F093347

General Info

Members Datasets Scaffolds Average Seq Length
117 67 108 389

Family's Representative Sequence

Representative Sequence 3300028654|Ga0265322_10010338|Ga0265322_100103382
Length 410
Sequence LTMKNISKLTHQKINKLTPEIEEAKKAALEVLLHNSHGPYNGLPRTAGWGYPEPYTRDLMFSIFGIAVSGNQKLMQSIRKVLETLAENQTERGHIPSLVHDKEDRGSSDTTPLFLLGVGIFRKVSGESKFLNEAVKKAMIWMEYQSPSDRYLIAQQPTSDWRDEQWMTGYGLFVNTLVYSYLRILGQNKRANRIRHEMGRFTITGGTIHRHVHEGLVVKHKPYYAFWSYKIHSSERFDLLGNCLAILSGLASPSRAKEIISWIEEECASMRKRGELTIDLPPNFFPFIKPEDPDWLPRYKIFNNPGDYHNGGIWPFICGFYVAALVAAKRYTLAREKLVTLTHSIKISNTGRVDFGFNEWIKAQDGKPMGQDWQTWSAALYLYAVKCVEEKRTPFFDEIRNCLTESKTEQ

Samples

Sample ID Description Type Environment
1 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
2 2738543023 Pedobacter sp. OK628 Isolate Unclassified
3 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
4 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
5 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
6 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
7 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
8 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
9 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
29 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
30 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
31 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
32 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
43 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
44 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
45 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
46 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
47 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
48 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
49 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
50 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
51 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
52 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
53 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
54 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
55 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
56 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
57 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
58 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
59 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
60 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
61 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
62 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
63 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
64 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
65 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
66 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
67 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.31
Metatranscriptomes 0
Isolates 7.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.71
Nodule 0
Rhizoplane 0
Rhizosphere 84.62
Stem 0
Stem Tuber 0
Unclassified 13.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10020698 3300003320 Bacteria 15994
2 rootH2_10092528 3300003320 Bacteria 3018
3 rootH2_10226837 3300003320 Bacteria 2695
4 rootH1_10166578 3300003323 Bacteria 2226
5 rootH1_10284542 3300003323 Bacteria 4483
6 Ga0065707_10148311 3300005295 Bacteria 1687
7 Ga0070670_100253632 3300005331 Bacteria 1533
8 Ga0070671_100023580 3300005355 Bacteria 5038
9 Ga0070708_100196069 3300005445 Bacteria 1890
10 Ga0070662_100042635 3300005457 Unclassified 3242
11 Ga0070707_100021982 3300005468 Bacteria 6031
12 Ga0070698_100031955 3300005471 Bacteria 5455
13 Ga0070699_100014223 3300005518 Bacteria 6846
14 Ga0070672_100011487 3300005543 Bacteria 6177
15 Ga0068855_100000109 3300005563 Bacteria 102724
16 Ga0068855_100001996 3300005563 Bacteria 25334
17 Ga0068856_100000031 3300005614 Bacteria 126668
18 Ga0068856_100004862 3300005614 Bacteria 13305
19 Ga0068852_100316097 3300005616 Unclassified 1515
20 Ga0105240_10180748 3300009093 Unclassified 2489
21 Ga0105243_10000007 3300009148 Bacteria 445042
22 Ga0105241_10233068 3300009174 Bacteria 1553
