average Seq Length
129 68 258 210

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10044021|Ga0157374_100440212
Length 238
Sequence MKTDLKQLNKAIVEGDAKKAVEVTKAALAEGATPLDLIQNHMIPAMDEVGKLFEEEEYFVPELLLSGRAMRGAFDLIRPLMVAQGVQPTGRVVIGTIQGDLHDIGKNLVAAMLEGAGFEVTDLGADVSPEAFVEAVKAKNANIVAFSAMLTVTMPKMKTTIEALEKAGLRDRVKVMVGGAPISQAYCDEVGADAYSDTASGAAALARDIMIGTTVTAQYEEKGEKTLAGIAATAKGAK

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
4 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
5 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
6 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
7 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
8 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
9 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
10 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
11 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
12 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
13 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
14 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
15 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
16 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
17 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
18 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
19 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
20 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
21 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
22 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
23 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
24 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
25 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
26 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
27 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
28 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
29 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
30 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
31 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
32 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
33 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
34 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
35 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
36 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
37 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
38 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
40 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
41 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
43 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
44 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
45 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
46 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
47 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
48 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
49 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
50 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
51 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
52 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
53 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
54 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
55 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
56 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
57 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
58 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
59 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
60 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
61 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
62 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
63 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
64 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
65 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
66 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
67 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
68 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.47
Metatranscriptomes 7.75
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 86.82
Stem 0
Stem Tuber 0
Unclassified 1.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10044021 3300013296 Bacteria 4125
2 Ga0070670_100454685 3300005331 Bacteria 1135
3 Ga0070695_100027907 3300005545 Bacteria 3500
4 Ga0070695_100369497 3300005545 Bacteria 1079
