F139592

General Info

Members Datasets Scaffolds Average Seq Length
128 93 124 233

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0014684|Ga0501047_0014684_120_956
Length 278
Sequence LARGEDDSGAWCHGGPANPEIIAIQLRLAETASAFDQELAVPETNRLAGAVIAFDLDGTLVETAPDLIAALNWLLEQEGLAPLPLDQARPFIGRGAGWLIERGFVAASGSAPATARRQDLLDRFIARYRANIAEESRPFPGLLEALDRLRAAGARLCVCTNKRTDLSRTLLDALDMTRLFEAVVGPDLAPAAKPDPRHLETAVALAGGALPRAVMVGDAATDAGAARAAGAGLVLVSFGYTEIPAAELAPDVLIHHFDELPEACFRLLGACPGPDASL

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
3 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
4 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
35 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
36 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
37 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
59 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
62 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
63 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
67 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
68 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
69 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
70 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
79 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
83 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
84 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
85 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
90 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
91 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
92 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
93 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.88
Metatranscriptomes 0
Isolates 3.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.38
Nodule 0
Rhizoplane 1.56
Rhizosphere 81.25
Stem 0
Stem Tuber 0
Unclassified 7.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1001002 3300002737 Bacteria 17701
2 JGI25165J46597_1000608 3300003214 Bacteria 30527
3 JGI25153J46596_10038633 3300003215 Bacteria 1501
4 Ga0065165_1031004 3300005262 Bacteria 1696
5 Ga0070658_10209447 3300005327 Bacteria 1647
6 Ga0070658_10248604 3300005327 Bacteria 1508
7 Ga0070670_100000050 3300005331 Bacteria 132470
8 Ga0070680_100111498 3300005336 Bacteria 2277
9 Ga0070669_100005143 3300005353 Bacteria 9457
10 Ga0070671_100004825 3300005355 Bacteria 10721
11 Ga0070667_100010714 3300005367 Bacteria 7577
12 Ga0070667_100109865 3300005367 Bacteria 2390
13 Ga0070681_10373534 3300005458 Bacteria 1336
14 Ga0070665_100000819 3300005548 Bacteria 40675
15 Ga0070665_100000923 3300005548 Bacteria 37614
16 Ga0068855_100056559 3300005563 Bacteria 4602
17 Ga0068855_100279655 3300005563 Bacteria 1854
18 Ga0068855_100420161 3300005563 Bacteria 1463
19 Ga0068859_100000177 3300005617 Bacteria 62179
20 Ga0068864_100000275 3300005618 Bacteria 45877
21 Ga0068863_100005365 3300005841 Bacteria 12642
22 Ga0068858_100004751 3300005842 Bacteria 13300
23 Ga0068858_100012403 3300005842 Bacteria 8036
24 Ga0068860_100033504 3300005843 Bacteria 4928
25 Ga0068862_100018447 3300005844 Bacteria 5811
26 Ga0070717_10754410 3300006028 Bacteria 885
27 Ga0097620_100000177 3300006931 Bacteria 62179
28 Ga0105240_10000522 3300009093 Bacteria 70833
29 Ga0105240_10002671 3300009093 Bacteria 28387
30 Ga0105240_10014967 3300009093 Bacteria 10569
31 Ga0105240_10137394 3300009093 Bacteria 2926
32 Ga0105240_10173937 3300009093 Bacteria 2547
33 Ga0105242_10218067 3300009176 Bacteria 1704
34 Ga0105248_10002192 3300009177 Bacteria 21611
35 Ga0105248_10002814 3300009177 Bacteria 19315
36 Ga0105238_10043137 3300009551 Bacteria 4564
37 Ga0157369_10345075 3300013105 Bacteria 1547
38 Ga0157372_10094366 3300013307 Bacteria 3407
39 Ga0163163_10003088 3300014325 Bacteria 14114
40 Ga0157379_10000956 3300014968 Bacteria 23412
41 Ga0157379_10007852 3300014968 Bacteria 9242
42 Ga0213872_10003279 3300021361 Bacteria 9033