23 Ga0157375_10030086 3300013308 Bacteria 5115
24 Ga0182008_10031817 3300014497 Unclassified 2653
25 Ga0182007_10010975 3300015262 Bacteria 3548
26 Ga0182007_10052336 3300015262 Bacteria 1346
27 Ga0209130_1011305 3300025284 Unclassified 2397
28 Ga0207426_1000139 3300025302 Bacteria 195835
29 Ga0207684_10210990 3300025910 Bacteria 1675
30 Ga0207654_10153081 3300025911 Bacteria 1482
31 Ga0207695_10003033 3300025913 Bacteria 24099
32 Ga0207646_10168687 3300025922 Unclassified 1976
33 Ga0207644_10018977 3300025931 Unclassified 4662
34 Ga0207706_10074650 3300025933 Bacteria 2981
35 Ga0207709_10000049 3300025935 Bacteria 237124
36 Ga0207691_10016901 3300025940 Bacteria 6922
37 Ga0207667_10000154 3300025949 Bacteria 102734
38 Ga0207667_10025788 3300025949 Bacteria 6430
39 Ga0207702_10000071 3300026078 Bacteria 114394
40 Ga0265334_10020755 3300028573 Unclassified 2688
41 Ga0265334_10027109 3300028573 Bacteria 2310
42 Ga0265323_10000124 3300028653 Bacteria 43991
43 Ga0265323_10005254 3300028653 Bacteria 5504
44 Ga0265322_10010338 3300028654 Bacteria 2706
45 Ga0265336_10005091 3300028666 Bacteria 4890
46 Ga0265338_10003408 3300028800 Bacteria 22423
47 Ga0265338_10004513 3300028800 Bacteria 18771
48 Ga0265338_10066825 3300028800 Bacteria 3109
49 Ga0265316_10000886 3300031344 Bacteria 32806
50 Ga0265316_10001403 3300031344 Bacteria 25930
51 Ga0265316_10001496 3300031344 Bacteria 25062
52 Ga0265316_10002071 3300031344 Bacteria 21095
53 Ga0307513_10050553 3300031456 Bacteria 4492
54 Ga0316576_10100650 3300031727 Bacteria 2160
55 Ga0395899_0000002 3300037312 Bacteria 1324310
56 Ga0395899_0010050 3300037312 Bacteria 7254
57 Ga0395899_0079517 3300037312 Unclassified 2388
58 Ga0395900_0012055 3300037418 Bacteria 8837
59 Ga0395898_0006559 3300037466 Bacteria 12417
60 Ga0395898_0072823 3300037466 Bacteria 3319
61 Ga0395905_0000380 3300037471 Bacteria 63103
62 Ga0395905_0002066 3300037471 Bacteria 22878
63 Ga0395901_0000271 3300038443 Bacteria 64591
64 Ga0400490_19468 3300038726 Bacteria 28884
65 Ga0451577_0000015 3300042876 Bacteria 538333
66 Ga0451577_0000034 3300042876 Bacteria 376183
67 Ga0451577_0005644 3300042876 Bacteria 12714
68 Ga0451577_0019396 3300042876 Bacteria 6254
69 Ga0451577_0026246 3300042876 Bacteria 5277
70 Ga0451577_0062328 3300042876 Bacteria 3326
71 Ga0451577_0070748 3300042876 Bacteria 3111
72 Ga0451577_0189195 3300042876 Bacteria 1857
73 Ga0451577_0348640 3300042876 Unclassified 1343
74 Ga0453683_0000015 3300044673 Bacteria 346024
75 Ga0453683_0001190 3300044673 Bacteria 23486
76 Ga0453683_0072582 3300044673 Bacteria 2154
77 Ga0453683_0120016 3300044673 Bacteria 1655
78 Ga0453683_0133463 3300044673 Unclassified 1565
79 Ga0453683_0134235 3300044673 Unclassified 1560
80 Ga0453684_0000081 3300044712 Bacteria 402985
81 Ga0453684_0000086 3300044712 Bacteria 397278
82 Ga0453684_0000098 3300044712 Bacteria 376183
83 Ga0453684_0000438 3300044712 Bacteria 169720
84 Ga0453684_0000651 3300044712 Bacteria 125123
85 Ga0453684_0001862 3300044712 Bacteria 55001
86 Ga0453684_0003480 3300044712 Bacteria 35365
87 Ga0453684_0006366 3300044712 Bacteria 22501
88 Ga0453684_0012909 3300044712 Bacteria 13684
89 Ga0453684_0033763 3300044712 Bacteria 7121
90 Ga0453684_0037001 3300044712 Bacteria 6709
91 Ga0453684_0091899 3300044712 Bacteria 3744
92 Ga0451576_0000036 3300045051 Bacteria 376183
93 Ga0451576_0000080 3300045051 Bacteria 242782
94 Ga0451576_0000718 3300045051 Bacteria 66705
95 Ga0451576_0001696 3300045051 Bacteria 36431
96 Ga0451576_0009331 3300045051 Bacteria 11387
97 Ga0451576_0047568 3300045051 Bacteria 4509
98 Ga0451576_0088669 3300045051 Bacteria 3218
99 Ga0451576_0092668 3300045051 Bacteria 3143
100 Ga0495687_000385 3300047443 Bacteria 54684
101 Ga0495687_003888 3300047443 Bacteria 10475
102 Ga0496116_0037130 3300048919 Bacteria 3400
103 Ga0496117_0015551 3300048920 Bacteria 6478
104 Ga0496118_0069723 3300048921 Bacteria 2544
105 Ga0496123_0017733 3300048926 Bacteria 5708
106 Ga0496124_0093857 3300048927 Bacteria 2442
107 Ga0496125_0102800 3300048928 Bacteria 2099
108 nmdc:mga05p37_46207_c1 3300050507 Bacteria 5354

