F134908

General Info

Members Datasets Scaffolds Average Seq Length
127 102 127 339

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10014092|Ga0307516_100140923
Length 373
Sequence MTRSMTNMLKVLGLCGAVALAAPSAARADNTELRIASLAPSGSPWMEVLDKAAAETKDKTAGRVSFKYFEGGQQGDERDFVRKIKLGQLDGAAVTAVGLSMIDESIRVLELPMMFQSAEELDYVADKLWPYFQKKFETKGFKLQDRGEVGWVYFLSKAKIEKLADLRGQKLWLWGDDQLVGAVFKKLGLNGVPLGVPEVDGNLTSGKIDACYSSPLAAVALQWYSKVKFMTSMPMSFAIGATVISVDAYKKMSAEDAKIAEEVARANARKLRKVIRKSNEDAKGTMARKGVTVVQTPVAMVDDFTKQSQELWNDLAGKIYSKAELKMVLDARDEYRAKHKTAAPRRGAGQPPTTRRAGPTSAPKNREALRAAS

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
29 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
47 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
48 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
51 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
52 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
53 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
54 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
59 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
60 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
61 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
62 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
69 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
70 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
71 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
76 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
77 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
78 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
79 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
80 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
81 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
82 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
83 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
84 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
85 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
86 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
87 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
88 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
89 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
90 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
91 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
92 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
93 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
94 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
95 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
96 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
97 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
98 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
99 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
100 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
101 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
102 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 1.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.6
Nodule 0
Rhizoplane 0
Rhizosphere 77.17
Stem 0
Stem Tuber 0
Unclassified 10.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10106322 3300003323 Bacteria 5749
2 Ga0058860_12075384 3300004801 Bacteria 1504
3 Ga0070683_100242374 3300005329 Bacteria 1715
4 Ga0068869_100201201 3300005334 Bacteria 1571
5 Ga0068869_100283697 3300005334 Bacteria 1332
6 Ga0070689_100013463 3300005340 Bacteria 5919
7 Ga0070687_100124215 3300005343 Unclassified 1481
8 Ga0070678_100228050 3300005456 Bacteria 1551
9 Ga0070698_100000933 3300005471 Bacteria 31971
10 Ga0070679_100004758 3300005530 Bacteria 12521
11 Ga0070679_100211211 3300005530 Unclassified 1905
12 Ga0070684_100101186 3300005535 Bacteria 2575
13 Ga0070665_100030147 3300005548 Bacteria 5458
14 Ga0068856_100357562 3300005614 Unclassified 1479
15 Ga0068861_100101116 3300005719 Unclassified 2293
16 Ga0068863_100036445 3300005841 Bacteria 4685
17 Ga0068863_100111014 3300005841 Bacteria 2612
18 Ga0068860_100140968 3300005843 Unclassified 2317
19 Ga0081455_10084078 3300005937 Bacteria 2598
20 Ga0070717_10006786 3300006028 Bacteria 8451
21 Ga0075366_10079309 3300006195 Bacteria 1960
22 Ga0075429_100005601 3300006880 Bacteria 10825
23 Ga0075435_100216240 3300007076 Unclassified 1627
24 Ga0105245_10000289 3300009098 Bacteria 48028
25 Ga0105245_10119528 3300009098 Bacteria 2460
26 Ga0105243_10143563 3300009148 Unclassified 2040
27 Ga0105243_10166454 3300009148 Unclassified 1906
28 Ga0105248_10187925 3300009177 Bacteria 2328
29 Ga0105237_10191173 3300009545 Bacteria 2047
30 Ga0105238_10329205 3300009551 Bacteria 1514
