F107930

General Info

Members Datasets Scaffolds Average Seq Length
120 110 117 144

Family's Representative Sequence

Representative Sequence 3300053123|Ga0500614_004549|Ga0500614_004549_421_948
Length 175
Sequence MPGDMRRAARAVDPPGSMAVPSRRTQLERRHMTNDKTYQGGCFCGAVEFTVTGQPAAMGYCHCTSCRSWSAGPVNAFTLWAPDAVKITKGADAIATFNKTPVSFRKWCTRCGGHVLTDHPTFGLVDVFAATIPGFPFQPALHVHYGESVLPIKDGLPKQKDMPAEMGGSGTLLGE

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2818991450 Burkholderia sp. 604 Isolate Unclassified
3 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
4 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
5 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
44 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
68 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
69 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
77 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
78 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
79 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
83 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
87 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
88 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
94 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
95 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
96 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
97 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
98 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
99 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
100 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
101 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
102 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
103 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
104 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
105 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
106 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
107 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
108 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
109 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
110 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.67
Metatranscriptomes 0.83
Isolates 2.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.17
Nodule 0
Rhizoplane 2.5
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 5.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_647123 2162886006 Bacteria 841
2 JGI24736J21556_1022615 3300001904 Bacteria 983
3 JGI24739J22299_10016183 3300001989 Bacteria 2701
4 JGI24735J21928_10028734 3300002067 Bacteria 1659
5 rootH1_10226520 3300003323 Bacteria 1828
6 Ga0058860_11621341 3300004801 Bacteria 648
7 Ga0065707_10082419 3300005295 Bacteria 15400
8 Ga0065707_10393399 3300005295 Bacteria 862
9 Ga0070676_10406550 3300005328 Unclassified 948
10 Ga0070670_100499075 3300005331 Bacteria 1082
11 Ga0070682_100077649 3300005337 Bacteria 2140
12 Ga0070689_100161453 3300005340 Bacteria 1812
13 Ga0070687_100441815 3300005343 Bacteria 863
14 Ga0070669_100132464 3300005353 Bacteria 1914
15 Ga0070659_100464609 3300005366 Bacteria 1075
16 Ga0070701_10323340 3300005438 Bacteria 955
17 Ga0070700_100031849 3300005441 Bacteria 3164
18 Ga0070700_100285133 3300005441 Bacteria 1199
19 Ga0070694_100261981 3300005444 Bacteria 1312
20 Ga0070663_100002506 3300005455 Bacteria 10359
21 Ga0070663_101679984 3300005455 Bacteria 567
22 Ga0068867_100093850 3300005459 Bacteria 2281
23 Ga0070685_10144720 3300005466 Bacteria 1500
24 Ga0070685_10458903 3300005466 Bacteria 894
25 Ga0070699_100028676 3300005518 Bacteria 4801
26 Ga0070696_100372204 3300005546 Bacteria 1111
27 Ga0070665_100291250 3300005548 Bacteria 1635
28 Ga0068855_100002912 3300005563 Bacteria 20942
29 Ga0068856_100005575 3300005614 Bacteria 12396
30 Ga0068863_100375227 3300005841 Bacteria 1388
31 Ga0068860_102291865 3300005843 Unclassified 560
32 Ga0081455_10053711 3300005937 Unclassified 3440
33 Ga0081455_10089590 3300005937 Unclassified 2496