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048928 Ga0496125_0102800 Ga0496125_0102800_30_962 310
2 3300045051 Ga0451576_0088669 Ga0451576_0088669_15_1019 321
3 3300037466 Ga0395898_0072823 Ga0395898_0072823_2283_3290 335
4 3300042876 Ga0451577_0189195 Ga0451577_0189195_389_1441 342
5 3300005355 Ga0070671_100023580 Ga0070671_1000235804 364
6 3300025931 Ga0207644_10018977 Ga0207644_100189773 364
7 iso_pu_bacteria 2721755487 2722729862 366
8 iso_pu_bacteria 2904780799 2904780812 366
9 iso_pu_bacteria 2919177583 2919180725 366
10 3300009148 Ga0105243_10000007 Ga0105243_10000007326 367
11 3300025935 Ga0207709_10000049 Ga0207709_1000004967 367
12 3300048919 Ga0496116_0037130 Ga0496116_0037130_1813_2925 367
13 3300048920 Ga0496117_0015551 Ga0496117_0015551_3075_4187 367
14 3300048921 Ga0496118_0069723 Ga0496118_0069723_200_1312 367
15 3300048926 Ga0496123_0017733 Ga0496123_0017733_2216_3328 367
16 3300048927 Ga0496124_0093857 Ga0496124_0093857_172_1284 367
17 3300005445 Ga0070708_100196069 Ga0070708_1001960692 382
18 3300005457 Ga0070662_100042635 Ga0070662_1000426353 382
19 3300005468 Ga0070707_100021982 Ga0070707_1000219822 382
20 3300005471 Ga0070698_100031955 Ga0070698_1000319557 382
21 3300005518 Ga0070699_100014223 Ga0070699_1000142238 382
22 3300013308 Ga0157375_10030086 Ga0157375_100300863 382
23 3300025922 Ga0207646_10168687 Ga0207646_101686872 382
24 3300025933 Ga0207706_10074650 Ga0207706_100746503 382
25 3300047443 Ga0495687_003888 Ga0495687_003888_8256_9404 382
26 iso_pu_bacteria 2738543023 2739301602 382
27 3300037312 Ga0395899_0079517 Ga0395899_0079517_729_1904 384
28 3300037418 Ga0395900_0012055 Ga0395900_0012055_3815_4990 384
29 3300037471 Ga0395905_0000380 Ga0395905_0000380_24825_26000 384
30 iso_pu_bacteria 2818991460 2819679083 385
31 iso_pu_bacteria 2852627209 2852627604 385
32 iso_pu_bacteria 2929177148 2929181819 385
33 iso_pu_bacteria 2945977869 2945984216 385
34 iso_pu_bacteria 2946013367 2946016390 385
35 3300005543 Ga0070672_100011487 Ga0070672_1000114872 386
36 3300005563 Ga0068855_100001996 Ga0068855_10000199615 386
37 3300005614 Ga0068856_100004862 Ga0068856_1000048628 386
38 3300009174 Ga0105241_10233068 Ga0105241_102330682 386
39 3300014497 Ga0182008_10031817 Ga0182008_100318172 386
40 3300015262 Ga0182007_10010975 Ga0182007_100109754 386
41 3300015262 Ga0182007_10052336 Ga0182007_100523361 386
42 3300025911 Ga0207654_10153081 Ga0207654_101530812 386
43 3300025940 Ga0207691_10016901 Ga0207691_100169014 386
44 3300025949 Ga0207667_10025788 Ga0207667_100257884 386
45 3300031344 Ga0265316_10000886 Ga0265316_1000088627 386
46 3300031456 Ga0307513_10050553 Ga0307513_100505534 386
47 3300042876 Ga0451577_0005644 Ga0451577_0005644_9399_10604 386
48 3300044712 Ga0453684_0000086 Ga0453684_0000086_181482_182663 386
49 3300044712 Ga0453684_0000651 Ga0453684_0000651_32449_33654 386
50 3300045051 Ga0451576_0000080 Ga0451576_0000080_51497_52702 386
51 3300003320 rootH2_10020698 rootH2_100206988 387
52 3300003320 rootH2_10092528 rootH2_100925282 387
53 3300003320 rootH2_10226837 rootH2_102268372 387
54 3300003323 rootH1_10166578 rootH1_101665782 387
55 3300003323 rootH1_10284542 rootH1_102845424 387
56 3300005295 Ga0065707_10148311 Ga0065707_101483111 387
57 3300005331 Ga0070670_100253632 Ga0070670_1002536322 387
58 3300005563 Ga0068855_100000109 Ga0068855_10000010973 387
59 3300005614 Ga0068856_100000031 Ga0068856_10000003120 387
60 3300005616 Ga0068852_100316097 Ga0068852_1003160971 387
61 3300009093 Ga0105240_10180748 Ga0105240_101807482 387