43 Ga0209437_100248 3300025233 Bacteria 86351
44 Ga0209233_1000241 3300025261 Bacteria 90643
45 Ga0209257_1000561 3300025304 Bacteria 63214
46 Ga0207705_10368159 3300025909 Bacteria 1109
47 Ga0207705_10510665 3300025909 Bacteria 934
48 Ga0207707_10098211 3300025912 Bacteria 2560
49 Ga0207695_10001134 3300025913 Bacteria 46205
50 Ga0207695_10024872 3300025913 Bacteria 6721
51 Ga0207695_10044231 3300025913 Bacteria 4738
52 Ga0207695_10081536 3300025913 Bacteria 3273
53 Ga0207695_10094998 3300025913 Bacteria 2987
54 Ga0207681_10002898 3300025923 Bacteria 10844
55 Ga0207694_10239147 3300025924 Bacteria 1484
56 Ga0207650_10000133 3300025925 Bacteria 90953
57 Ga0207644_10011959 3300025931 Bacteria 5755
58 Ga0207686_10037176 3300025934 Bacteria 2936
59 Ga0207704_10004346 3300025938 Bacteria 6480
60 Ga0207711_10003297 3300025941 Bacteria 14029
61 Ga0207711_10006999 3300025941 Bacteria 9462
62 Ga0207667_10100153 3300025949 Bacteria 2989
63 Ga0207667_10298709 3300025949 Bacteria 1645
64 Ga0207667_10720568 3300025949 Bacteria 999
65 Ga0207668_10000078 3300025972 Bacteria 73213
66 Ga0207658_10021635 3300025986 Bacteria 4467
67 Ga0207658_10100312 3300025986 Bacteria 2266
68 Ga0207703_10003261 3300026035 Bacteria 13626
69 Ga0207703_10006645 3300026035 Bacteria 9224
70 Ga0207641_10062389 3300026088 Bacteria 3180
71 Ga0207676_10005547 3300026095 Bacteria 8928
72 Ga0207676_10336542 3300026095 Bacteria 1391
73 Ga0207675_100389931 3300026118 Bacteria 1371
74 Ga0207675_100404692 3300026118 Bacteria 1345
75 Ga0268266_10001334 3300028379 Bacteria 29886
76 Ga0268266_10006847 3300028379 Bacteria 10381
77 Ga0268265_10027351 3300028380 Bacteria 4070
78 Ga0268265_10103940 3300028380 Bacteria 2301
79 Ga0268264_10058759 3300028381 Bacteria 3221
80 Ga0265338_10005675 3300028800 Bacteria 16162
81 Ga0307511_10056751 3300030521 Bacteria 3056
82 Ga0265327_10001063 3300031251 Bacteria 38305
83 Ga0265327_10004087 3300031251 Bacteria 13190
84 Ga0307513_10002572 3300031456 Bacteria 25075
85 Ga0316578_10021430 3300031728 Bacteria 3587
86 Ga0307516_10000004 3300031730 Bacteria 367451
87 Ga0307414_10456793 3300032004 Bacteria 1121
88 Ga0307411_10258121 3300032005 Bacteria 1375
89 Ga0307510_10110187 3300033180 Bacteria 2499
90 Ga0373944_0014693 3300035089 Bacteria 2189
91 Ga0373945_0082805 3300035116 Bacteria 1232
92 Ga0373927_0000409 3300035695 Bacteria 33052
93 Ga0316584_0163095 3300036712 Bacteria 1655
94 Ga0373925_0000136 3300037068 Bacteria 77912
95 Ga0395899_0002138 3300037312 Bacteria 16246
96 Ga0395899_0448298 3300037312 Bacteria 845
97 Ga0395900_0000010 3300037418 Bacteria 461364
98 Ga0395900_0343688 3300037418 Bacteria 1467
99 Ga0395898_0085308 3300037466 Bacteria 3043
100 Ga0395905_0018727 3300037471 Bacteria 6567
101 Ga0395905_0039428 3300037471 Bacteria 4432
102 Ga0395905_0048847 3300037471 Bacteria 3964
103 Ga0395905_0060652 3300037471 Bacteria 3537
104 Ga0395901_0000007 3300038443 Bacteria 497408
105 Ga0436365_1905250 3300039437 Bacteria 1856
106 Ga0436360_0922575 3300039438 Bacteria 5078
107 Ga0436361_0113313 3300039447 Bacteria 15671
108 Ga0466961_0463158 3300044693 Bacteria 767
109 Ga0466957_0469994 3300044842 Bacteria 869
110 Ga0496107_0098195 3300048910 Bacteria 2145
111 Ga0496115_0182252 3300048918 Bacteria 1736
112 Ga0496125_0029146 3300048928 Bacteria 4967
113 Ga0501032_0168233 3300049569 Bacteria 1438
114 Ga0501033_0006219 3300049570 Bacteria 9359
115 Ga0501033_0124833 3300049570 Bacteria 1866
116 Ga0501037_0085741 3300049573 Bacteria 2280
117 Ga0501047_0014684 3300049581 Bacteria 7453
118 Ga0501044_0006448 3300049823 Bacteria 12959
119 Ga0501044_0475218 3300049823 Bacteria 1154
120 Ga0500643_004115 3300053087 Bacteria 6698
121 Ga0500562_001050 3300053108 Bacteria 6776
122 Ga0500562_001295 3300053108 Bacteria 6169
123 Ga0500595_071774 3300053119 Bacteria 1026
124 Ga0500645_001688 3300053730 Bacteria 10789

