F127693

General Info

Members Datasets Scaffolds Average Seq Length
125 87 250 307

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0168167|Ga0466967_0168167_148_1164
Length 338
Sequence LRFLCRRFVASDASETAALYLIEIRMASMNTVLKRAQTFLFGALLVIACTAKGQDGTIYPLEAPPEPNAIPLGTGGVKDQPAQESWFRQWGEPMARNVSNATLTPVLPDPAKANGAAVIVAPGGGFRWLSMNNEGWKVARALADHGIAAFVLKYRLQPTPGSLDDFKADMNRPRGAGSGAAGGPPPMPKWDLTNQLEDAQAAYALILKRAQEWHVDTQRIGMVGFSAGAGLTMHCTLHSTTMKLAFIAPIYGGLAAVEVPKDAPPLFAAVASDDPLFHGEFGVIKSWYDAHRPVEFHLYQNGGHGFGLGYPDRTSNGWFPVFIHWLEVNKFLAAKSAR

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
20 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
21 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
22 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
23 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
24 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
36 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
37 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
38 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
39 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
40 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
41 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
42 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
43 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
44 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
45 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
46 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
47 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
48 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
49 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
50 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
51 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
52 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
53 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
54 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
55 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
56 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
57 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
58 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
59 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
60 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
61 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
62 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
63 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
64 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
65 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
66 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
67 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
68 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
69 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
70 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
77 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
78 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
79 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
81 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
82 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
83 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
84 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
85 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
86 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
87 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.8
Metatranscriptomes 0
Isolates 3.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.6
Nodule 0
Rhizoplane 3.2
Rhizosphere 68.8
Stem 0
Stem Tuber 0
Unclassified 3.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0168167 3300045976 Bacteria 2061
2 JGI24736J21556_1000905 3300001904 Bacteria 5480
3 JGI24739J22299_10003658 3300001989 Bacteria 5867
4 JGI24737J22298_10024878 3300001990 Bacteria 1894
5 rootH2_10002692 3300003320 Bacteria 17203
6 rootH2_10027993 3300003320 Bacteria 29006
7 rootH2_10092878 3300003320 Bacteria 12472
8 rootL2_10021303 3300003322 Bacteria 14986
9 rootL2_10034669 3300003322 Bacteria 6142
10 rootH1_10007757 3300003323 Bacteria 42297