62 3300025284 Ga0209130_1011305 Ga0209130_10113052 387
63 3300025302 Ga0207426_1000139 Ga0207426_1000139135 387
64 3300025910 Ga0207684_10210990 Ga0207684_102109902 387
65 3300025913 Ga0207695_10003033 Ga0207695_100030337 387
66 3300025949 Ga0207667_10000154 Ga0207667_1000015417 387
67 3300026078 Ga0207702_10000071 Ga0207702_1000007121 387
68 3300028573 Ga0265334_10020755 Ga0265334_100207551 387
69 3300028573 Ga0265334_10027109 Ga0265334_100271092 387
70 3300028653 Ga0265323_10000124 Ga0265323_1000012427 387
71 3300028653 Ga0265323_10005254 Ga0265323_100052542 387
72 3300028654 Ga0265322_10010338 Ga0265322_100103382 387
73 3300028666 Ga0265336_10005091 Ga0265336_100050913 387
74 3300028800 Ga0265338_10003408 Ga0265338_100034089 387
75 3300028800 Ga0265338_10004513 Ga0265338_1000451314 387
76 3300028800 Ga0265338_10066825 Ga0265338_100668253 387
77 3300031344 Ga0265316_10001403 Ga0265316_1000140325 387
78 3300031344 Ga0265316_10001496 Ga0265316_1000149612 387
79 3300031344 Ga0265316_10002071 Ga0265316_1000207111 387
80 3300031727 Ga0316576_10100650 Ga0316576_101006502 387
81 3300037312 Ga0395899_0000002 Ga0395899_0000002_1141825_1143027 387
82 3300037312 Ga0395899_0010050 Ga0395899_0010050_2500_3678 387
83 3300037466 Ga0395898_0006559 Ga0395898_0006559_6097_7275 387
84 3300037471 Ga0395905_0002066 Ga0395905_0002066_1253_2431 387
85 3300038443 Ga0395901_0000271 Ga0395901_0000271_42125_43303 387
86 3300038726 Ga0400490_19468 Ga0400490_19468_1201_2409 387
87 3300042876 Ga0451577_0000015 Ga0451577_0000015_408736_409926 387
88 3300042876 Ga0451577_0000034 Ga0451577_0000034_218348_219556 387
89 3300042876 Ga0451577_0019396 Ga0451577_0019396_3766_4950 387
90 3300042876 Ga0451577_0026246 Ga0451577_0026246_3346_4575 387
91 3300042876 Ga0451577_0062328 Ga0451577_0062328_956_2140 387
92 3300042876 Ga0451577_0070748 Ga0451577_0070748_1567_2760 387
93 3300042876 Ga0451577_0348640 Ga0451577_0348640_25_1209 387
94 3300044673 Ga0453683_0000015 Ga0453683_0000015_340639_341847 387
95 3300044673 Ga0453683_0001190 Ga0453683_0001190_20793_22001 387
96 3300044673 Ga0453683_0072582 Ga0453683_0072582_707_1873 387
97 3300044673 Ga0453683_0120016 Ga0453683_0120016_271_1455 387
98 3300044673 Ga0453683_0133463 Ga0453683_0133463_256_1443 387
99 3300044673 Ga0453683_0134235 Ga0453683_0134235_251_1438 387
100 3300044712 Ga0453684_0000081 Ga0453684_0000081_226230_227420 387
101 3300044712 Ga0453684_0000098 Ga0453684_0000098_218348_219556 387
102 3300044712 Ga0453684_0000438 Ga0453684_0000438_72010_73239 387
103 3300044712 Ga0453684_0001862 Ga0453684_0001862_12072_13247 387
104 3300044712 Ga0453684_0003480 Ga0453684_0003480_21903_23093 387
105 3300044712 Ga0453684_0006366 Ga0453684_0006366_19254_20438 387
106 3300044712 Ga0453684_0012909 Ga0453684_0012909_5389_6591 387
107 3300044712 Ga0453684_0033763 Ga0453684_0033763_5683_6876 387
108 3300044712 Ga0453684_0037001 Ga0453684_0037001_3608_4792 387
109 3300044712 Ga0453684_0091899 Ga0453684_0091899_2269_3459 387
110 3300045051 Ga0451576_0000036 Ga0451576_0000036_156628_157836 387
111 3300045051 Ga0451576_0000718 Ga0451576_0000718_39405_40595 387
112 3300045051 Ga0451576_0001696 Ga0451576_0001696_31115_32317 387
113 3300045051 Ga0451576_0009331 Ga0451576_0009331_248_1435 387
114 3300045051 Ga0451576_0047568 Ga0451576_0047568_813_1979 387
115 3300045051 Ga0451576_0092668 Ga0451576_0092668_224_1432 387
116 3300047443 Ga0495687_000385 Ga0495687_000385_32588_33760 387
117 3300050507 nmdc:mga05p37_46207_c1 nmdc:mga05p37_46207_c1_1286_2473 387

