F130956

General Info

Members Datasets Scaffolds Average Seq Length
126 68 252 97

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10023000|Ga0265327_100230003
Length 116
Sequence MLTFESCLLMLATDPATAATSSISPVRLLTIFVLGIYIGVEVITKIPPTLHTPLMSGSNAISGITLMGAILAAGQGHSVILKILGSIAVAFAMINVVGGFLVTHRMLGMFQKKKSH

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
9 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
10 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
11 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
12 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
17 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
18 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
19 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
20 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
21 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
22 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
23 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
24 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
25 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
26 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
27 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
28 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
29 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
30 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
31 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
32 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
34 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
35 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
36 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
37 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
38 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
39 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
40 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
41 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
42 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
43 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
44 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
45 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
46 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
47 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
48 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
49 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
50 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
51 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
52 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
53 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
54 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
55 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
56 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
57 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
58 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
59 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
60 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
61 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
62 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
63 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
64 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
65 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
67 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
68 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.65
Metatranscriptomes 6.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 95.24
Stem 0
Stem Tuber 0
Unclassified 4.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10023000 3300031251 Bacteria 3706
2 Ga0070683_101200055 3300005329 Bacteria 729
3 Ga0070689_100004265 3300005340 Bacteria 9638
4 Ga0070689_100104753 3300005340 Bacteria 2243
5 Ga0070675_100155096 3300005354 Bacteria 1966
6 Ga0070688_100063275 3300005365 Bacteria 2344
7 Ga0070685_10629187 3300005466 Unclassified 775
8 Ga0070684_100152780 3300005535 Bacteria 2092
9 Ga0068857_100087167 3300005577 Bacteria 2792
10 Ga0068860_101583127 3300005843 Unclassified 677
11 Ga0075430_100827215 3300006846 Bacteria 763