31 Ga0105249_10088121 3300009553 Bacteria 2898
32 Ga0157374_10012371 3300013296 Bacteria 7424
33 Ga0157376_10040982 3300014969 Bacteria 3789
34 Ga0207705_10231089 3300025909 Bacteria 1407
35 Ga0207684_10046922 3300025910 Bacteria 3664
36 Ga0207684_10093647 3300025910 Bacteria 2562
37 Ga0207660_10151671 3300025917 Bacteria 1781
38 Ga0207662_10215490 3300025918 Bacteria 1248
39 Ga0207652_10051786 3300025921 Bacteria 3521
40 Ga0207687_10000971 3300025927 Bacteria 19486
41 Ga0207687_10113741 3300025927 Bacteria 2013
42 Ga0207709_10162906 3300025935 Bacteria 1557
43 Ga0207709_10224702 3300025935 Bacteria 1356
44 Ga0207670_10023213 3300025936 Bacteria 3858
45 Ga0207670_10041909 3300025936 Bacteria 3013
46 Ga0207661_10208451 3300025944 Bacteria 1721
47 Ga0207712_10154152 3300025961 Bacteria 1778
48 Ga0207708_10079802 3300026075 Bacteria 2514
49 Ga0207702_10322313 3300026078 Bacteria 1472
50 Ga0207641_10179804 3300026088 Bacteria 1937
51 Ga0207641_10220541 3300026088 Bacteria 1758
52 Ga0207641_10235366 3300026088 Bacteria 1704
53 Ga0207675_100193701 3300026118 Bacteria 1950
54 Ga0207683_10140500 3300026121 Bacteria 2176
55 Ga0268266_10029167 3300028379 Bacteria 4690
56 Ga0268264_10092574 3300028381 Unclassified 2610
57 Ga0268264_10105528 3300028381 Unclassified 2458
58 Ga0265319_1036568 3300028563 Bacteria 1679
59 Ga0307517_10064643 3300028786 Bacteria 3398
60 Ga0307515_10030778 3300028794 Bacteria 8991
61 Ga0265338_10015496 3300028800 Bacteria 8368
62 Ga0265338_10022390 3300028800 Bacteria 6543
63 Ga0265332_10017591 3300031238 Bacteria 3153
64 Ga0307513_10054862 3300031456 Bacteria 4269
65 Ga0307509_10000176 3300031507 Bacteria 100893
66 Ga0307509_10012948 3300031507 Bacteria 9912
67 Ga0307509_10100507 3300031507 Bacteria 2930
68 Ga0307509_10113464 3300031507 Bacteria 2707
69 Ga0307508_10052709 3300031616 Bacteria 3612
70 Ga0307516_10014092 3300031730 Bacteria 8478
71 Ga0307516_10039964 3300031730 Bacteria 4672
72 Ga0307516_10240071 3300031730 Bacteria 1511
73 Ga0307406_10001632 3300031901 Bacteria 12322
74 Ga0307406_10091231 3300031901 Unclassified 2052
75 Ga0307416_100009203 3300032002 Bacteria 6446
76 Ga0307415_100112638 3300032126 Unclassified 2022
77 Ga0307415_100369231 3300032126 Unclassified 1214
78 Ga0373949_0000229 3300035090 Bacteria 21167
79 Ga0373936_0000001 3300035113 Bacteria 456155
80 Ga0373954_0173680 3300035118 Bacteria 1056
81 Ga0373961_0000028 3300035241 Bacteria 94923
82 Ga0395899_0008533 3300037312 Bacteria 7892
83 Ga0395900_0005058 3300037418 Bacteria 13833
84 Ga0395898_0161071 3300037466 Bacteria 2146
85 Ga0395905_0131614 3300037471 Bacteria 2353
86 Ga0395901_0017011 3300038443 Bacteria 7411
87 Ga0466967_0213332 3300045976 Bacteria 1832
88 Ga0495650_0058617 3300046471 Bacteria 1553
89 Ga0495632_0095486 3300046519 Archaea 1405
90 Ga0495686_0009696 3300047472 Bacteria 6913
91 Ga0495686_0016138 3300047472 Bacteria 5075
92 Ga0501309_007086 3300049129 Bacteria 1382
93 Ga0501034_0195307 3300049571 Unclassified 1984
94 Ga0501046_0146564 3300049580 Unclassified 1782
95 Ga0501047_0027976 3300049581 Bacteria 5433
96 Ga0501067_0099953 3300049583 Bacteria 1611
97 Ga0501069_0011249 3300049585 Bacteria 4747
98 Ga0501070_0026609 3300049586 Bacteria 4853
99 Ga0501071_0151638 3300049587 Bacteria 1729
100 Ga0501071_0217622 3300049587 Bacteria 1437
101 Ga0501072_0043633 3300049588 Bacteria 3525
102 Ga0501202_028466 3300049652 Bacteria 1154
103 Ga0501227_000141 3300049665 Bacteria 13284
104 Ga0501230_000147 3300049667 Bacteria 5735
105 Ga0501233_001597 3300049668 Unclassified 3897
106 Ga0501225_0000915 3300049705 Bacteria 9204
107 Ga0501229_001834 3300049706 Bacteria 2487
108 Ga0501081_0208762 3300049743 Bacteria 1418
109 Ga0501044_0014698 3300049823 Bacteria 8441
110 Ga0501044_0369537 3300049823 Bacteria 1351
111 nmdc:mga05p37_470875_c1 3300050507 Bacteria 1449
112 nmdc:mga09592_13758_c1 3300050508 Bacteria 6012
113 Ga0500583_0157798 3300053092 Bacteria 1130
114 Ga0500566_0000795 3300053094 Bacteria 17905
115 Ga0500566_0010398 3300053094 Bacteria 5486
116 Ga0500566_0102291 3300053094 Bacteria 1569
117 Ga0500640_005193 3300053095 Bacteria 4822
118 Ga0500554_000482 3300053102 Bacteria 8307
119 Ga0500562_028757 3300053108 Bacteria 1461
120 Ga0500595_000054 3300053119 Bacteria 85119
121 Ga0500597_038905 3300053120 Bacteria 1993
122 Ga0500614_000235 3300053123 Bacteria 14445
123 Ga0500642_0007769 3300053130 Bacteria 3624
124 Ga0500559_0009985 3300053136 Bacteria 4090
125 Ga0500585_095473 3300053144 Bacteria 1073
126 Ga0500603_002546 3300053150 Bacteria 3988
127 Ga0500622_0008001 3300053156 Bacteria 5953