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06202

GDE_C

Amylo-alpha-1,6-glucosidase

280

384

0.77

PF12899

Glyco_hydro_100

Alkaline and neutral invertase

185

391

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hmm-assembly1.cif.gz_A crystal structure of aorhaa 0.7559 29 368
6ttj-assembly1.cif.gz_C neutral invertase 2 from arabidopsis thaliana 0.7546 11 387
6ttj-assembly1.cif.gz_L neutral invertase 2 from arabidopsis thaliana 0.754 11 387
6ttj-assembly2.cif.gz_J neutral invertase 2 from arabidopsis thaliana 0.7537 11 387
6ttj-assembly2.cif.gz_H neutral invertase 2 from arabidopsis thaliana 0.7422 11 387
ID Description Score Start End Superfamily
af_F4I2X9_96_502_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.7389 37 368 1.50.10.10
af_Q10MC0_124_589_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.7197 1 375 1.50.10.10
af_Q84JL5_269_595_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.6994 95 377 1.50.10.10
af_Q10MC0_124_589_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.6985 1 375 1.50.10.10
af_Q337G9_1_401_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.6746 7 186 1.50.10.10
ID Description Score Start End GO Terms
AF-A0A2M7JP20-F1-model_v4 beta-fructofuranosidase (EC 3.2.1.26) 0.9684 291 387 GO:0005975
GO:0033926
AF-A0A2M7JP20-F1-model_v4 beta-fructofuranosidase (EC 3.2.1.26) 0.9587 291 387 GO:0005975
GO:0033926
AF-A0A3N5SGN8-F1-model_v4 Amylo-alpha-1,6-glucosidase 0.9559 7 108 GO:0005975
AF-K1YGL4-F1-model_v4 beta-fructofuranosidase (EC 3.2.1.26) 0.9539 246 385 GO:0005975
GO:0016020
GO:0033926
AF-A0A3N5SGN8-F1-model_v4 Amylo-alpha-1,6-glucosidase 0.9294 7 108 GO:0005975

Feature Viewer

pLDDT pTM Quality
81.37 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map