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005353 Ga0070669_100005143 Ga0070669_1000051439 221
2 3300005355 Ga0070671_100004825 Ga0070671_1000048254 221
3 3300005367 Ga0070667_100109865 Ga0070667_1001098652 221
4 3300005617 Ga0068859_100000177 Ga0068859_10000017758 221
5 3300005841 Ga0068863_100005365 Ga0068863_1000053653 221
6 3300005842 Ga0068858_100012403 Ga0068858_1000124034 221
7 3300005843 Ga0068860_100033504 Ga0068860_1000335043 221
8 3300006931 Ga0097620_100000177 Ga0097620_10000017758 221
9 3300009177 Ga0105248_10002814 Ga0105248_1000281417 221
10 3300014325 Ga0163163_10003088 Ga0163163_100030888 221
11 3300014968 Ga0157379_10000956 Ga0157379_100009564 221
12 3300025931 Ga0207644_10011959 Ga0207644_100119594 221
13 3300025941 Ga0207711_10006999 Ga0207711_100069992 221
14 3300025986 Ga0207658_10100312 Ga0207658_101003122 221
15 3300026035 Ga0207703_10006645 Ga0207703_100066452 221
16 3300026088 Ga0207641_10062389 Ga0207641_100623893 221
17 3300026118 Ga0207675_100389931 Ga0207675_1003899312 221
18 3300028381 Ga0268264_10058759 Ga0268264_100587592 221
19 3300037312 Ga0395899_0002138 Ga0395899_0002138_8566_9297 222
20 3300037418 Ga0395900_0000010 Ga0395900_0000010_348405_349136 222
21 3300037466 Ga0395898_0085308 Ga0395898_0085308_314_1045 222
22 3300037471 Ga0395905_0018727 Ga0395905_0018727_1871_2602 222
23 3300038443 Ga0395901_0000007 Ga0395901_0000007_432769_433500 222
24 3300009551 Ga0105238_10043137 Ga0105238_100431374 224
25 3300025924 Ga0207694_10239147 Ga0207694_102391472 224
26 3300030521 Ga0307511_10056751 Ga0307511_100567512 225
27 3300031728 Ga0316578_10021430 Ga0316578_100214303 225
28 3300036712 Ga0316584_0163095 Ga0316584_0163095_481_1173 225
29 3300005844 Ga0068862_100018447 Ga0068862_1000184472 226
30 3300028380 Ga0268265_10027351 Ga0268265_100273513 226
31 3300037418 Ga0395900_0343688 Ga0395900_0343688_730_1431 226
32 3300048910 Ga0496107_0098195 Ga0496107_0098195_515_1204 226
33 3300048918 Ga0496115_0182252 Ga0496115_0182252_908_1597 226
34 3300049570 Ga0501033_0006219 Ga0501033_0006219_7178_7867 226
35 3300049573 Ga0501037_0085741 Ga0501037_0085741_228_917 226
36 3300049823 Ga0501044_0006448 Ga0501044_0006448_10802_11491 226
37 3300005327 Ga0070658_10209447 Ga0070658_102094472 227
38 3300006028 Ga0070717_10754410 Ga0070717_107544101 227
39 3300025938 Ga0207704_10004346 Ga0207704_100043462 227
40 3300026095 Ga0207676_10336542 Ga0207676_103365422 227
41 3300009177 Ga0105248_10002192 Ga0105248_1000219217 228
42 3300025941 Ga0207711_10003297 Ga0207711_100032974 228
43 3300031456 Ga0307513_10002572 Ga0307513_100025723 228
44 3300005336 Ga0070680_100111498 Ga0070680_1001114984 229
45 3300005367 Ga0070667_100010714 Ga0070667_1000107145 229
46 3300005458 Ga0070681_10373534 Ga0070681_103735342 229
47 3300005548 Ga0070665_100000819 Ga0070665_10000081940 229
48 3300005563 Ga0068855_100056559 Ga0068855_1000565593 229
49 3300009093 Ga0105240_10014967 Ga0105240_100149675 229
50 3300009093 Ga0105240_10137394 Ga0105240_101373942 229
51 3300013105 Ga0157369_10345075 Ga0157369_103450752 229
52 3300013307 Ga0157372_10094366 Ga0157372_100943663 229
53 3300025909 Ga0207705_10510665 Ga0207705_105106652 229
54 3300025912 Ga0207707_10098211 Ga0207707_100982112 229
55 3300025913 Ga0207695_10044231 Ga0207695_100442312 229
56 3300025913 Ga0207695_10081536 Ga0207695_100815362 229
57 3300025913 Ga0207695_10094998 Ga0207695_100949982 229
58 3300025949 Ga0207667_10298709 Ga0207667_102987092 229
59 3300025972 Ga0207668_10000078 Ga0207668_1000007837 229
60 3300025986 Ga0207658_10021635 Ga0207658_100216354 229
61 3300028379 Ga0268266_10001334 Ga0268266_1000133425 229
62 3300028380 Ga0268265_10103940 Ga0268265_101039402 229
63 3300053087 Ga0500643_004115 Ga0500643_004115_3667_4368 229
64 3300053119 Ga0500595_071774 Ga0500595_071774_276_974 229
