F135034

General Info

Members Datasets Scaffolds Average Seq Length
127 108 254 154

Family's Representative Sequence

Representative Sequence 3300035170|Ga0373943_0450042|Ga0373943_0450042_99_593
Length 164
Sequence MTTPAGPHRSDTDRIEKQITLRAPVARVWKALTDSKEFGAWFRVNLDGQFKPGGRIRGNITYPGYEHLVMDVTVERMDRERLFSFRWHPAAIDPKRDYDKEPTTLVEFRLETIDAGGRPDGGTRLTVVESGFDALPPDRRQEALRMNSGGWEIQVENIKTHVGG

Samples

Sample ID Description Type Environment
1 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
29 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
30 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
39 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
40 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
41 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
42 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
43 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
44 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
45 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
46 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
47 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
48 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
49 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
50 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
51 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
52 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
53 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
54 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
55 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
56 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
57 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
58 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
59 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
60 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
61 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
62 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
63 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
64 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
65 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
66 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
67 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
68 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
69 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
70 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
71 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
72 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
73 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
74 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
75 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
76 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
77 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
78 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
79 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
80 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
81 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
82 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
83 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
84 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
85 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
86 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
87 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
88 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
91 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
92 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
93 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
94 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
95 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
96 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
97 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
98 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
99 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
100 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
101 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
102 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
103 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
104 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
105 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
106 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
107 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
108 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.94
Nodule 0
Rhizoplane 3.94
Rhizosphere 85.04
Stem 0
Stem Tuber 0
Unclassified 21.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373943_0450042 3300035170 Bacteria 748
2 rootH1_10333116 3300003323 Bacteria 1491
3 Ga0065707_10162799 3300005295 Unclassified 1548
4 Ga0070674_100400867 3300005356 Bacteria 1121
5 Ga0070673_100271653 3300005364 Bacteria 1484
6 Ga0070705_100015444 3300005440 Bacteria 3949
7 Ga0070705_101526856 3300005440 Bacteria 560
8 Ga0070694_100620286 3300005444 Bacteria 873
9 Ga0070708_100737317 3300005445 Bacteria 927
10 Ga0070708_100854010 3300005445 Bacteria 855
11 Ga0068867_102204464 3300005459 Unclassified 523
12 Ga0070706_100032369 3300005467 Bacteria 4822
13 Ga0070707_100643561 3300005468 Bacteria 1023
14 Ga0070698_100000807 3300005471 Bacteria 34196
15 Ga0070698_100202347 3300005471 Bacteria 1921
16 Ga0070699_100095935 3300005518 Bacteria 2597
17 Ga0070699_100293614 3300005518 Bacteria 1458
18 Ga0070697_100011589 3300005536 Bacteria 6889
19 Ga0070697_101451307 3300005536 Bacteria 613
20 Ga0070695_100647927 3300005545 Bacteria 834
21 Ga0070704_100015632 3300005549 Bacteria 4773
22 Ga0068859_101849421 3300005617 Unclassified 667
23 Ga0068862_101183991 3300005844 Bacteria 762
24 Ga0081540_1087926 3300005983 Bacteria 1375
25 Ga0075362_10318820 3300006177 Unclassified 774
26 Ga0075429_100550695 3300006880 Bacteria 1011
27 Ga0075436_100065249 3300006914 Bacteria 2517
28 Ga0075436_100071776 3300006914 Bacteria 2394
29 Ga0097620_101848689 3300006931 Unclassified 667
30 Ga0111539_10001970 3300009094 Bacteria 27408
31 Ga0111539_10004591 3300009094 Bacteria 18046
32 Ga0111539_11594005 3300009094 Bacteria 757
33 Ga0105245_10008959 3300009098 Bacteria 8726
34 Ga0114129_10212303 3300009147 Bacteria 2616
35 Ga0105241_10016556 3300009174 Bacteria 5408
36 Ga0157379_10226035 3300014968 Bacteria 1696
37 Ga0157376_10546213 3300014969 Bacteria 1146
38 Ga0207685_10529905 3300025905 Bacteria 624
39 Ga0207705_10588918 3300025909 Bacteria 865
40 Ga0207684_10003809 3300025910 Bacteria 14546
41 Ga0207654_10007619 3300025911 Bacteria 5458
42 Ga0207646_11158174 3300025922 Bacteria 679
43 Ga0207687_10011061 3300025927 Bacteria 5899
44 Ga0207700_10421129 3300025928 Unclassified 1173
45 Ga0207667_10080629 3300025949 Bacteria 3372
46 Ga0207428_10016729 3300027907 Bacteria 6308
47 Ga0207428_10064136 3300027907 Bacteria 2901
48 Ga0307515_10189815 3300028794 Bacteria 1970
49 Ga0307513_10246235 3300031456 Bacteria 1587
50 Ga0307410_10388051 3300031852 Bacteria 1125
51 Ga0307407_10016806 3300031903 Bacteria 3652
52 Ga0307407_10129076 3300031903 Unclassified 1614
53 Ga0307409_100136710 3300031995 Bacteria 2104
54 Ga0307416_101366019 3300032002 Unclassified 814
55 Ga0307414_10071999 3300032004 Bacteria 2496
56 Ga0307411_10037523 3300032005 Bacteria 3048
57 Ga0307411_10826088 3300032005 Unclassified 818
58 Ga0307411_12039778 3300032005 Bacteria 536
59 Ga0373935_0175514 3300035692 Bacteria 1468
60 Ga0373947_0148307 3300035725 Bacteria 1509