34 Ga0075428_101278463 3300006844 Bacteria 772
35 Ga0075434_100104220 3300006871 Bacteria 2846
36 Ga0075436_100011736 3300006914 Bacteria 6014
37 Ga0075436_100137011 3300006914 Bacteria 1719
38 Ga0099794_10082291 3300007265 Bacteria 1589
39 Ga0099795_10059468 3300007788 Bacteria 1414
40 Ga0105250_10000091 3300009092 Bacteria 80262
41 Ga0114129_11559500 3300009147 Unclassified 810
42 Ga0105243_11467221 3300009148 Unclassified 705
43 Ga0105248_10293936 3300009177 Bacteria 1829
44 Ga0163163_10436435 3300014325 Bacteria 1369
45 Ga0157380_10937175 3300014326 Bacteria 895
46 Ga0182007_10002853 3300015262 Bacteria 8412
47 Ga0207696_1001282 3300025711 Bacteria 14019
48 Ga0207647_10009144 3300025904 Bacteria 7049
49 Ga0207662_10119584 3300025918 Bacteria 1651
50 Ga0207681_10132492 3300025923 Bacteria 1845
51 Ga0207650_10346673 3300025925 Bacteria 1221
52 Ga0207690_10465550 3300025932 Bacteria 1018
53 Ga0207704_10238530 3300025938 Bacteria 1357
54 Ga0207689_10319334 3300025942 Bacteria 1289
55 Ga0207661_11046404 3300025944 Unclassified 752
56 Ga0207667_10008412 3300025949 Bacteria 12264
57 Ga0207678_10010667 3300026067 Bacteria 8071
58 Ga0207678_10323418 3300026067 Bacteria 1327
59 Ga0207708_10052302 3300026075 Bacteria 3111
60 Ga0207708_10344740 3300026075 Bacteria 1221
61 Ga0207702_10107902 3300026078 Unclassified 2470
62 Ga0207648_10101212 3300026089 Bacteria 2525
63 Ga0209969_1004132 3300027360 Unclassified 2030
64 Ga0209967_1000952 3300027364 Unclassified 3703
65 Ga0209981_1007805 3300027378 Bacteria 1447
66 Ga0209999_1004383 3300027543 Unclassified 2540
67 Ga0209971_1055261 3300027682 Unclassified 960
68 Ga0209974_10309627 3300027876 Unclassified 606
69 Ga0268266_10167162 3300028379 Bacteria 1994
70 Ga0268265_12093653 3300028380 Bacteria 573
71 Ga0268264_10052494 3300028381 Bacteria 3399
72 Ga0265336_10249756 3300028666 Bacteria 527
73 Ga0265332_10008216 3300031238 Bacteria 4692
74 Ga0307509_10065926 3300031507 Unclassified 3800
75 Ga0307408_100540450 3300031548 Bacteria 1027
76 Ga0316575_10145584 3300031665 Bacteria 976
77 Ga0265314_10311705 3300031711 Bacteria 879
78 Ga0307516_10067335 3300031730 Bacteria 3451
79 Ga0307416_100486462 3300032002 Bacteria 1295
80 Ga0307415_100335913 3300032126 Bacteria 1266
81 Ga0307415_100773451 3300032126 Bacteria 874
82 Ga0373949_0000412 3300035090 Bacteria 14814
83 Ga0373941_0008736 3300035115 Bacteria 2528
84 Ga0373954_0341626 3300035118 Bacteria 739
85 Ga0373962_0141899 3300035242 Bacteria 781
86 Ga0373925_0300440 3300037068 Bacteria 1296
87 Ga0436365_1057511 3300039437 Bacteria 734
88 Ga0451802_1876178 3300041460 Bacteria 618
89 Ga0451807_1609373 3300041486 Bacteria 806
90 Ga0466959_0134484 3300045049 Bacteria 1751
91 Ga0466967_0408710 3300045976 Bacteria 1322
92 Ga0495580_0029818 3300046472 Bacteria 3957
93 Ga0495606_0225667 3300046507 Bacteria 1053
94 Ga0496112_0641446 3300048915 Bacteria 992
95 Ga0501038_0290480 3300049574 Bacteria 1285
96 Ga0501039_0218032 3300049575 Bacteria 1500
97 Ga0501041_0190301 3300049577 Bacteria 1285
98 Ga0501042_1309148 3300049578 Bacteria 528
99 Ga0501074_0034430 3300049590 Bacteria 3671
100 Ga0501076_0410616 3300049592 Bacteria 1114
101 Ga0501219_015027 3300049703 Bacteria 623
102 Ga0501079_0983174 3300049741 Bacteria 665
103 Ga0501080_0053594 3300049742 Bacteria 3756
104 Ga0501081_0377313 3300049743 Bacteria 1047
105 Ga0501083_0082508 3300049744 Bacteria 2130
106 nmdc:mga07m45_858574_c1 3300050496 Bacteria 519
107 nmdc:mga05p37_1631558_c1 3300050507 Bacteria 633
108 nmdc:mga0qj67_997223_c1 3300050509 Unclassified 657
109 nmdc:mga08x19_128919_c1 3300050514 Bacteria 1700
110 nmdc:mga08x19_1643_c1 3300050514 Bacteria 13812
111 Ga0500555_001333 3300053103 Bacteria 7751
112 Ga0500597_024080 3300053120 Bacteria 2440
113 Ga0500614_004549 3300053123 Bacteria 2925
114 Ga0500636_0228470 3300053177 Unclassified 964
115 Ga0590071_019296 3300059421 Bacteria 1604
116 Ga0590075_052175 3300059424 Bacteria 1050
117 Ga0501082_0012903 3300060353 Bacteria 7182