65 3300005327 Ga0070658_10248604 Ga0070658_102486042 230
66 3300005331 Ga0070670_100000050 Ga0070670_10000005053 230
67 3300005548 Ga0070665_100000923 Ga0070665_10000092319 230
68 3300005563 Ga0068855_100279655 Ga0068855_1002796552 230
69 3300005563 Ga0068855_100420161 Ga0068855_1004201613 230
70 3300005618 Ga0068864_100000275 Ga0068864_10000027513 230
71 3300005842 Ga0068858_100004751 Ga0068858_1000047515 230
72 3300009093 Ga0105240_10000522 Ga0105240_100005227 230
73 3300009093 Ga0105240_10173937 Ga0105240_101739373 230
74 3300009176 Ga0105242_10218067 Ga0105242_102180672 230
75 3300014968 Ga0157379_10007852 Ga0157379_1000785211 230
76 3300025909 Ga0207705_10368159 Ga0207705_103681592 230
77 3300025913 Ga0207695_10001134 Ga0207695_100011347 230
78 3300025925 Ga0207650_10000133 Ga0207650_1000013310 230
79 3300025934 Ga0207686_10037176 Ga0207686_100371762 230
80 3300025949 Ga0207667_10100153 Ga0207667_101001532 230
81 3300025949 Ga0207667_10720568 Ga0207667_107205681 230
82 3300026035 Ga0207703_10003261 Ga0207703_1000326110 230
83 3300026095 Ga0207676_10005547 Ga0207676_1000554710 230
84 3300026118 Ga0207675_100404692 Ga0207675_1004046921 230
85 3300028379 Ga0268266_10006847 Ga0268266_100068479 230
86 3300035089 Ga0373944_0014693 Ga0373944_0014693_1291_1992 230
87 3300035116 Ga0373945_0082805 Ga0373945_0082805_468_1169 230
88 3300035695 Ga0373927_0000409 Ga0373927_0000409_31398_32099 230
89 3300037068 Ga0373925_0000136 Ga0373925_0000136_43806_44507 230
90 3300037312 Ga0395899_0448298 Ga0395899_0448298_60_773 230
91 3300037471 Ga0395905_0039428 Ga0395905_0039428_3026_3739 230
92 3300037471 Ga0395905_0048847 Ga0395905_0048847_539_1240 230
93 3300037471 Ga0395905_0060652 Ga0395905_0060652_2484_3197 230
94 3300039437 Ga0436365_1905250 Ga0436365_1905250_126_827 230
95 3300044693 Ga0466961_0463158 Ga0466961_0463158_27_737 230
96 3300044842 Ga0466957_0469994 Ga0466957_0469994_144_854 230
97 3300049569 Ga0501032_0168233 Ga0501032_0168233_77_808 231
98 iso_pu_bacteria 2643221598 2644002137 231
99 iso_pu_bacteria 2643221614 2644085547 231
100 iso_pu_bacteria 2643221661 2644343099 231
101 iso_pu_bacteria 2643221666 2644366399 231
102 3300021361 Ga0213872_10003279 Ga0213872_100032794 232
103 3300032005 Ga0307411_10258121 Ga0307411_102581212 232
104 3300039447 Ga0436361_0113313 Ga0436361_0113313_10297_11094 232
105 3300053730 Ga0500645_001688 Ga0500645_001688_4918_5625 232
106 3300003215 JGI25153J46596_10038633 JGI25153J46596_100386333 233
107 3300005262 Ga0065165_1031004 Ga0065165_10310042 233
108 3300025304 Ga0209257_1000561 Ga0209257_100056120 233
109 3300049823 Ga0501044_0475218 Ga0501044_0475218_250_960 233
110 3300002737 JGI25162J39368_1001002 JGI25162J39368_10010028 235
111 3300003214 JGI25165J46597_1000608 JGI25165J46597_100060822 235
112 3300009093 Ga0105240_10002671 Ga0105240_100026713 235
113 3300025233 Ga0209437_100248 Ga0209437_10024836 235
114 3300025261 Ga0209233_1000241 Ga0209233_100024141 235
115 3300025913 Ga0207695_10024872 Ga0207695_100248723 235
116 3300025923 Ga0207681_10002898 Ga0207681_100028988 235
117 3300028800 Ga0265338_10005675 Ga0265338_1000567512 235
118 3300031251 Ga0265327_10001063 Ga0265327_1000106330 235
119 3300031251 Ga0265327_10004087 Ga0265327_100040877 235
120 3300031730 Ga0307516_10000004 Ga0307516_10000004165 235
121 3300032004 Ga0307414_10456793 Ga0307414_104567932 235
122 3300033180 Ga0307510_10110187 Ga0307510_101101873 235
123 3300039438 Ga0436360_0922575 Ga0436360_0922575_4190_4909 235
124 3300048928 Ga0496125_0029146 Ga0496125_0029146_725_1438 235
125 3300049570 Ga0501033_0124833 Ga0501033_0124833_1073_1798 235
126 3300049581 Ga0501047_0014684 Ga0501047_0014684_120_956 235
127 3300053108 Ga0500562_001050 Ga0500562_001050_3158_3874 235
128 3300053108 Ga0500562_001295 Ga0500562_001295_2904_3626 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

