F107565

General Info

Members Datasets Scaffolds Average Seq Length
120 110 240 171

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0000018|Ga0496126_0000018_258632_259195
Length 187
Sequence MPTNTEFPKATYRYDPYRNFKFRVKWDGKYVAGISRVSALTRTTQVITHRSGGDPTTPRRMPGQSEYEAITLERGVTHDVAFEQWANKVWDYHNSTIDDQQGGTGNMDVSLKDFRKDIILEVYNEAGQKVLAYNIYRCWPSEFRAVPEFDANGNAVAIQSLKLENEGWERDTSVQEPTEPSYTLPPS

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
32 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
33 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
34 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
36 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
37 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
47 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
50 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
51 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
52 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
53 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
54 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
55 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
58 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
61 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
62 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
64 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
65 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
66 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
67 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
68 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
69 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
70 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
71 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
72 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
76 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
77 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
78 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
79 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
80 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
81 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
82 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
83 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
84 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
85 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
86 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
87 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
88 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
89 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
94 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
95 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
96 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
97 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
100 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
101 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
102 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
103 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
104 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
105 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
106 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
107 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
108 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
109 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
110 2512875024

Type Distribution

Type Percentage (%)
Metagenomes 97.5
Metatranscriptomes 1.67
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.67
Nodule 0.83
Rhizoplane 7.5
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 3.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0000018 3300048929 Bacteria 581170
2 JGI25153J46596_10000035 3300003215 Bacteria 189737
3 Ga0058863_11724956 3300004799 Bacteria 1011
4 Ga0068868_100498616 3300005338 Bacteria 1066
5 Ga0070675_100357801 3300005354 Bacteria 1295
6 Ga0070688_100642737 3300005365 Bacteria 816
7 Ga0070659_100604184 3300005366 Bacteria 943