11 rootH1_10012985 3300003323 Bacteria 3842
12 rootH1_10080124 3300003323 Unclassified 2946
13 Ga0055525_1000021 3300003759 Bacteria 370802
14 Ga0055530_10005639 3300003791 Bacteria 5864
15 Ga0070683_100008060 3300005329 Bacteria 8944
16 Ga0070683_100112853 3300005329 Bacteria 2565
17 Ga0070660_100000506 3300005339 Bacteria 26071
18 Ga0070660_100363790 3300005339 Bacteria 1192
19 Ga0070673_100117784 3300005364 Bacteria 2211
20 Ga0070679_100007134 3300005530 Bacteria 10433
21 Ga0068857_100042191 3300005577 Bacteria 4046
22 Ga0068856_100002718 3300005614 Bacteria 18127
23 Ga0068856_100187015 3300005614 Bacteria 2085
24 Ga0068859_100002364 3300005617 Bacteria 19191
25 Ga0075370_10074748 3300006353 Bacteria 1942
26 Ga0097620_100002364 3300006931 Bacteria 19191
27 Ga0105251_10009145 3300009011 Bacteria 5889
28 Ga0105237_10080034 3300009545 Bacteria 3258
29 Ga0157375_10014772 3300013308 Bacteria 6978
30 Ga0163163_10059557 3300014325 Bacteria 3778
31 Ga0213872_10000330 3300021361 Bacteria 40103
32 Ga0213872_10000575 3300021361 Bacteria 28427
33 Ga0213872_10000650 3300021361 Bacteria 26329
34 Ga0213872_10003834 3300021361 Bacteria 8185
35 Ga0209563_100005 3300025230 Bacteria 1774893
36 Ga0207647_10006641 3300025904 Bacteria 8406
37 Ga0207657_10001555 3300025919 Bacteria 24617
38 Ga0207657_10036340 3300025919 Bacteria 4409
39 Ga0207652_10011239 3300025921 Bacteria 7212
40 Ga0207650_10351526 3300025925 Bacteria 1212
41 Ga0207661_10003168 3300025944 Bacteria 11410
42 Ga0207651_10257145 3300025960 Bacteria 1432
43 Ga0207712_10019541 3300025961 Bacteria 4426
44 Ga0207702_10000106 3300026078 Bacteria 97204
45 Ga0207674_10044504 3300026116 Bacteria 4572
46 Ga0207698_10023468 3300026142 Bacteria 4310
47 Ga0265319_1000750 3300028563 Bacteria 21154
48 Ga0265319_1006573 3300028563 Bacteria 5369
49 Ga0265336_10037816 3300028666 Bacteria 1483
50 Ga0307515_10007405 3300028794 Bacteria 21695
51 Ga0307515_10078233 3300028794 Bacteria 4353
52 Ga0307515_10143405 3300028794 Bacteria 2546
53 Ga0265330_10026949 3300031235 Bacteria 2598
54 Ga0265320_10001040 3300031240 Bacteria 20589
55 Ga0265331_10007031 3300031250 Bacteria 6563
56 Ga0265331_10022062 3300031250 Bacteria 3251
57 Ga0265327_10005017 3300031251 Bacteria 11337
58 Ga0265327_10006315 3300031251 Bacteria 9524
59 Ga0307408_100001074 3300031548 Bacteria 20937
60 Ga0265342_10046566 3300031712 Bacteria 2606
61 Ga0307406_10175350 3300031901 Bacteria 1556
62 Ga0307409_100122308 3300031995 Bacteria 2207
63 Ga0307416_100344220 3300032002 Bacteria 1505
64 Ga0307414_10045123 3300032004 Bacteria 3016
65 Ga0395900_0031924 3300037418 Bacteria 5413
66 Ga0395905_0003009 3300037471 Bacteria 18259
67 Ga0436361_0145405 3300039447 Bacteria 5083
68 Ga0436361_0182416 3300039447 Bacteria 55509
69 Ga0436361_0768493 3300039447 Bacteria 51280
70 Ga0436361_0880474 3300039447 Bacteria 17016
71 Ga0451807_1870479 3300041486 Bacteria 1858
72 Ga0451577_0006737 3300042876 Bacteria 11397
73 Ga0451577_0143833 3300042876 Bacteria 2144
74 Ga0466969_0104384 3300044656 Bacteria 1331
75 Ga0453683_0000103 3300044673 Bacteria 126669
76 Ga0453683_0044803 3300044673 Unclassified 2774
77 Ga0453683_0277315 3300044673 Bacteria 1070
78 Ga0466961_0041504 3300044693 Bacteria 2950
79 Ga0453684_0000287 3300044712 Bacteria 216926
80 Ga0453684_0440840 3300044712 Unclassified 1451
81 Ga0453684_0466304 3300044712 Bacteria 1403
82 Ga0451576_0000087 3300045051 Bacteria 234554
83 Ga0451576_0001635 3300045051 Bacteria 37451
84 Ga0451576_0001950 3300045051 Bacteria 32974
85 Ga0451576_0010350 3300045051 Bacteria 10708
86 Ga0451576_0057572 3300045051 Bacteria 4063
87 Ga0451576_0879628 3300045051 Unclassified 940
88 Ga0496108_0233078 3300048911 Bacteria 1601
89 Ga0496111_0102107 3300048914 Bacteria 2108
90 Ga0496114_0240265 3300048917 Bacteria 1593
91 Ga0496116_0000770 3300048919 Bacteria 40669
92 Ga0496118_0093702 3300048921 Bacteria 2056
93 Ga0496121_0004166 3300048924 Bacteria 19769
94 Ga0496122_0001319 3300048925 Bacteria 40655
95 Ga0496122_0059636 3300048925 Bacteria 2815
96 Ga0496122_0064021 3300048925 Bacteria 2678
97 Ga0496123_0001095 3300048926 Bacteria 40664