52

236

0.96

PF13242

Hydrolase_like

HAD-hyrolase-like

190

260

0.91

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

50

230

0.84

PF12710

HAD

haloacid dehalogenase-like hydrolase

52

236

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hsz-assembly2.cif.gz_B crystal structure of a predicted phosphoglycolate phosphatase (hs_0176) from haemophilus somnus 129pt at 1.90 a resolution 0.9242 7 220
2yy6-assembly2.cif.gz_B crystal structure of the phosphoglycolate phosphatase from aquifex aeolicus vf5 0.923 10 220
2yy6-assembly2.cif.gz_B crystal structure of the phosphoglycolate phosphatase from aquifex aeolicus vf5 0.9018 10 220
2nyv-assembly1.cif.gz_A x-ray crystal structure of a phosphoglycolate phosphatase from aquifex aeolicus 0.8972 8 219
2hdo-assembly1.cif.gz_A crystal structure of putative phosphoglycolate phosphatase (np_784602.1) from lactobacillus plantarum at 1.50 a resolution 0.8856 8 219
ID Description Score Start End Superfamily
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9579 96 209 3.40.50.1000
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9265 96 209 3.40.50.1000
2hszB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9251 91 220 3.40.50.1000
4ex7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9063 10 223 3.40.50.1000
2hi0B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9058 92 221 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A4Q1HLW3-F1-model_v4 Phosphoglycolate phosphatase (PGP) (PGPase) (EC 3.1.3.18) 0.9828 1 225 GO:0005829
GO:0005975
GO:0006281
GO:0008967
GO:0046295
GO:0046872
AF-A0A059DMJ1-F1-model_v4 Phosphoglycolate phosphatase (PGP) (PGPase) (EC 3.1.3.18) 0.9779 7 225 GO:0005829
GO:0005975
GO:0006281
GO:0008967
GO:0046295
GO:0046872
AF-A0A1T4MJV3-F1-model_v4 phosphoglycolate phosphatase (EC 3.1.3.18) 0.9767 13 229 GO:0005829
GO:0006281
GO:0008967
AF-A0A7W2GQF7-F1-model_v4 Phosphoglycolate phosphatase (PGP) (PGPase) (EC 3.1.3.18) 0.9758 8 227 GO:0005829
GO:0005975
GO:0006281
GO:0008967
GO:0046295
GO:0046872
AF-A0A127EWF2-F1-model_v4 Phosphoglycolate phosphatase (PGP) (PGPase) (EC 3.1.3.18) 0.9743 10 228 GO:0005829
GO:0005975
GO:0006281
GO:0008967
GO:0046295
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.74 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map