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035113 Ga0373936_0000001 Ga0373936_0000001_31846_32880 304
2 3300031901 Ga0307406_10091231 Ga0307406_100912311 310
3 3300032126 Ga0307415_100112638 Ga0307415_1001126382 310
4 3300005334 Ga0068869_100201201 Ga0068869_1002012012 311
5 3300005530 Ga0070679_100211211 Ga0070679_1002112112 313
6 3300037312 Ga0395899_0008533 Ga0395899_0008533_6609_7622 313
7 3300037418 Ga0395900_0005058 Ga0395900_0005058_11498_12511 313
8 3300038443 Ga0395901_0017011 Ga0395901_0017011_3246_4259 313
9 3300037466 Ga0395898_0161071 Ga0395898_0161071_140_1153 317
10 3300049668 Ga0501233_001597 Ga0501233_001597_1342_2346 318
11 3300049706 Ga0501229_001834 Ga0501229_001834_979_1983 318
12 3300053130 Ga0500642_0007769 Ga0500642_0007769_2012_3010 318
13 3300053144 Ga0500585_095473 Ga0500585_095473_47_1042 318
14 3300006880 Ga0075429_100005601 Ga0075429_1000056014 319
15 3300046519 Ga0495632_0095486 Ga0495632_0095486_136_1110 319
16 3300050508 nmdc:mga09592_13758_c1 nmdc:mga09592_13758_c1_2936_3952 319
17 3300049571 Ga0501034_0195307 Ga0501034_0195307_893_1909 320
18 3300049823 Ga0501044_0369537 Ga0501044_0369537_186_1202 320
19 3300053136 Ga0500559_0009985 Ga0500559_0009985_1201_2211 320
20 3300005456 Ga0070678_100228050 Ga0070678_1002280502 323
21 3300013296 Ga0157374_10012371 Ga0157374_100123715 323
22 3300026121 Ga0207683_10140500 Ga0207683_101405002 323
23 3300031616 Ga0307508_10052709 Ga0307508_100527093 325
24 3300005329 Ga0070683_100242374 Ga0070683_1002423741 326
25 3300005530 Ga0070679_100004758 Ga0070679_1000047586 326
26 3300005535 Ga0070684_100101186 Ga0070684_1001011861 326
27 3300009545 Ga0105237_10191173 Ga0105237_101911731 326
28 3300009551 Ga0105238_10329205 Ga0105238_103292052 326
29 3300025917 Ga0207660_10151671 Ga0207660_101516712 326
30 3300025921 Ga0207652_10051786 Ga0207652_100517863 326
31 3300025936 Ga0207670_10041909 Ga0207670_100419092 326
32 3300025944 Ga0207661_10208451 Ga0207661_102084512 326
33 3300049665 Ga0501227_000141 Ga0501227_000141_5577_6677 326
34 3300049667 Ga0501230_000147 Ga0501230_000147_386_1486 326
35 3300049705 Ga0501225_0000915 Ga0501225_0000915_4259_5359 326
36 3300025910 Ga0207684_10093647 Ga0207684_100936471 328
37 3300049583 Ga0501067_0099953 Ga0501067_0099953_367_1368 328
38 3300049585 Ga0501069_0011249 Ga0501069_0011249_2312_3313 328
39 3300049587 Ga0501071_0151638 Ga0501071_0151638_173_1174 328
40 3300049588 Ga0501072_0043633 Ga0501072_0043633_281_1282 328
41 3300049743 Ga0501081_0208762 Ga0501081_0208762_401_1402 328
42 3300005614 Ga0068856_100357562 Ga0068856_1003575621 329
43 3300025909 Ga0207705_10231089 Ga0207705_102310891 329
44 3300026078 Ga0207702_10322313 Ga0207702_103223131 329
45 3300037471 Ga0395905_0131614 Ga0395905_0131614_432_1439 329
46 3300007076 Ga0075435_100216240 Ga0075435_1002162402 330
47 3300009553 Ga0105249_10088121 Ga0105249_100881213 330
48 3300035090 Ga0373949_0000229 Ga0373949_0000229_1207_2214 330
49 3300047472 Ga0495686_0016138 Ga0495686_0016138_1785_2804 330
50 3300005471 Ga0070698_100000933 Ga0070698_1000009337 331
51 3300009098 Ga0105245_10000289 Ga0105245_1000028916 331
52 3300009177 Ga0105248_10187925 Ga0105248_101879253 331
53 3300014969 Ga0157376_10040982 Ga0157376_100409822 331
54 3300025927 Ga0207687_10000971 Ga0207687_1000097113 331
55 3300025961 Ga0207712_10154152 Ga0207712_101541522 331
56 3300028563 Ga0265319_1036568 Ga0265319_10365682 331
57 3300028800 Ga0265338_10015496 Ga0265338_100154964 331
58 3300031507 Ga0307509_10012948 Ga0307509_100129489 331
59 3300035118 Ga0373954_0173680 Ga0373954_0173680_29_1039 331
60 3300035241 Ga0373961_0000028 Ga0373961_0000028_49791_50849 331
61 3300046471 Ga0495650_0058617 Ga0495650_0058617_343_1353 331
62 3300053094 Ga0500566_0010398 Ga0500566_0010398_3541_4575 331
63 3300053150 Ga0500603_002546 Ga0500603_002546_818_1852 331