5 Ga0070704_100089032 3300005549 Bacteria 2295
6 Ga0075431_100000721 3300006847 Bacteria 28516
7 Ga0105248_10392015 3300009177 Bacteria 1564
8 Ga0105237_10771965 3300009545 Bacteria 968
9 Ga0207670_10645750 3300025936 Bacteria 872
10 Ga0265337_1004690 3300028556 Bacteria 5620
11 Ga0265337_1045343 3300028556 Bacteria 1251
12 Ga0265319_1001792 3300028563 Bacteria 12292
13 Ga0265319_1042386 3300028563 Bacteria 1531
14 Ga0265334_10008638 3300028573 Bacteria 4323
15 Ga0265318_10001474 3300028577 Bacteria 13765
16 Ga0265318_10070063 3300028577 Bacteria 1300
17 Ga0265322_10000075 3300028654 Bacteria 47751
18 Ga0265336_10034233 3300028666 Bacteria 1571
19 Ga0265338_10000201 3300028800 Bacteria 112868
20 Ga0265338_10292869 3300028800 Bacteria 1186
21 Ga0265324_10002364 3300029957 Bacteria 9727
22 Ga0265330_10004818 3300031235 Bacteria 6802
23 Ga0265332_10062245 3300031238 Bacteria 1595
24 Ga0265328_10009300 3300031239 Bacteria 4007
25 Ga0265320_10005356 3300031240 Bacteria 8249
26 Ga0265320_10006659 3300031240 Bacteria 7258
27 Ga0265339_10037793 3300031249 Bacteria 2697
28 Ga0265339_10211904 3300031249 Bacteria 951
29 Ga0265331_10217284 3300031250 Bacteria 860
30 Ga0265327_10061921 3300031251 Bacteria 1907
31 Ga0265316_10002983 3300031344 Bacteria 17304
32 Ga0265316_10014793 3300031344 Bacteria 6850
33 Ga0265316_10047540 3300031344 Bacteria 3394
34 Ga0265313_10005496 3300031595 Bacteria 9297
35 Ga0265313_10008505 3300031595 Bacteria 6804
36 Ga0316579_10062195 3300031691 Bacteria 1758
37 Ga0316579_10106490 3300031691 Bacteria 1344
38 Ga0265314_10000492 3300031711 Bacteria 51206
39 Ga0265314_10255390 3300031711 Bacteria 1004
40 Ga0265342_10000670 3300031712 Bacteria 35691
41 Ga0265342_10012220 3300031712 Bacteria 5824
42 Ga0265342_10054645 3300031712 Bacteria 2372
43 Ga0265342_10076408 3300031712 Bacteria 1941
44 Ga0316576_10001695 3300031727 Bacteria 12074
45 Ga0316576_10013802 3300031727 Bacteria 5383
46 Ga0316576_10019057 3300031727 Bacteria 4696
47 Ga0316576_10033130 3300031727 Bacteria 3676
48 Ga0316576_10066717 3300031727 Bacteria 2647
49 Ga0316576_10389921 3300031727 Bacteria 1033
50 Ga0316578_10147598 3300031728 Bacteria 1417
51 Ga0316578_10178215 3300031728 Bacteria 1281
52 Ga0307405_10128447 3300031731 Bacteria 1747
53 Ga0316577_10000664 3300031733 Bacteria 14376
54 Ga0316577_10125908 3300031733 Unclassified 1441
55 Ga0316577_10328269 3300031733 Bacteria 868
56 Ga0307416_100008354 3300032002 Bacteria 6671
57 Ga0307411_10034210 3300032005 Bacteria 3160
58 Ga0307415_100248440 3300032126 Bacteria 1444
59 Ga0316593_10006050 3300032168 Bacteria 3242
60 Ga0316593_10006490 3300032168 Bacteria 3160
61 Ga0316592_1073654 3300033524 Bacteria 774
62 Ga0316592_1097849 3300033524 Bacteria 674
63 Ga0316586_1008486 3300033527 Bacteria 1525
64 Ga0316588_1004692 3300033528 Bacteria 2607
65 Ga0316587_1029430 3300033529 Bacteria 966
66 Ga0316596_1001793 3300033541 Bacteria 4465
67 Ga0316596_1009504 3300033541 Bacteria 2334
68 Ga0316596_1097715 3300033541 Bacteria 793
69 Ga0316574_0343586 3300035398 Bacteria 945
70 Ga0316574_0358169 3300035398 Bacteria 922
71 Ga0373927_0002179 3300035695 Bacteria 14387
72 Ga0373947_0174834 3300035725 Bacteria 1395
73 Ga0316582_0007098 3300036647 Bacteria 5948
74 Ga0316582_0039475 3300036647 Bacteria 2940
75 Ga0316582_0180205 3300036647 Bacteria 1437
76 Ga0316582_0603164 3300036647 Bacteria 756
77 Ga0316584_0116363 3300036712 Unclassified 1999
78 Ga0316584_0290926 3300036712 Bacteria 1185
79 Ga0373925_0050792 3300037068 Bacteria 3094
80 Ga0400484_03078 3300038725 Bacteria 4634
81 Ga0400490_03228 3300038726 Bacteria 13773
82 Ga0400490_33785 3300038726 Bacteria 1695
83 Ga0400491_09852 3300038727 Bacteria 5198
84 Ga0400488_17886 3300038741 Bacteria 3969
85 Ga0400488_25008 3300038741 Bacteria 1785
86 Ga0400488_46898 3300038741 Bacteria 3969
87 Ga0400483_000614 3300039062 Bacteria 1990
88 Ga0400483_039955 3300039062 Bacteria 9631
89 Ga0400483_146457 3300039062 Bacteria 1194
90 Ga0400483_192270 3300039062 Bacteria 4101
91 Ga0400483_235980 3300039062 Bacteria 1856
92 Ga0400483_261800 3300039062 Bacteria 1233
93 Ga0400489_32282 3300039093 Bacteria 123730
94 Ga0400489_46828 3300039093 Bacteria 3152
95 Ga0400489_70833 3300039093 Bacteria 1549
96 Ga0436360_0772339 3300039438 Bacteria 1965
97 Ga0436361_0078993 3300039447 Bacteria 1523
98 Ga0436362_0526578 3300039453 Bacteria 1652