8 Ga0070667_101207445 3300005367 Bacteria 708
9 Ga0070709_10000659 3300005434 Bacteria 19660
10 Ga0070709_11029695 3300005434 Bacteria 656
11 Ga0070705_100807371 3300005440 Bacteria 747
12 Ga0070708_100867275 3300005445 Bacteria 848
13 Ga0070663_100032750 3300005455 Bacteria 3585
14 Ga0070663_100780267 3300005455 Bacteria 818
15 Ga0070678_100021365 3300005456 Bacteria 4267
16 Ga0070684_100124344 3300005535 Bacteria 2322
17 Ga0070665_100009398 3300005548 Bacteria 9894
18 Ga0070702_100060161 3300005615 Bacteria 2207
19 Ga0068862_100040724 3300005844 Bacteria 3949
20 Ga0081455_10137174 3300005937 Bacteria 1904
21 Ga0081538_10059135 3300005981 Unclassified 2216
22 Ga0075365_10008461 3300006038 Bacteria 5845
23 Ga0075431_100183012 3300006847 Bacteria 2150
24 Ga0075435_100730520 3300007076 Bacteria 861
25 Ga0105240_10000730 3300009093 Bacteria 60084
26 Ga0105245_10399636 3300009098 Bacteria 1373
27 Ga0105237_11333185 3300009545 Bacteria 724
28 Ga0105238_10727778 3300009551 Bacteria 1005
29 Ga0105238_11307036 3300009551 Bacteria 751
30 Ga0105239_11772058 3300010375 Bacteria 715
31 Ga0157378_10493121 3300013297 Bacteria 1222
32 Ga0157378_11577125 3300013297 Bacteria 702
33 Ga0163163_10607223 3300014325 Bacteria 1157
34 Ga0157380_11684764 3300014326 Bacteria 691
35 Ga0157377_10175574 3300014745 Bacteria 1343
36 Ga0157379_10619866 3300014968 Unclassified 1011
37 Ga0213874_10024809 3300021377 Bacteria 1685
38 Ga0209676_1002410 3300025292 Bacteria 13360
39 Ga0209025_1074797 3300025294 Bacteria 1181
40 Ga0209758_1000028 3300025297 Bacteria 530102
41 Ga0209257_1034331 3300025304 Bacteria 1584
42 Ga0207695_10001258 3300025913 Bacteria 43155
43 Ga0207659_10288540 3300025926 Bacteria 1344
44 Ga0207661_10076582 3300025944 Bacteria 2748
45 Ga0207640_10449578 3300025981 Bacteria 1061
46 Ga0207703_10260264 3300026035 Bacteria 1568
47 Ga0207676_11877189 3300026095 Bacteria 598
48 Ga0207683_10025048 3300026121 Bacteria 5144
49 Ga0268266_10000459 3300028379 Bacteria 59218
50 Ga0307517_10096255 3300028786 Bacteria 2373
51 Ga0307515_10001340 3300028794 Bacteria 55728
52 Ga0265338_10008245 3300028800 Bacteria 12688
53 Ga0307512_10002828 3300030522 Bacteria 21137
54 Ga0307513_10006596 3300031456 Bacteria 15151
55 Ga0307508_10017703 3300031616 Bacteria 6480
56 Ga0316579_10076764 3300031691 Bacteria 1588
57 Ga0316576_10189585 3300031727 Bacteria 1550
58 Ga0316578_10063496 3300031728 Bacteria 2178
59 Ga0316578_10463048 3300031728 Bacteria 749
60 Ga0316577_10369949 3300031733 Bacteria 814
61 Ga0307410_10190040 3300031852 Bacteria 1561
62 Ga0307407_10046246 3300031903 Bacteria 2464
63 Ga0307409_100156907 3300031995 Bacteria 1984
64 Ga0307416_100384926 3300032002 Bacteria 1434
65 Ga0307415_100154159 3300032126 Bacteria 1772
66 Ga0316585_10093934 3300032137 Bacteria 981
67 Ga0316593_10016906 3300032168 Bacteria 2218
68 Ga0373938_0120334 3300034957 Unclassified 676
69 Ga0373961_0000045 3300035241 Bacteria 73542
70 Ga0316574_0015869 3300035398 Bacteria 4377
71 Ga0373931_0129884 3300035691 Bacteria 1449
72 Ga0316582_0063623 3300036647 Bacteria 2371
73 Ga0400484_33078 3300038725 Bacteria 1755
74 Ga0400490_35290 3300038726 Bacteria 1304
75 Ga0400488_09163 3300038741 Bacteria 3833
76 Ga0400488_28267 3300038741 Bacteria 7491
77 Ga0400483_067130 3300039062 Bacteria 2185
78 Ga0400487_25730 3300039110 Bacteria 2634
79 Ga0400487_47612 3300039110 Bacteria 2795
80 Ga0453684_0533517 3300044712 Bacteria 1295
81 Ga0495603_0162622 3300046455 Bacteria 1294
82 Ga0495638_0139864 3300046460 Bacteria 1414
83 Ga0495651_0090407 3300046462 Bacteria 2297
84 Ga0495651_0093936 3300046462 Bacteria 2245
85 Ga0495645_0300485 3300046543 Unclassified 1049
86 Ga0495675_0244453 3300047444 Bacteria 1079
87 Ga0496102_0973710 3300048905 Bacteria 769
88 Ga0496104_0001755 3300048907 Bacteria 18727
89 Ga0496107_0666189 3300048910 Bacteria 767
90 Ga0496108_0157335 3300048911 Bacteria 1963
91 Ga0496110_0032047 3300048913 Bacteria 4537
92 Ga0496110_0955486 3300048913 Bacteria 764
93 Ga0496112_0847267 3300048915 Bacteria 838