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035242 Ga0373962_0141899 Ga0373962_0141899_129_551 140
2 iso_pu_bacteria 2818991450 2819621635 140
3 iso_pu_bacteria 2928108538 2928112166 140
4 iso_pu_bacteria 2928135762 2928139290 140
5 3300004801 Ga0058860_11621341 Ga0058860_116213411 141
6 3300031665 Ga0316575_10145584 Ga0316575_101455841 141
7 3300041460 Ga0451802_1876178 Ga0451802_1876178_43_468 141
8 3300041486 Ga0451807_1609373 Ga0451807_1609373_233_658 141
9 3300046507 Ga0495606_0225667 Ga0495606_0225667_36_461 141
10 3300048915 Ga0496112_0641446 Ga0496112_0641446_341_766 141
11 3300005295 Ga0065707_10393399 Ga0065707_103933992 142
12 3300005340 Ga0070689_100161453 Ga0070689_1001614533 142
13 3300005441 Ga0070700_100285133 Ga0070700_1002851332 142
14 3300005444 Ga0070694_100261981 Ga0070694_1002619811 142
15 3300005546 Ga0070696_100372204 Ga0070696_1003722042 142
16 3300026075 Ga0207708_10344740 Ga0207708_103447402 142
17 3300028380 Ga0268265_12093653 Ga0268265_120936531 142
18 3300028381 Ga0268264_10052494 Ga0268264_100524943 142
19 3300039437 Ga0436365_1057511 Ga0436365_1057511_212_640 142
20 3300045049 Ga0466959_0134484 Ga0466959_0134484_1075_1503 142
21 3300049592 Ga0501076_0410616 Ga0501076_0410616_22_450 142
22 3300049744 Ga0501083_0082508 Ga0501083_0082508_1067_1495 142
23 3300050496 nmdc:mga07m45_858574_c1 nmdc:mga07m45_858574_c1_52_480 142
24 3300059421 Ga0590071_019296 Ga0590071_019296_210_638 142
25 3300059424 Ga0590075_052175 Ga0590075_052175_322_750 142
26 3300060353 Ga0501082_0012903 Ga0501082_0012903_450_878 142
27 3300003323 rootH1_10226520 rootH1_102265202 143
28 3300005343 Ga0070687_100441815 Ga0070687_1004418151 143
29 3300005455 Ga0070663_101679984 Ga0070663_1016799841 143
30 3300006844 Ga0075428_101278463 Ga0075428_1012784631 143
31 3300025918 Ga0207662_10119584 Ga0207662_101195841 143
32 3300032002 Ga0307416_100486462 Ga0307416_1004864622 143
33 3300032126 Ga0307415_100335913 Ga0307415_1003359132 143
34 3300049590 Ga0501074_0034430 Ga0501074_0034430_2532_2963 143
35 3300049703 Ga0501219_015027 Ga0501219_015027_69_500 143
36 3300049742 Ga0501080_0053594 Ga0501080_0053594_3105_3536 143
37 3300050507 nmdc:mga05p37_1631558_c1 nmdc:mga05p37_1631558_c1_32_463 143
38 2162886006 SwRhRL3b_contig_647123 SwRhRL3b_0150.00000570 144
39 3300001904 JGI24736J21556_1022615 JGI24736J21556_10226152 144
40 3300001989 JGI24739J22299_10016183 JGI24739J22299_100161834 144
41 3300002067 JGI24735J21928_10028734 JGI24735J21928_100287342 144
42 3300005295 Ga0065707_10082419 Ga0065707_1008241913 144
43 3300005328 Ga0070676_10406550 Ga0070676_104065502 144
44 3300005331 Ga0070670_100499075 Ga0070670_1004990753 144
45 3300005337 Ga0070682_100077649 Ga0070682_1000776492 144
46 3300005353 Ga0070669_100132464 Ga0070669_1001324642 144
47 3300005366 Ga0070659_100464609 Ga0070659_1004646092 144
48 3300005438 Ga0070701_10323340 Ga0070701_103233402 144
49 3300005441 Ga0070700_100031849 Ga0070700_1000318493 144
50 3300005455 Ga0070663_100002506 Ga0070663_1000025066 144
51 3300005459 Ga0068867_100093850 Ga0068867_1000938503 144
52 3300005466 Ga0070685_10144720 Ga0070685_101447202 144
53 3300005466 Ga0070685_10458903 Ga0070685_104589032 144
54 3300005518 Ga0070699_100028676 Ga0070699_1000286762 144
55 3300005548 Ga0070665_100291250 Ga0070665_1002912502 144
56 3300005563 Ga0068855_100002912 Ga0068855_10000291217 144
57 3300005614 Ga0068856_100005575 Ga0068856_10000557510 144
58 3300005841 Ga0068863_100375227 Ga0068863_1003752271 144
59 3300005843 Ga0068860_102291865 Ga0068860_1022918651 144
60 3300005937 Ga0081455_10053711 Ga0081455_100537119 144