99 Ga0451577_0063880 3300042876 Bacteria 3283
100 Ga0451577_0221392 3300042876 Bacteria 1711
101 Ga0451577_0319349 3300042876 Bacteria 1408
102 Ga0451577_0521487 3300042876 Bacteria 1079
103 Ga0453683_0006579 3300044673 Bacteria 7963
104 Ga0453683_0015923 3300044673 Bacteria 4859
105 Ga0453683_0092199 3300044673 Bacteria 1899
106 Ga0453683_0571596 3300044673 Bacteria 736
107 Ga0453684_0000893 3300044712 Bacteria 99593
108 Ga0453684_0021919 3300044712 Bacteria 9508
109 Ga0453684_0027265 3300044712 Bacteria 8200
110 Ga0453684_0057995 3300044712 Bacteria 5004
111 Ga0453684_0075996 3300044712 Bacteria 4219
112 Ga0453684_0092169 3300044712 Bacteria 3737
113 Ga0453684_0171209 3300044712 Bacteria 2559
114 Ga0453684_0216694 3300044712 Bacteria 2221
115 Ga0453684_0278571 3300044712 Bacteria 1908
116 Ga0453684_0334444 3300044712 Bacteria 1712
117 Ga0453684_0492808 3300044712 Bacteria 1358
118 Ga0453684_0760122 3300044712 Bacteria 1048
119 Ga0453684_1080186 3300044712 Bacteria 849
120 Ga0451576_0270259 3300045051 Bacteria 1777
121 Ga0495630_0402871 3300046517 Bacteria 1048
122 Ga0495634_0481102 3300046642 Bacteria 729
123 Ga0495635_0293764 3300046663 Bacteria 1090
124 Ga0495674_0013519 3300047319 Bacteria 7675
125 Ga0495674_0305672 3300047319 Bacteria 1298
126 Ga0495675_0442614 3300047444 Bacteria 753
127 Ga0495684_0017317 3300047471 Bacteria 5547
128 Ga0501077_0084103 3300049593 Bacteria 2017
129 2788436629 2786546940 Bacteria 6396474
130 Ga0157374_10044021
131 Ga0070670_100454685
132 Ga0070695_100027907
133 Ga0070695_100369497
134 Ga0070704_100089032
135 Ga0075431_100000721
136 Ga0105248_10392015
137 Ga0105237_10771965
138 Ga0207670_10645750
139 Ga0265337_1004690
140 Ga0265337_1045343
141 Ga0265319_1001792
142 Ga0265319_1042386
143 Ga0265334_10008638
144 Ga0265318_10001474
145 Ga0265318_10070063
146 Ga0265322_10000075
147 Ga0265336_10034233
148 Ga0265338_10000201
149 Ga0265338_10292869
150 Ga0265324_10002364
151 Ga0265330_10004818
152 Ga0265332_10062245
153 Ga0265328_10009300
154 Ga0265320_10005356
155 Ga0265320_10006659
156 Ga0265339_10037793
157 Ga0265339_10211904
158 Ga0265331_10217284
159 Ga0265327_10061921
160 Ga0265316_10002983
161 Ga0265316_10014793
162 Ga0265316_10047540
163 Ga0265313_10005496
164 Ga0265313_10008505
165 Ga0316579_10062195
166 Ga0316579_10106490
167 Ga0265314_10000492
168 Ga0265314_10255390
169 Ga0265342_10000670
170 Ga0265342_10012220
171 Ga0265342_10054645
172 Ga0265342_10076408
173 Ga0316576_10001695
174 Ga0316576_10013802
175 Ga0316576_10019057
176 Ga0316576_10033130
177 Ga0316576_10066717
178 Ga0316576_10389921
179 Ga0316578_10147598
180 Ga0316578_10178215
181 Ga0307405_10128447
182 Ga0316577_10000664
183 Ga0316577_10125908
184 Ga0316577_10328269
185 Ga0307416_100008354
186 Ga0307411_10034210
187 Ga0307415_100248440
188 Ga0316593_10006050
189 Ga0316593_10006490
190 Ga0316592_1073654
191 Ga0316592_1097849
192 Ga0316586_1008486
193 Ga0316588_1004692
194 Ga0316587_1029430
195 Ga0316596_1001793
196 Ga0316596_1009504
197 Ga0316596_1097715
198 Ga0316574_0343586
199 Ga0316574_0358169
200 Ga0373927_0002179
201 Ga0373947_0174834
202 Ga0316582_0007098
203 Ga0316582_0039475
204 Ga0316582_0180205
205 Ga0316582_0603164
206 Ga0316584_0116363
207 Ga0316584_0290926
208 Ga0373925_0050792
209 Ga0400484_03078
210 Ga0400490_03228
211 Ga0400490_33785
212 Ga0400491_09852
213 Ga0400488_17886
214 Ga0400488_25008
215 Ga0400488_46898
216 Ga0400483_000614
217 Ga0400483_039955
218 Ga0400483_146457
219 Ga0400483_192270
220 Ga0400483_235980
221 Ga0400483_261800
222 Ga0400489_32282
223 Ga0400489_46828
224 Ga0400489_70833
225 Ga0436360_0772339
226 Ga0436361_0078993
227 Ga0436362_0526578
228 Ga0451577_0063880
229 Ga0451577_0221392
230 Ga0451577_0319349
231 Ga0451577_0521487
232 Ga0453683_0006579
233 Ga0453683_0015923
234 Ga0453683_0092199
235 Ga0453683_0571596
236 Ga0453684_0000893
237 Ga0453684_0021919
238 Ga0453684_0027265
239 Ga0453684_0057995
240 Ga0453684_0075996
241 Ga0453684_0092169
242 Ga0453684_0171209
243 Ga0453684_0216694
244 Ga0453684_0278571
245 Ga0453684_0334444
246 Ga0453684_0492808
247 Ga0453684_0760122
248 Ga0453684_1080186
249 Ga0451576_0270259
250 Ga0495630_0402871
251 Ga0495634_0481102
252 Ga0495635_0293764
253 Ga0495674_0013519
254 Ga0495674_0305672
255 Ga0495675_0442614
256 Ga0495684_0017317
257 Ga0501077_0084103
258 2788436629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02607