64 3300004801 Ga0058860_12075384 Ga0058860_120753841 332
65 3300005334 Ga0068869_100283697 Ga0068869_1002836972 332
66 3300005340 Ga0070689_100013463 Ga0070689_1000134632 332
67 3300005343 Ga0070687_100124215 Ga0070687_1001242152 332
68 3300005548 Ga0070665_100030147 Ga0070665_1000301472 332
69 3300005719 Ga0068861_100101116 Ga0068861_1001011162 332
70 3300005841 Ga0068863_100036445 Ga0068863_1000364452 332
71 3300005841 Ga0068863_100111014 Ga0068863_1001110142 332
72 3300005843 Ga0068860_100140968 Ga0068860_1001409682 332
73 3300005937 Ga0081455_10084078 Ga0081455_100840782 332
74 3300006028 Ga0070717_10006786 Ga0070717_100067868 332
75 3300006195 Ga0075366_10079309 Ga0075366_100793092 332
76 3300009098 Ga0105245_10119528 Ga0105245_101195282 332
77 3300009148 Ga0105243_10143563 Ga0105243_101435632 332
78 3300009148 Ga0105243_10166454 Ga0105243_101664542 332
79 3300025910 Ga0207684_10046922 Ga0207684_100469223 332
80 3300025918 Ga0207662_10215490 Ga0207662_102154902 332
81 3300025927 Ga0207687_10113741 Ga0207687_101137412 332
82 3300025935 Ga0207709_10162906 Ga0207709_101629061 332
83 3300025935 Ga0207709_10224702 Ga0207709_102247021 332
84 3300025936 Ga0207670_10023213 Ga0207670_100232132 332
85 3300026075 Ga0207708_10079802 Ga0207708_100798022 332
86 3300026088 Ga0207641_10179804 Ga0207641_101798042 332
87 3300026088 Ga0207641_10220541 Ga0207641_102205412 332
88 3300026088 Ga0207641_10235366 Ga0207641_102353662 332
89 3300026118 Ga0207675_100193701 Ga0207675_1001937012 332
90 3300028379 Ga0268266_10029167 Ga0268266_100291673 332
91 3300028381 Ga0268264_10092574 Ga0268264_100925742 332
92 3300028381 Ga0268264_10105528 Ga0268264_101055282 332
93 3300028786 Ga0307517_10064643 Ga0307517_100646432 332
94 3300028794 Ga0307515_10030778 Ga0307515_100307785 332
95 3300028800 Ga0265338_10022390 Ga0265338_100223906 332
96 3300031238 Ga0265332_10017591 Ga0265332_100175912 332
97 3300031456 Ga0307513_10054862 Ga0307513_100548622 332
98 3300031507 Ga0307509_10000176 Ga0307509_1000017649 332
99 3300031507 Ga0307509_10100507 Ga0307509_101005072 332
100 3300031507 Ga0307509_10113464 Ga0307509_101134642 332
101 3300031730 Ga0307516_10014092 Ga0307516_100140923 332
102 3300031730 Ga0307516_10039964 Ga0307516_100399643 332
103 3300031730 Ga0307516_10240071 Ga0307516_102400712 332
104 3300031901 Ga0307406_10001632 Ga0307406_100016329 332
105 3300032126 Ga0307415_100369231 Ga0307415_1003692312 332
106 3300045976 Ga0466967_0213332 Ga0466967_0213332_68_1084 332
107 3300047472 Ga0495686_0009696 Ga0495686_0009696_1251_2270 332
108 3300049580 Ga0501046_0146564 Ga0501046_0146564_573_1586 332
109 3300049586 Ga0501070_0026609 Ga0501070_0026609_1866_2879 332
110 3300049587 Ga0501071_0217622 Ga0501071_0217622_345_1361 332
111 3300049652 Ga0501202_028466 Ga0501202_028466_80_1093 332
112 3300049823 Ga0501044_0014698 Ga0501044_0014698_5639_6652 332
113 3300050507 nmdc:mga05p37_470875_c1 nmdc:mga05p37_470875_c1_253_1329 332
114 3300053092 Ga0500583_0157798 Ga0500583_0157798_12_1040 332
115 3300053094 Ga0500566_0000795 Ga0500566_0000795_1434_2492 332
116 3300053094 Ga0500566_0102291 Ga0500566_0102291_323_1384 332
117 3300053095 Ga0500640_005193 Ga0500640_005193_1292_2350 332
118 3300053102 Ga0500554_000482 Ga0500554_000482_3946_5004 332
119 3300053108 Ga0500562_028757 Ga0500562_028757_57_1106 332
120 3300053119 Ga0500595_000054 Ga0500595_000054_3368_4426 332
121 3300053120 Ga0500597_038905 Ga0500597_038905_297_1355 332
122 3300053123 Ga0500614_000235 Ga0500614_000235_11138_12196 332
123 3300053156 Ga0500622_0008001 Ga0500622_0008001_2996_4045 332
124 3300003323 rootH1_10106322 rootH1_101063222 333
125 3300032002 Ga0307416_100009203 Ga0307416_1000092035 333
126 3300049129 Ga0501309_007086 Ga0501309_007086_171_1235 333
127 3300049581 Ga0501047_0027976 Ga0501047_0027976_2566_3591 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

