F089938

General Info

Members Datasets Scaffolds Average Seq Length
116 90 115 122

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0071474|Ga0496115_0071474_2202_2603
Length 133
Sequence MRRQGGDRLRLDPFDTSVWIDHLRVGDDRLAALLVDGSILTHPFVIGEIALGHLRQRDAVLAALEGLARVEIATDAEVLRFIESHALFGRGVGYLDVHLLAATKLTPGARLWTKDKRLRSVAEELGLAAEPCA

Samples

Sample ID Description Type Environment
1 2643221629 Devosia sp. Root105 Isolate Unclassified
2 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
3 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
19 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
20 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
21 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
22 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
23 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
24 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
25 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
38 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
39 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
40 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
41 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
42 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
43 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
44 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
45 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
46 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
47 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
48 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
49 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
50 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
51 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
52 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
53 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
54 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
55 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
56 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
57 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
58 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
59 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
60 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
61 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
62 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
63 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
64 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
65 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
66 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
67 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
68 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
69 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
70 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
71 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
72 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
73 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
74 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
75 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
76 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
77 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
78 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
79 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
80 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
81 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
82 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
83 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
84 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
85 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
89 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
90 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 0.86
Isolates 0.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.34
Nodule 0
Rhizoplane 8.62
Rhizosphere 70.69
Stem 0
Stem Tuber 0
Unclassified 10.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055527_1000138 3300003760 Bacteria 51833
2 Ga0055535_1000118 3300003761 Bacteria 85373
3 Ga0055542_1000064 3300003762 Bacteria 159853
4 Ga0055529_1000072 3300003763 Bacteria 159853
5 Ga0070670_100624519 3300005331 Bacteria 965
6 Ga0070689_100371645 3300005340 Bacteria 1203
7 Ga0070708_100425859 3300005445 Bacteria 1252
8 Ga0070708_100990144 3300005445 Bacteria 788
9 Ga0070663_100239735 3300005455 Unclassified 1431
10 Ga0070706_100019233 3300005467 Bacteria 6301
11 Ga0070706_100064397 3300005467 Bacteria 3388
12 Ga0070707_100386332 3300005468 Bacteria 1359
13 Ga0070707_100539396 3300005468 Bacteria 1129
14 Ga0070698_100001208 3300005471 Bacteria 28691
15 Ga0070698_100061007 3300005471 Bacteria 3804