98 Ga0496123_0132559 3300048926 Bacteria 1377
99 Ga0496124_0002718 3300048927 Bacteria 22574
100 Ga0496125_0003399 3300048928 Bacteria 19358
101 Ga0496125_0007342 3300048928 Bacteria 11738
102 Ga0496125_0092665 3300048928 Bacteria 2258
103 Ga0496126_0000926 3300048929 Bacteria 50760
104 Ga0501296_003365 3300049519 Bacteria 1704
105 Ga0501032_0000499 3300049569 Bacteria 31750
106 Ga0501034_0006163 3300049571 Bacteria 12929
107 Ga0501034_0130521 3300049571 Bacteria 2496
108 Ga0501043_0256635 3300049579 Bacteria 1346
109 Ga0501046_0009520 3300049580 Bacteria 8397
110 Ga0501046_0019025 3300049580 Bacteria 5700
111 Ga0501047_0028089 3300049581 Bacteria 5422
112 Ga0501048_0183676 3300049582 Bacteria 1482
113 Ga0501223_005840 3300049663 Bacteria 2571
114 Ga0501224_000665 3300049664 Bacteria 4273
115 Ga0501083_0130754 3300049744 Bacteria 1645
116 Ga0501035_0001019 3300049822 Bacteria 29515
117 Ga0501044_0000090 3300049823 Bacteria 112221
118 Ga0501044_0193845 3300049823 Bacteria 1993
119 nmdc:mga0k408_61417_c1 3300050493 Bacteria 2184
120 Ga0500622_0010419 3300053156 Bacteria 5104
121 Ga0500645_006335 3300053730 Bacteria 4238
122 2643746466 2643221544 Bacteria 5886209
123 2644219033 2643221639 Bacteria 6649903
124 2644255540 2643221646 Bacteria 6433402
125 2884635616 2884634485 Bacteria 3928637
126 Ga0466967_0168167
127 JGI24736J21556_1000905
128 JGI24739J22299_10003658
129 JGI24737J22298_10024878
130 rootH2_10002692
131 rootH2_10027993
132 rootH2_10092878
133 rootL2_10021303
134 rootL2_10034669
135 rootH1_10007757
136 rootH1_10012985
137 rootH1_10080124
138 Ga0055525_1000021
139 Ga0055530_10005639
140 Ga0070683_100008060
141 Ga0070683_100112853
142 Ga0070660_100000506
143 Ga0070660_100363790
144 Ga0070673_100117784
145 Ga0070679_100007134
146 Ga0068857_100042191
147 Ga0068856_100002718
148 Ga0068856_100187015
149 Ga0068859_100002364
150 Ga0075370_10074748
151 Ga0097620_100002364
152 Ga0105251_10009145
153 Ga0105237_10080034
154 Ga0157375_10014772
155 Ga0163163_10059557
156 Ga0213872_10000330
157 Ga0213872_10000575
158 Ga0213872_10000650
159 Ga0213872_10003834
160 Ga0209563_100005
161 Ga0207647_10006641
162 Ga0207657_10001555
163 Ga0207657_10036340
164 Ga0207652_10011239
165 Ga0207650_10351526
166 Ga0207661_10003168
167 Ga0207651_10257145
168 Ga0207712_10019541
169 Ga0207702_10000106
170 Ga0207674_10044504
171 Ga0207698_10023468
172 Ga0265319_1000750
173 Ga0265319_1006573
174 Ga0265336_10037816
175 Ga0307515_10007405
176 Ga0307515_10078233
177 Ga0307515_10143405
178 Ga0265330_10026949
179 Ga0265320_10001040
180 Ga0265331_10007031
181 Ga0265331_10022062
182 Ga0265327_10005017
183 Ga0265327_10006315
184 Ga0307408_100001074
185 Ga0265342_10046566
186 Ga0307406_10175350
187 Ga0307409_100122308
188 Ga0307416_100344220
189 Ga0307414_10045123
190 Ga0395900_0031924
191 Ga0395905_0003009
192 Ga0436361_0145405
193 Ga0436361_0182416
194 Ga0436361_0768493
195 Ga0436361_0880474
196 Ga0451807_1870479
197 Ga0451577_0006737
198 Ga0451577_0143833
199 Ga0466969_0104384
200 Ga0453683_0000103
201 Ga0453683_0044803
202 Ga0453683_0277315
203 Ga0466961_0041504
204 Ga0453684_0000287
205 Ga0453684_0440840
206 Ga0453684_0466304
207 Ga0451576_0000087
208 Ga0451576_0001635
209 Ga0451576_0001950
210 Ga0451576_0010350
211 Ga0451576_0057572
212 Ga0451576_0879628
213 Ga0496108_0233078
214 Ga0496111_0102107
215 Ga0496114_0240265
216 Ga0496116_0000770
217 Ga0496118_0093702
218 Ga0496121_0004166
219 Ga0496122_0001319
220 Ga0496122_0059636
221 Ga0496122_0064021
222 Ga0496123_0001095
223 Ga0496123_0132559
224 Ga0496124_0002718
225 Ga0496125_0003399
226 Ga0496125_0007342
227 Ga0496125_0092665
228 Ga0496126_0000926
229 Ga0501296_003365
230 Ga0501032_0000499
231 Ga0501034_0006163
232 Ga0501034_0130521
233 Ga0501043_0256635
234 Ga0501046_0009520
235 Ga0501046_0019025
236 Ga0501047_0028089
237 Ga0501048_0183676
238 Ga0501223_005840
239 Ga0501224_000665
240 Ga0501083_0130754
241 Ga0501035_0001019
242 Ga0501044_0000090
243 Ga0501044_0193845
244 nmdc:mga0k408_61417_c1
245 Ga0500622_0010419
246 Ga0500645_006335
247 2643746466
248 2644219033
249 2644255540
250 2884635616