94 Ga0496114_0161078 3300048917 Bacteria 1951
95 Ga0496115_0000127 3300048918 Bacteria 68926
96 Ga0496117_0159756 3300048920 Bacteria 1322
97 Ga0496121_0382350 3300048924 Bacteria 928
98 Ga0501032_0117304 3300049569 Bacteria 1760
99 Ga0501039_0615416 3300049575 Bacteria 851
100 Ga0501043_0247771 3300049579 Bacteria 1373
101 Ga0501047_0663720 3300049581 Bacteria 861
102 Ga0501069_0109988 3300049585 Bacteria 1568
103 Ga0501070_0117218 3300049586 Bacteria 2199
104 Ga0501080_0123077 3300049742 Bacteria 2403
105 Ga0501081_0765887 3300049743 Bacteria 726
106 Ga0501083_0010747 3300049744 Bacteria 6437
107 Ga0501083_0029925 3300049744 Bacteria 3741
108 Ga0501044_0768657 3300049823 Bacteria 844
109 nmdc:mga03n38_131575_c1 3300050490 Bacteria 1240
110 nmdc:mga0yw44_6631_c1 3300050492 Bacteria 5611
111 nmdc:mga0n895_620519_c1 3300050512 Bacteria 1082
112 nmdc:mga0rr50_1736488_c1 3300050513 Bacteria 526
113 Ga0500644_0012634 3300053088 Bacteria 2340
114 Ga0500651_0109030 3300053093 Bacteria 1691
115 Ga0500641_0155819 3300053096 Bacteria 985
116 Ga0500569_012213 3300053109 Bacteria 2072
117 Ga0500594_0010536 3300053118 Bacteria 2148
118 Ga0500652_032651 3300053131 Bacteria 2052
119 Ga0501082_0149597 3300060353 Bacteria 2027
120 2512960203 2512875024 Bacteria 7195110
121 Ga0496126_0000018
122 JGI25153J46596_10000035
123 Ga0058863_11724956
124 Ga0068868_100498616
125 Ga0070675_100357801
126 Ga0070688_100642737
127 Ga0070659_100604184
128 Ga0070667_101207445
129 Ga0070709_10000659
130 Ga0070709_11029695
131 Ga0070705_100807371
132 Ga0070708_100867275
133 Ga0070663_100032750
134 Ga0070663_100780267
135 Ga0070678_100021365
136 Ga0070684_100124344
137 Ga0070665_100009398
138 Ga0070702_100060161
139 Ga0068862_100040724
140 Ga0081455_10137174
141 Ga0081538_10059135
142 Ga0075365_10008461
143 Ga0075431_100183012
144 Ga0075435_100730520
145 Ga0105240_10000730
146 Ga0105245_10399636
147 Ga0105237_11333185
148 Ga0105238_10727778
149 Ga0105238_11307036
150 Ga0105239_11772058
151 Ga0157378_10493121
152 Ga0157378_11577125
153 Ga0163163_10607223
154 Ga0157380_11684764
155 Ga0157377_10175574
156 Ga0157379_10619866
157 Ga0213874_10024809
158 Ga0209676_1002410
159 Ga0209025_1074797
160 Ga0209758_1000028
161 Ga0209257_1034331
162 Ga0207695_10001258
163 Ga0207659_10288540
164 Ga0207661_10076582
165 Ga0207640_10449578
166 Ga0207703_10260264
167 Ga0207676_11877189
168 Ga0207683_10025048
169 Ga0268266_10000459
170 Ga0307517_10096255
171 Ga0307515_10001340
172 Ga0265338_10008245
173 Ga0307512_10002828
174 Ga0307513_10006596
175 Ga0307508_10017703
176 Ga0316579_10076764
177 Ga0316576_10189585
178 Ga0316578_10063496
179 Ga0316578_10463048
180 Ga0316577_10369949
181 Ga0307410_10190040
182 Ga0307407_10046246
183 Ga0307409_100156907
184 Ga0307416_100384926
185 Ga0307415_100154159
186 Ga0316585_10093934
187 Ga0316593_10016906
188 Ga0373938_0120334
189 Ga0373961_0000045
190 Ga0316574_0015869
191 Ga0373931_0129884
192 Ga0316582_0063623
193 Ga0400484_33078
194 Ga0400490_35290
195 Ga0400488_09163
196 Ga0400488_28267
197 Ga0400483_067130
198 Ga0400487_25730
199 Ga0400487_47612
200 Ga0453684_0533517
201 Ga0495603_0162622
202 Ga0495638_0139864
203 Ga0495651_0090407
204 Ga0495651_0093936
205 Ga0495645_0300485
206 Ga0495675_0244453
207 Ga0496102_0973710
208 Ga0496104_0001755
209 Ga0496107_0666189
210 Ga0496108_0157335
211 Ga0496110_0032047
212 Ga0496110_0955486
213 Ga0496112_0847267
214 Ga0496114_0161078
215 Ga0496115_0000127
216 Ga0496117_0159756
217 Ga0496121_0382350
218 Ga0501032_0117304
219 Ga0501039_0615416
220 Ga0501043_0247771
221 Ga0501047_0663720
222 Ga0501069_0109988
223 Ga0501070_0117218
224 Ga0501080_0123077
225 Ga0501081_0765887
226 Ga0501083_0010747
227 Ga0501083_0029925
228 Ga0501044_0768657
229 nmdc:mga03n38_131575_c1
230 nmdc:mga0yw44_6631_c1
231 nmdc:mga0n895_620519_c1
232 nmdc:mga0rr50_1736488_c1
233 Ga0500644_0012634
234 Ga0500651_0109030
235 Ga0500641_0155819
236 Ga0500569_012213
237 Ga0500594_0010536
238 Ga0500652_032651
239 Ga0501082_0149597
240 2512960203