16 Ga0070698_101571889 3300005471 Bacteria 609
17 Ga0070698_101610552 3300005471 Unclassified 601
18 Ga0070699_100119989 3300005518 Bacteria 2312
19 Ga0070697_100883084 3300005536 Bacteria 793
20 Ga0068852_101220490 3300005616 Bacteria 773
21 Ga0068851_10094894 3300005834 Unclassified 1575
22 Ga0070717_11011151 3300006028 Unclassified 757
23 Ga0105248_10202247 3300009177 Bacteria 2238
24 Ga0105248_11190073 3300009177 Unclassified 862
25 Ga0157374_10031520 3300013296 Bacteria 4819
26 Ga0163162_12532442 3300013306 Bacteria 590
27 Ga0157375_10166295 3300013308 Unclassified 2350
28 Ga0157376_10969910 3300014969 Bacteria 871
29 Ga0213875_10078910 3300021388 Bacteria 1536
30 Ga0228598_1001393 3300024227 Bacteria 5313
31 Ga0209672_100008 3300025228 Bacteria 946876
32 Ga0209258_100004 3300025242 Bacteria 1376422
33 Ga0209258_100008 3300025242 Bacteria 1009355
34 Ga0209148_1000041 3300025254 Bacteria 469323
35 Ga0209455_1000007 3300025272 Bacteria 1157983
36 Ga0207705_10617311 3300025909 Bacteria 843
37 Ga0207684_10018642 3300025910 Bacteria 5942
38 Ga0207684_10297583 3300025910 Bacteria 1391
39 Ga0207695_10825601 3300025913 Bacteria 807
40 Ga0207671_10483281 3300025914 Bacteria 987
41 Ga0207657_10342991 3300025919 Bacteria 1179
42 Ga0207646_10120500 3300025922 Bacteria 2357
43 Ga0207646_10133859 3300025922 Unclassified 2232
44 Ga0207646_10364384 3300025922 Bacteria 1306
45 Ga0207665_10158507 3300025939 Bacteria 1626
46 Ga0268264_11960950 3300028381 Bacteria 595
47 Ga0265328_10027411 3300031239 Bacteria 2136
48 Ga0265320_10050898 3300031240 Bacteria 2012
49 Ga0307412_10002454 3300031911 Bacteria 10309
50 Ga0316588_1040085 3300033528 Unclassified 1118
51 Ga0373929_0039017 3300035085 Bacteria 1047
52 Ga0373932_0017687 3300035112 Bacteria 1834
53 Ga0373946_0382630 3300035171 Unclassified 708
54 Ga0373931_0037465 3300035691 Bacteria 2532
55 Ga0373935_0188038 3300035692 Bacteria 1421
56 Ga0395899_0127884 3300037312 Bacteria 1816
57 Ga0395900_0338606 3300037418 Bacteria 1480
58 Ga0395900_0343971 3300037418 Bacteria 1466
59 Ga0395898_1800895 3300037466 Unclassified 533
60 Ga0436364_0956301 3300037853 Unclassified 639
61 Ga0395901_0001004 3300038443 Bacteria 30516
62 Ga0400486_23241 3300038742 Bacteria 32107
63 Ga0400483_049288 3300039062 Bacteria 1406
64 Ga0400483_230731 3300039062 Unclassified 1711
65 Ga0400489_12784 3300039093 Bacteria 1363
66 Ga0436361_0459643 3300039447 Unclassified 503
67 Ga0436361_0917025 3300039447 Unclassified 1525
68 Ga0436363_0838402 3300039450 Unclassified 787
69 Ga0436362_0740825 3300039453 Bacteria 773
70 Ga0436362_0946174 3300039453 Bacteria 2539
71 Ga0439441_038736 3300042001 Bacteria 949
72 Ga0466963_0051558 3300044694 Bacteria 2728
73 Ga0466963_0421887 3300044694 Unclassified 941
74 Ga0466963_0555609 3300044694 Bacteria 811
75 Ga0453684_0073971 3300044712 Bacteria 4293
76 Ga0466967_0053307 3300045976 Bacteria 3554
77 Ga0466967_0246583 3300045976 Bacteria 1705
78 Ga0495605_0231741 3300046474 Bacteria 795
79 Ga0495585_0091077 3300046492 Bacteria 1642
80 Ga0495583_0183107 3300046506 Unclassified 857
81 Ga0495606_0015997 3300046507 Bacteria 5745
82 Ga0495618_0175505 3300046514 Bacteria 1363
83 Ga0495663_0024012 3300046525 Bacteria 1770
84 Ga0495640_0107014 3300046533 Bacteria 1831
85 Ga0495633_0082646 3300046558 Bacteria 1494
86 Ga0495668_0000014 3300046616 Bacteria 442055
87 Ga0495668_0392028 3300046616 Unclassified 763
88 Ga0495635_0188931 3300046663 Bacteria 1399
89 Ga0495599_0721790 3300046678 Unclassified 573
90 Ga0495669_0028304 3300046684 Bacteria 2454
91 Ga0495670_0133904 3300046691 Bacteria 1293
92 Ga0495671_0069082 3300046692 Bacteria 1736
93 Ga0495649_0004066 3300046694 Bacteria 9629
94 Ga0495683_0015738 3300047323 Bacteria 3928
95 Ga0495683_0152353 3300047323 Bacteria 1075
96 Ga0495677_0080376 3300047445 Bacteria 1221
97 Ga0496104_0106884 3300048907 Bacteria 2682
98 Ga0496105_0098924 3300048908 Bacteria 2409
99 Ga0496105_0391517 3300048908 Bacteria 1104
100 Ga0496109_0060039 3300048912 Bacteria 3474
101 Ga0496110_0020910 3300048913 Bacteria 5529
102 Ga0496110_0336163 3300048913 Bacteria 1376
103 Ga0496110_1338852 3300048913 Bacteria 625
104 Ga0496115_0071474 3300048918 Bacteria 2814
105 Ga0496115_1129178 3300048918 Unclassified 592
106 Ga0496115_1412626 3300048918 Unclassified 513
107 Ga0496119_0000213 3300048922 Bacteria 82822
108 Ga0496119_0182530 3300048922 Bacteria 1099
109 Ga0496124_0476036 3300048927 Bacteria 844
110 Ga0496125_0319356 3300048928 Bacteria 942
111 Ga0501034_0329376 3300049571 Bacteria 1459
112 Ga0501036_0901145 3300049572 Bacteria 726
113 Ga0500618_011485 3300053125 Bacteria 2347
114 Ga0500642_0299134 3300053130 Unclassified 727
115 Ga0500588_0031628 3300053146 Bacteria 1528