35

319

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pfy-assembly4.cif.gz_D crystal structure of dctp7, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid 0.9258 27 326
2pfz-assembly1.cif.gz_A crystal structure of dctp6, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid 0.9248 27 327
4p8b-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) 0.9221 28 327
2pfz-assembly1.cif.gz_A crystal structure of dctp6, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid 0.919 27 327
2pfy-assembly4.cif.gz_D crystal structure of dctp7, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid 0.917 27 326
ID Description Score Start End Superfamily
2pfzA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9248 27 327 3.40.190.170
2pfzA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.919 27 327 3.40.190.170
2pfyD00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9115 27 326 3.40.190.170
4nn3A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9115 28 327 3.40.190.170
4nf0G00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9078 27 307 3.40.190.170
ID Description Score Start End GO Terms
AF-A0A1F9M9K6-F1-model_v4 TRAP dicarboxylate transporter subunit DctP 0.9729 48 331 GO:0055085
AF-A0A353XDH4-F1-model_v4 deleted 0.9664 79 329
AF-A0A7V3HDK0-F1-model_v4 ABC transporter substrate-binding protein 0.9485 26 128 GO:0055085
AF-A0A0M4D9F4-F1-model_v4 TRAP-type C4-dicarboxylate transport system, periplasmic component 0.948 24 329 GO:0055085
AF-A0A7C7DH28-F1-model_v4 TRAP transporter substrate-binding protein 0.9451 24 327 GO:0030288
GO:0055085

Feature Viewer

pLDDT pTM Quality
86.1 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map