61 Ga0373925_0000867 3300037068 Bacteria 27634
62 Ga0436365_0638264 3300039437 Unclassified 724
63 Ga0436361_0403783 3300039447 Bacteria 3140
64 Ga0436361_1015461 3300039447 Bacteria 1216
65 Ga0436363_0364400 3300039450 Bacteria 582
66 Ga0451802_1311527 3300041460 Bacteria 1096
67 Ga0451807_1996806 3300041486 Bacteria 1152
68 Ga0451837_1754400 3300041494 Bacteria 732
69 Ga0466959_0000503 3300045049 Bacteria 22685
70 Ga0451576_0101889 3300045051 Bacteria 2986
71 Ga0451576_0239259 3300045051 Bacteria 1896
72 Ga0495629_0000003 3300046459 Bacteria 529162
73 Ga0495638_0006030 3300046460 Bacteria 8872
74 Ga0495653_0142606 3300046463 Unclassified 1683
75 Ga0495580_0711988 3300046472 Bacteria 656
76 Ga0495605_0232070 3300046474 Bacteria 795
77 Ga0495639_0000369 3300046475 Bacteria 21729
78 Ga0495662_0005578 3300046476 Bacteria 6295
79 Ga0495594_0067024 3300046499 Bacteria 1992
80 Ga0495630_0000017 3300046517 Bacteria 191957
81 Ga0495666_0000283 3300046526 Bacteria 22189
82 Ga0495640_0198008 3300046533 Unclassified 1274
83 Ga0495586_0000343 3300046535 Bacteria 29189
84 Ga0495622_0052950 3300046557 Unclassified 1883
85 Ga0495635_0000526 3300046663 Bacteria 24261
86 Ga0495588_0180344 3300046674 Unclassified 1116
87 Ga0495647_0061640 3300046681 Bacteria 1481
88 Ga0495658_0171892 3300046683 Bacteria 1341
89 Ga0495658_0352829 3300046683 Bacteria 935
90 Ga0495613_0594000 3300046689 Unclassified 737
91 Ga0495624_0046327 3300046690 Bacteria 2765
92 Ga0495600_0048708 3300046809 Bacteria 2764
93 Ga0495581_0041625 3300047315 Unclassified 2659
94 Ga0495676_0024801 3300047321 Bacteria 5183
95 Ga0495680_0014438 3300047322 Bacteria 6839
96 Ga0495684_0002416 3300047471 Bacteria 14884
97 Ga0496103_0532854 3300048906 Bacteria 750
98 Ga0496104_0303404 3300048907 Bacteria 1509
99 Ga0496112_0399715 3300048915 Bacteria 1314
100 Ga0496117_0013538 3300048920 Bacteria 7111
101 Ga0496118_0000784 3300048921 Bacteria 50942
102 Ga0496121_0035010 3300048924 Bacteria 4507
103 Ga0501033_1102569 3300049570 Unclassified 528
104 Ga0501043_0844366 3300049579 Unclassified 660
105 Ga0501068_0457717 3300049584 Unclassified 826
106 Ga0501075_0224179 3300049591 Unclassified 1434
107 Ga0501076_0123764 3300049592 Bacteria 2094
108 Ga0501077_0202485 3300049593 Unclassified 1261
109 Ga0501238_005367 3300049671 Bacteria 1624
110 Ga0501079_0946391 3300049741 Unclassified 678
111 Ga0501083_0154255 3300049744 Unclassified 1504
112 nmdc:mga03683_135071_c1 3300050489 Unclassified 1106
113 nmdc:mga05p37_579275_c1 3300050507 Bacteria 1271
114 nmdc:mga09592_145933_c1 3300050508 Bacteria 2040
115 nmdc:mga06r32_49443_c1 3300050510 Bacteria 4020
116 nmdc:mga08y16_131576_c1 3300050511 Unclassified 2602
117 nmdc:mga08y16_194318_c1 3300050511 Bacteria 2104
118 nmdc:mga08y16_32767_c1 3300050511 Bacteria 5463
119 nmdc:mga08x19_54018_c1 3300050514 Bacteria 2585
120 nmdc:mga08x19_89713_c1 3300050514 Bacteria 2028
121 Ga0500566_0001184 3300053094 Bacteria 15212
122 Ga0500568_0007624 3300053139 Bacteria 5289
123 Ga0500619_000144 3300053154 Bacteria 17371
124 Ga0501084_0209060 3300054114 Bacteria 1647
125 Ga0501082_0175432 3300060353 Bacteria 1863
126 Ga0501082_0948391 3300060353 Unclassified 752
127 Ga0530510_0247910 3300061734 Unclassified 1327
128 Ga0373943_0450042
129 rootH1_10333116
130 Ga0065707_10162799
131 Ga0070674_100400867
132 Ga0070673_100271653
133 Ga0070705_100015444
134 Ga0070705_101526856
135 Ga0070694_100620286
136 Ga0070708_100737317
137 Ga0070708_100854010
138 Ga0068867_102204464
139 Ga0070706_100032369
140 Ga0070707_100643561
141 Ga0070698_100000807
142 Ga0070698_100202347
143 Ga0070699_100095935
144 Ga0070699_100293614
145 Ga0070697_100011589
146 Ga0070697_101451307
147 Ga0070695_100647927
148 Ga0070704_100015632
149 Ga0068859_101849421