61 3300005937 Ga0081455_10089590 Ga0081455_100895901 144
62 3300006871 Ga0075434_100104220 Ga0075434_1001042204 144
63 3300006914 Ga0075436_100011736 Ga0075436_1000117365 144
64 3300006914 Ga0075436_100137011 Ga0075436_1001370112 144
65 3300007265 Ga0099794_10082291 Ga0099794_100822912 144
66 3300007788 Ga0099795_10059468 Ga0099795_100594682 144
67 3300009092 Ga0105250_10000091 Ga0105250_100000918 144
68 3300009147 Ga0114129_11559500 Ga0114129_115595002 144
69 3300009148 Ga0105243_11467221 Ga0105243_114672211 144
70 3300009177 Ga0105248_10293936 Ga0105248_102939362 144
71 3300014325 Ga0163163_10436435 Ga0163163_104364352 144
72 3300014326 Ga0157380_10937175 Ga0157380_109371752 144
73 3300015262 Ga0182007_10002853 Ga0182007_100028534 144
74 3300025711 Ga0207696_1001282 Ga0207696_10012829 144
75 3300025904 Ga0207647_10009144 Ga0207647_100091444 144
76 3300025923 Ga0207681_10132492 Ga0207681_101324922 144
77 3300025925 Ga0207650_10346673 Ga0207650_103466731 144
78 3300025932 Ga0207690_10465550 Ga0207690_104655501 144
79 3300025938 Ga0207704_10238530 Ga0207704_102385302 144
80 3300025942 Ga0207689_10319334 Ga0207689_103193342 144
81 3300025944 Ga0207661_11046404 Ga0207661_110464042 144
82 3300025949 Ga0207667_10008412 Ga0207667_100084126 144
83 3300026067 Ga0207678_10010667 Ga0207678_100106673 144
84 3300026067 Ga0207678_10323418 Ga0207678_103234182 144
85 3300026075 Ga0207708_10052302 Ga0207708_100523023 144
86 3300026078 Ga0207702_10107902 Ga0207702_101079021 144
87 3300026089 Ga0207648_10101212 Ga0207648_101012122 144
88 3300027360 Ga0209969_1004132 Ga0209969_10041324 144
89 3300027364 Ga0209967_1000952 Ga0209967_10009523 144
90 3300027378 Ga0209981_1007805 Ga0209981_10078052 144
91 3300027543 Ga0209999_1004383 Ga0209999_10043833 144
92 3300027682 Ga0209971_1055261 Ga0209971_10552611 144
93 3300027876 Ga0209974_10309627 Ga0209974_103096271 144
94 3300028379 Ga0268266_10167162 Ga0268266_101671623 144
95 3300028666 Ga0265336_10249756 Ga0265336_102497561 144
96 3300031238 Ga0265332_10008216 Ga0265332_100082162 144
97 3300031507 Ga0307509_10065926 Ga0307509_100659262 144
98 3300031548 Ga0307408_100540450 Ga0307408_1005404502 144
99 3300031711 Ga0265314_10311705 Ga0265314_103117052 144
100 3300031730 Ga0307516_10067335 Ga0307516_100673356 144
101 3300032126 Ga0307415_100773451 Ga0307415_1007734512 144
102 3300035090 Ga0373949_0000412 Ga0373949_0000412_10114_10548 144
103 3300035115 Ga0373941_0008736 Ga0373941_0008736_1520_1954 144
104 3300035118 Ga0373954_0341626 Ga0373954_0341626_221_655 144
105 3300037068 Ga0373925_0300440 Ga0373925_0300440_830_1264 144
106 3300045976 Ga0466967_0408710 Ga0466967_0408710_801_1235 144
107 3300046472 Ga0495580_0029818 Ga0495580_0029818_159_593 144
108 3300049574 Ga0501038_0290480 Ga0501038_0290480_781_1215 144
109 3300049575 Ga0501039_0218032 Ga0501039_0218032_426_860 144
110 3300049577 Ga0501041_0190301 Ga0501041_0190301_196_630 144
111 3300049578 Ga0501042_1309148 Ga0501042_1309148_83_517 144
112 3300049741 Ga0501079_0983174 Ga0501079_0983174_150_584 144
113 3300049743 Ga0501081_0377313 Ga0501081_0377313_330_764 144
114 3300050509 nmdc:mga0qj67_997223_c1 nmdc:mga0qj67_997223_c1_107_550 144
115 3300050514 nmdc:mga08x19_128919_c1 nmdc:mga08x19_128919_c1_772_1206 144
116 3300050514 nmdc:mga08x19_1643_c1 nmdc:mga08x19_1643_c1_6196_6630 144
117 3300053103 Ga0500555_001333 Ga0500555_001333_4497_4931 144
118 3300053120 Ga0500597_024080 Ga0500597_024080_143_577 144
119 3300053123 Ga0500614_004549 Ga0500614_004549_421_948 144
120 3300053177 Ga0500636_0228470 Ga0500636_0228470_503_937 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