12 Ga0207659_10117179 3300025926 Bacteria 2035
13 Ga0207687_10187393 3300025927 Bacteria 1607
14 Ga0207670_10032328 3300025936 Bacteria 3364
15 Ga0207670_10080164 3300025936 Bacteria 2281
16 Ga0207661_10224809 3300025944 Bacteria 1660
17 Ga0268265_11410409 3300028380 Bacteria 699
18 Ga0307513_10125802 3300031456 Bacteria 2519
19 Ga0307408_100035322 3300031548 Bacteria 3507
20 Ga0316575_10065613 3300031665 Bacteria 1454
21 Ga0316575_10204084 3300031665 Bacteria 823
22 Ga0316575_10265939 3300031665 Bacteria 721
23 Ga0316575_10428178 3300031665 Bacteria 569
24 Ga0316579_10015182 3300031691 Bacteria 3340
25 Ga0316579_10202139 3300031691 Bacteria 961
26 Ga0316579_10263031 3300031691 Bacteria 834
27 Ga0316576_10013883 3300031727 Bacteria 5368
28 Ga0316576_10020290 3300031727 Bacteria 4570
29 Ga0316576_10026429 3300031727 Bacteria 4074
30 Ga0316576_10064862 3300031727 Bacteria 2683
31 Ga0316576_10077164 3300031727 Bacteria 2467
32 Ga0316576_10110831 3300031727 Bacteria 2057
33 Ga0316576_10253643 3300031727 Bacteria 1321
34 Ga0316576_10261254 3300031727 Bacteria 1299
35 Ga0316576_10265309 3300031727 Bacteria 1288
36 Ga0316576_10695423 3300031727 Bacteria 737
37 Ga0316578_10000972 3300031728 Bacteria 10887
38 Ga0316578_10011981 3300031728 Bacteria 4561
39 Ga0316578_10143106 3300031728 Bacteria 1440
40 Ga0316578_10589892 3300031728 Bacteria 651
41 Ga0316578_10659539 3300031728 Unclassified 611
42 Ga0316578_10841247 3300031728 Bacteria 531
43 Ga0307405_10011496 3300031731 Bacteria 4644
44 Ga0316577_10001702 3300031733 Bacteria 10557
45 Ga0316577_10019113 3300031733 Bacteria 3791
46 Ga0316577_10182937 3300031733 Bacteria 1184
47 Ga0316577_10540521 3300031733 Bacteria 663
48 Ga0307413_10233667 3300031824 Bacteria 1352
49 Ga0307413_11552541 3300031824 Unclassified 587
50 Ga0307406_10743013 3300031901 Bacteria 823
51 Ga0307412_10068686 3300031911 Bacteria 2410
52 Ga0307412_10121232 3300031911 Bacteria 1883
53 Ga0307416_100458240 3300032002 Bacteria 1329
54 Ga0307416_100667057 3300032002 Bacteria 1126
55 Ga0307411_10242764 3300032005 Bacteria 1411
56 Ga0316583_10084943 3300032133 Bacteria 1105
57 Ga0316585_10025310 3300032137 Bacteria 1840
58 Ga0316585_10218606 3300032137 Bacteria 630
59 Ga0316580_10153907 3300032139 Bacteria 706
60 Ga0316580_10176276 3300032139 Bacteria 657
61 Ga0316593_10030094 3300032168 Bacteria 1760
62 Ga0316593_10032670 3300032168 Bacteria 1700
63 Ga0316593_10037898 3300032168 Bacteria 1595
64 Ga0316593_10041281 3300032168 Bacteria 1535
65 Ga0316593_10210471 3300032168 Bacteria 720
66 Ga0316593_10254501 3300032168 Unclassified 658
67 Ga0307507_10153255 3300033179 Bacteria 1727
68 Ga0316592_1047946 3300033524 Bacteria 952
69 Ga0316588_1025673 3300033528 Bacteria 1362
70 Ga0316574_0008241 3300035398 Bacteria 5775
71 Ga0316574_0064434 3300035398 Bacteria 2306
72 Ga0316574_0084345 3300035398 Bacteria 2021
73 Ga0316574_0124659 3300035398 Bacteria 1655
74 Ga0316574_0222938 3300035398 Bacteria 1208
75 Ga0316574_0392749 3300035398 Bacteria 874
76 Ga0316574_0763271 3300035398 Bacteria 590
77 Ga0316582_0097498 3300036647 Bacteria 1943
78 Ga0316582_0102554 3300036647 Bacteria 1897
79 Ga0316582_0154285 3300036647 Bacteria 1553
80 Ga0316582_0190298 3300036647 Bacteria 1398
81 Ga0316582_0194118 3300036647 Bacteria 1384
82 Ga0316582_0392865 3300036647 Unclassified 955
83 Ga0316582_0651161 3300036647 Bacteria 724
84 Ga0316582_0934559 3300036647 Bacteria 593
85 Ga0316582_1176858 3300036647 Bacteria 522
86 Ga0316584_0028757 3300036712 Bacteria 4102
87 Ga0316584_0047215 3300036712 Bacteria 3216
88 Ga0316584_0122159 3300036712 Bacteria 1946
89 Ga0316584_0196920 3300036712 Bacteria 1488
90 Ga0316584_0699348 3300036712 Bacteria 695
91 Ga0316584_0918650 3300036712 Bacteria 588
92 Ga0316581_0046196 3300037588 Bacteria 1331
93 Ga0316581_0203453 3300037588 Bacteria 609
94 Ga0400488_30509 3300038741 Bacteria 4484
95 Ga0400486_26571 3300038742 Bacteria 1783
96 Ga0400483_154393 3300039062 Bacteria 46904
97 Ga0400489_07055 3300039093 Bacteria 1770
98 Ga0439438_138278 3300041405 Bacteria 583
99 Ga0439461_0102465 3300041410 Bacteria 698