150 Ga0068862_101183991
151 Ga0081540_1087926
152 Ga0075362_10318820
153 Ga0075429_100550695
154 Ga0075436_100065249
155 Ga0075436_100071776
156 Ga0097620_101848689
157 Ga0111539_10001970
158 Ga0111539_10004591
159 Ga0111539_11594005
160 Ga0105245_10008959
161 Ga0114129_10212303
162 Ga0105241_10016556
163 Ga0157379_10226035
164 Ga0157376_10546213
165 Ga0207685_10529905
166 Ga0207705_10588918
167 Ga0207684_10003809
168 Ga0207654_10007619
169 Ga0207646_11158174
170 Ga0207687_10011061
171 Ga0207700_10421129
172 Ga0207667_10080629
173 Ga0207428_10016729
174 Ga0207428_10064136
175 Ga0307515_10189815
176 Ga0307513_10246235
177 Ga0307410_10388051
178 Ga0307407_10016806
179 Ga0307407_10129076
180 Ga0307409_100136710
181 Ga0307416_101366019
182 Ga0307414_10071999
183 Ga0307411_10037523
184 Ga0307411_10826088
185 Ga0307411_12039778
186 Ga0373935_0175514
187 Ga0373947_0148307
188 Ga0373925_0000867
189 Ga0436365_0638264
190 Ga0436361_0403783
191 Ga0436361_1015461
192 Ga0436363_0364400
193 Ga0451802_1311527
194 Ga0451807_1996806
195 Ga0451837_1754400
196 Ga0466959_0000503
197 Ga0451576_0101889
198 Ga0451576_0239259
199 Ga0495629_0000003
200 Ga0495638_0006030
201 Ga0495653_0142606
202 Ga0495580_0711988
203 Ga0495605_0232070
204 Ga0495639_0000369
205 Ga0495662_0005578
206 Ga0495594_0067024
207 Ga0495630_0000017
208 Ga0495666_0000283
209 Ga0495640_0198008
210 Ga0495586_0000343
211 Ga0495622_0052950
212 Ga0495635_0000526
213 Ga0495588_0180344
214 Ga0495647_0061640
215 Ga0495658_0171892
216 Ga0495658_0352829
217 Ga0495613_0594000
218 Ga0495624_0046327
219 Ga0495600_0048708
220 Ga0495581_0041625
221 Ga0495676_0024801
222 Ga0495680_0014438
223 Ga0495684_0002416
224 Ga0496103_0532854
225 Ga0496104_0303404
226 Ga0496112_0399715
227 Ga0496117_0013538
228 Ga0496118_0000784
229 Ga0496121_0035010
230 Ga0501033_1102569
231 Ga0501043_0844366
232 Ga0501068_0457717
233 Ga0501075_0224179
234 Ga0501076_0123764
235 Ga0501077_0202485
236 Ga0501238_005367
237 Ga0501079_0946391
238 Ga0501083_0154255
239 nmdc:mga03683_135071_c1
240 nmdc:mga05p37_579275_c1
241 nmdc:mga09592_145933_c1
242 nmdc:mga06r32_49443_c1
243 nmdc:mga08y16_131576_c1
244 nmdc:mga08y16_194318_c1
245 nmdc:mga08y16_32767_c1
246 nmdc:mga08x19_54018_c1
247 nmdc:mga08x19_89713_c1
248 Ga0500566_0001184
249 Ga0500568_0007624
250 Ga0500619_000144
251 Ga0501084_0209060
252 Ga0501082_0175432
253 Ga0501082_0948391
254 Ga0530510_0247910

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

22

163

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.8549 9 151
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.846 12 155
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.8353 9 156
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.8125 12 155
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.8037 12 148
ID Description Score Start End Superfamily
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8134 10 155 3.30.530.20
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8037 12 148 3.30.530.20
3q6aA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7892 13 145 3.30.530.20
af_Q8BK64_207_336_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7871 12 152 3.30.530.20
3f08B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7815 12 156 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A5E7G1E5-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9902 11 155
AF-A0A0D0MNH8-F1-model_v4 Vanillate O-demethylase oxidoreductase VanB 0.9885 74 150 GO:0008168
GO:0032259
AF-A0A3G7TUA0-F1-model_v4 Aha1 domain superfamily 0.9877 11 154
AF-A0A2K4G3G9-F1-model_v4 Vanillate O-demethylase oxidoreductase VanB 0.9874 11 155 GO:0008168
GO:0032259
AF-A0A1Q7KFF9-F1-model_v4 Vanillate O-demethylase oxidoreductase VanB 0.9865 11 154 GO:0008168
GO:0032259

Map