B12-binding_2

B12 binding domain

4

78

0.96

PF02310

B12-binding

B12 binding domain

90

206

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y80-assembly1.cif.gz_A structure of a corrinoid (factor iiim)-binding protein from moorella thermoacetica 0.9282 60 183
1y80-assembly1.cif.gz_A structure of a corrinoid (factor iiim)-binding protein from moorella thermoacetica 0.9139 60 183
8ssd-assembly1.cif.gz_B methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8 0.9127 2 182
8ssd-assembly1.cif.gz_C methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8 0.9018 2 182
8sse-assembly1.cif.gz_A methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8 0.9002 2 182
ID Description Score Start End Superfamily
4jgiA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9383 64 183 3.40.50.280
1y80A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9282 60 183 3.40.50.280
af_A4HT60_767_916_3.40.50.280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9234 61 183 3.40.50.280
3ezxA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9197 65 183 3.40.50.280
1y80A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9139 60 183 3.40.50.280
ID Description Score Start End GO Terms
AF-A0A2N9NNB5-F1-model_v4 Dimethylamine corrinoid protein 1 0.9881 4 183 GO:0005829
GO:0008705
GO:0031419
GO:0046653
GO:0046872
GO:0050667
AF-A0A349H459-F1-model_v4 Cobalamin-binding protein 0.9857 2 183 GO:0005829
GO:0008705
GO:0031419
GO:0046653
GO:0046872
GO:0050667
AF-A0A0F9G0A7-F1-model_v4 B12-binding domain-containing protein 0.9816 2 182 GO:0003723
GO:0005829
GO:0008705
GO:0031419
GO:0046653
GO:0046872
GO:0050667
AF-A0A2D5Z6J7-F1-model_v4 Cobalamin-binding protein 0.9809 1 183 GO:0005829
GO:0008705
GO:0031419
GO:0046653
GO:0046872
GO:0050667
AF-K0NLU6-F1-model_v4 MttC1: predicted trimethylamine corrinoid protein 1 0.9788 2 182 GO:0005829
GO:0008705
GO:0031419
GO:0046653
GO:0046872
GO:0050667

Map