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

186

262

0.88

PF01738

DLH

Dienelactone hydrolase family

187

330

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q3k-assembly1.cif.gz_B crystal structure of mgs-m1, an alpha/beta hydrolase enzyme from a medee basin deep-sea metagenome library 0.7519 70 302
7dwc-assembly4.cif.gz_D bacteroides thetaiotaomicron vpi5482 btaxe1 0.7517 71 298
3hxk-assembly1.cif.gz_A crystal structure of a sugar hydrolase (yeeb) from lactococcus lactis, northeast structural genomics consortium target kr108 0.7423 70 299
5xg0-assembly2.cif.gz_B crystal structure of a novel pet hydrolase from ideonella sakaiensis 201-f6 0.7372 69 297
6eqf-assembly1.cif.gz_A crystal structure of a polyethylene terephthalate degrading hydrolase from ideonella sakaiensis in spacegroup p212121 0.723 71 297
ID Description Score Start End Superfamily
af_A0A1D6EGD3_55_198_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7749 86 206 3.40.50.1820
4q3kA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.753 70 302 3.40.50.1820
af_Q04457_5_543_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7506 71 220 3.40.50.1820
af_Q9UT29_165_337_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7433 72 237 3.40.50.1820
3hxkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7394 70 299 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A5C8LWD8-F1-model_v4 Alpha/beta hydrolase 0.9854 24 306 GO:0016787
AF-V4PKI7-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9763 28 306 GO:0016787
AF-V4PKI7-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9694 28 306 GO:0016787
AF-A0A2G1Y6L3-F1-model_v4 Esterase 0.9632 204 306
AF-A0A520JMF0-F1-model_v4 Alpha/beta hydrolase 0.9597 149 305 GO:0016787

Map