59

146

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8518 2 130
3ut2-assembly1.cif.gz_A crystal structure of fungal magkatg2 0.8499 60 88
4wac-assembly1.cif.gz_A crystal structure of tarm 0.8445 62 88
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.8395 8 103
5txq-assembly1.cif.gz_B crystal structure of the a143d variant of catalase-peroxidase from b. pseudomallei 0.814 62 88
ID Description Score Start End Superfamily
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.844 5 135 3.90.1590.10
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8323 5 135 3.90.1590.10
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8253 8 103 2.170.150.70
af_Q2FZM7_1_163_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.82 62 88 3.40.50.2000
1xa8D00 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8135 4 116 3.90.1590.10
ID Description Score Start End GO Terms
AF-A0A530AJC1-F1-model_v4 GFA family protein 0.9922 5 112 GO:0016846
GO:0046872
AF-A0A1M6W7J2-F1-model_v4 Uncharacterized conserved protein 0.991 2 144 GO:0016846
GO:0046872
AF-A0A530GKI3-F1-model_v4 GFA family protein 0.9908 5 101 GO:0016846
GO:0046872
AF-A0A328ZA67-F1-model_v4 deleted 0.9891 3 144
AF-A0A1I4PXY6-F1-model_v4 Glutathione-dependent formaldehyde-activating enzyme 0.9891 5 144 GO:0016846
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.06 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map