100 Ga0439446_0004098 3300042156 Bacteria 3674
101 Ga0451577_0498627 3300042876 Bacteria 1105
102 Ga0451577_0935697 3300042876 Bacteria 780
103 Ga0453683_0565314 3300044673 Bacteria 740
104 Ga0453684_0381375 3300044712 Bacteria 1583
105 Ga0451576_0000118 3300045051 Bacteria 202550
106 Ga0466967_0533851 3300045976 Bacteria 1154
107 Ga0466967_0996811 3300045976 Bacteria 834
108 Ga0501031_0695625 3300049568 Bacteria 653
109 Ga0501036_0159832 3300049572 Bacteria 1900
110 Ga0501047_1061048 3300049581 Bacteria 623
111 Ga0501048_0661992 3300049582 Bacteria 750
112 Ga0501068_0001802 3300049584 Bacteria 11386
113 Ga0501069_0184742 3300049585 Bacteria 1205
114 Ga0501070_0149582 3300049586 Bacteria 1926
115 Ga0501071_1287958 3300049587 Bacteria 565
116 Ga0501074_0010712 3300049590 Bacteria 6658
117 Ga0501076_1645583 3300049592 Bacteria 527
118 Ga0501225_0288702 3300049705 Bacteria 552
119 Ga0501081_1269540 3300049743 Bacteria 558
120 Ga0501083_0063384 3300049744 Bacteria 2465
121 Ga0501035_0842391 3300049822 Bacteria 730
122 Ga0501045_0166378 3300049824 Bacteria 1642
123 Ga0501084_0091570 3300054114 Bacteria 2553
124 Ga0501084_0124282 3300054114 Bacteria 2170
125 Ga0530510_0137568 3300061734 Bacteria 1799
126 Ga0530510_0732521 3300061734 Bacteria 754
127 Ga0265327_10023000
128 Ga0070683_101200055
129 Ga0070689_100004265
130 Ga0070689_100104753
131 Ga0070675_100155096
132 Ga0070688_100063275
133 Ga0070685_10629187
134 Ga0070684_100152780
135 Ga0068857_100087167
136 Ga0068860_101583127
137 Ga0075430_100827215
138 Ga0207659_10117179
139 Ga0207687_10187393
140 Ga0207670_10032328
141 Ga0207670_10080164
142 Ga0207661_10224809
143 Ga0268265_11410409
144 Ga0307513_10125802
145 Ga0307408_100035322
146 Ga0316575_10065613
147 Ga0316575_10204084
148 Ga0316575_10265939
149 Ga0316575_10428178
150 Ga0316579_10015182
151 Ga0316579_10202139
152 Ga0316579_10263031
153 Ga0316576_10013883
154 Ga0316576_10020290
155 Ga0316576_10026429
156 Ga0316576_10064862
157 Ga0316576_10077164
158 Ga0316576_10110831
159 Ga0316576_10253643
160 Ga0316576_10261254
161 Ga0316576_10265309
162 Ga0316576_10695423
163 Ga0316578_10000972
164 Ga0316578_10011981
165 Ga0316578_10143106
166 Ga0316578_10589892
167 Ga0316578_10659539
168 Ga0316578_10841247
169 Ga0307405_10011496
170 Ga0316577_10001702
171 Ga0316577_10019113
172 Ga0316577_10182937
173 Ga0316577_10540521
174 Ga0307413_10233667
175 Ga0307413_11552541
176 Ga0307406_10743013
177 Ga0307412_10068686
178 Ga0307412_10121232
179 Ga0307416_100458240
180 Ga0307416_100667057
181 Ga0307411_10242764
182 Ga0316583_10084943
183 Ga0316585_10025310
184 Ga0316585_10218606
185 Ga0316580_10153907
186 Ga0316580_10176276
187 Ga0316593_10030094
188 Ga0316593_10032670
189 Ga0316593_10037898
190 Ga0316593_10041281
191 Ga0316593_10210471
192 Ga0316593_10254501
193 Ga0307507_10153255
194 Ga0316592_1047946
195 Ga0316588_1025673
196 Ga0316574_0008241
197 Ga0316574_0064434
198 Ga0316574_0084345
199 Ga0316574_0124659
200 Ga0316574_0222938
201 Ga0316574_0392749
202 Ga0316574_0763271
203 Ga0316582_0097498
204 Ga0316582_0102554
205 Ga0316582_0154285
206 Ga0316582_0190298
207 Ga0316582_0194118
208 Ga0316582_0392865
209 Ga0316582_0651161
210 Ga0316582_0934559
211 Ga0316582_1176858
212 Ga0316584_0028757
213 Ga0316584_0047215
214 Ga0316584_0122159
215 Ga0316584_0196920
216 Ga0316584_0699348
217 Ga0316584_0918650
218 Ga0316581_0046196
219 Ga0316581_0203453
220 Ga0400488_30509
221 Ga0400486_26571
222 Ga0400483_154393
223 Ga0400489_07055
224 Ga0439438_138278
225 Ga0439461_0102465
226 Ga0439446_0004098
227 Ga0451577_0498627
228 Ga0451577_0935697
229 Ga0453683_0565314
230 Ga0453684_0381375
231 Ga0451576_0000118
232 Ga0466967_0533851
233 Ga0466967_0996811
234 Ga0501031_0695625
235 Ga0501036_0159832
236 Ga0501047_1061048
237 Ga0501048_0661992
238 Ga0501068_0001802
239 Ga0501069_0184742
240 Ga0501070_0149582
241 Ga0501071_1287958
242 Ga0501074_0010712
243 Ga0501076_1645583
244 Ga0501225_0288702
245 Ga0501081_1269540
246 Ga0501083_0063384
247 Ga0501035_0842391
248 Ga0501045_0166378
249 Ga0501084_0091570
250 Ga0501084_0124282
251 Ga0530510_0137568
252 Ga0530510_0732521