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06841

Phage_T4_gp19

T4-like virus tail tube protein gp19

18

169

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j0b-assembly1.cif.gz_a cryo-em structure of an extracellular contractile injection system, pvc sheath-tube complex in extended state 0.6752 9 160
6rap-assembly1.cif.gz_A cryo-em structure of the anti-feeding prophage cap (afp tube terminating cap) 0.672 9 160
6j0f-assembly1.cif.gz_a cryo-em structure of an extracellular contractile injection system, pvc sheath/tube terminator in extended state 0.6715 9 161
6rao-assembly1.cif.gz_F cryo-em structure of the anti-feeding prophage (afp) baseplate, 6-fold symmetrised 0.6653 16 159
6j0n-assembly1.cif.gz_n cryo-em structure of an extracellular contractile injection system, baseplate in extended state, refined in c6 symmetry 0.6604 15 159
ID Description Score Start End Superfamily
af_O46009_146_303_3.40.630.90 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase; 0.7793 106 125 3.40.630.90
af_O01460_148_305_3.40.630.90 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase; 0.7775 106 125 3.40.630.90
af_Q9VF86_1_117_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.759 106 125 3.30.420.40
af_Q9VAU3_109_343_3.40.570.10 Alpha Beta;3-Layer(aba) Sandwich;Extracellular Endonuclease; Chain A;Extracellular Endonuclease, subunit A 0.7285 106 126 3.40.570.10
af_Q20382_149_311_3.40.630.90 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase; 0.7218 108 125 3.40.630.90
ID Description Score Start End GO Terms
AF-A0A2H3LAJ6-F1-model_v4 Phage tail protein 0.8623 9 160 GO:0005198
AF-A0A3C0E4N7-F1-model_v4 Phage tail protein 0.8435 19 163 GO:0005198
AF-A0A2H3LAJ6-F1-model_v4 Phage tail protein 0.8345 9 160 GO:0005198
AF-A0A661XWU2-F1-model_v4 Phage tail protein 0.8283 9 160 GO:0005198
AF-A0A2W6ABD6-F1-model_v4 Phage tail protein 0.8207 1 131 GO:0005198

Map