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12769

PNTB_4TM

4TM region of pyridine nucleotide transhydrogenase, mitoch

28

112

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tkd-assembly1.cif.gz_9 yeast atp synthase state 1catalytic(h) with 10 mm atp backbone model 0.8079 33 87
6tmh-assembly1.cif.gz_N cryo-em structure of toxoplasma gondii mitochondrial atp synthase dimer, oscp/f1/c-ring model 0.7674 33 88
6n2d-assembly1.cif.gz_c3 bacillus ps3 atp synthase membrane region 0.7441 27 84
1wp7-assembly1.cif.gz_A crystal structure of nipah virus fusion core 0.7287 29 85
7tkb-assembly1.cif.gz_2 yeast atp synthase state 1catalytic(f) with 10 mm atp backbone model 0.7271 33 83
ID Description Score Start End Superfamily
4jq5H00 Special;Helix non-globular;Helix Hairpins; 0.7994 29 92 6.10.140.1350
af_Q37315_15_88_1.20.20.10 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.767 33 87 1.20.20.10
af_P69421_3_72_1.20.20.10 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.7557 33 87 1.20.20.10
5fl7L00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.7515 33 83 1.20.20.10
1wp8B00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;YojJ-like 0.7459 29 85 1.10.287.770
ID Description Score Start End GO Terms
AF-A0A0G0FFC9-F1-model_v4 FG-GAP repeat protein 0.6853 9 88 GO:0016020
AF-A0A0G0J3I1-F1-model_v4 ATP synthase F(0) sector subunit c (F-type ATPase subunit c) 0.6616 15 93 GO:0008289
GO:0015078
GO:0015986
GO:0045263
AF-A0A132BB65-F1-model_v4 Uncharacterized protein 0.6468 25 88 GO:0016020
AF-A0A3D8QMY9-F1-model_v4 Uncharacterized protein 0.635 25 92
AF-A0A0G0J3I1-F1-model_v4 ATP synthase F(0) sector subunit c (F-type ATPase subunit c) 0.6226 15 93 GO:0008289
GO:0015078
GO:0015986
GO:0045263

Map