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005471 Ga0070698_100061007 Ga0070698_1000610071 94
2 3300044712 Ga0453684_0073971 Ga0453684_0073971_1627_1947 106
3 3300005467 Ga0070706_100064397 Ga0070706_1000643973 117
4 3300005468 Ga0070707_100539396 Ga0070707_1005393962 117
5 3300005471 Ga0070698_101571889 Ga0070698_1015718892 117
6 3300005536 Ga0070697_100883084 Ga0070697_1008830842 117
7 3300024227 Ga0228598_1001393 Ga0228598_10013932 117
8 3300025910 Ga0207684_10297583 Ga0207684_102975831 117
9 3300025922 Ga0207646_10133859 Ga0207646_101338592 117
10 3300025939 Ga0207665_10158507 Ga0207665_101585073 117
11 3300031911 Ga0307412_10002454 Ga0307412_100024547 117
12 3300039450 Ga0436363_0838402 Ga0436363_0838402_105_458 117
13 3300005331 Ga0070670_100624519 Ga0070670_1006245192 118
14 3300005455 Ga0070663_100239735 Ga0070663_1002397352 118
15 3300005616 Ga0068852_101220490 Ga0068852_1012204901 118
16 3300014969 Ga0157376_10969910 Ga0157376_109699102 118
17 3300009177 Ga0105248_10202247 Ga0105248_102022474 119
18 3300013306 Ga0163162_12532442 Ga0163162_125324422 119
19 iso_pu_bacteria 2643221629 2644166634 119
20 3300005445 Ga0070708_100425859 Ga0070708_1004258592 120
21 3300005445 Ga0070708_100990144 Ga0070708_1009901442 120
22 3300005467 Ga0070706_100019233 Ga0070706_1000192335 120
23 3300005468 Ga0070707_100386332 Ga0070707_1003863322 120
24 3300005471 Ga0070698_100001208 Ga0070698_10000120823 120
25 3300005471 Ga0070698_101610552 Ga0070698_1016105522 120
26 3300005518 Ga0070699_100119989 Ga0070699_1001199892 120
27 3300025910 Ga0207684_10018642 Ga0207684_100186425 120
28 3300025922 Ga0207646_10120500 Ga0207646_101205002 120
29 3300025922 Ga0207646_10364384 Ga0207646_103643842 120
30 3300037312 Ga0395899_0127884 Ga0395899_0127884_1090_1452 120
31 3300037418 Ga0395900_0338606 Ga0395900_0338606_445_807 120
32 3300038443 Ga0395901_0001004 Ga0395901_0001004_4439_4801 120
33 3300039447 Ga0436361_0459643 Ga0436361_0459643_81_443 120
34 3300044694 Ga0466963_0051558 Ga0466963_0051558_2129_2491 120
35 3300045976 Ga0466967_0053307 Ga0466967_0053307_1545_1907 120
36 3300037418 Ga0395900_0343971 Ga0395900_0343971_165_530 121
37 3300037466 Ga0395898_1800895 Ga0395898_1800895_47_412 121
38 3300039062 Ga0400483_049288 Ga0400483_049288_312_677 121
39 3300039062 Ga0400483_230731 Ga0400483_230731_53_418 121
40 3300046492 Ga0495585_0091077 Ga0495585_0091077_1246_1611 121
41 3300046506 Ga0495583_0183107 Ga0495583_0183107_234_599 121
42 3300046525 Ga0495663_0024012 Ga0495663_0024012_96_461 121
43 3300046558 Ga0495633_0082646 Ga0495633_0082646_515_880 121
44 3300046616 Ga0495668_0392028 Ga0495668_0392028_333_698 121
45 3300046691 Ga0495670_0133904 Ga0495670_0133904_571_936 121
46 3300046692 Ga0495671_0069082 Ga0495671_0069082_845_1210 121
47 3300047323 Ga0495683_0152353 Ga0495683_0152353_146_511 121
48 3300047445 Ga0495677_0080376 Ga0495677_0080376_184_549 121
49 3300049571 Ga0501034_0329376 Ga0501034_0329376_668_1036 121
50 3300053130 Ga0500642_0299134 Ga0500642_0299134_72_437 121
51 3300053146 Ga0500588_0031628 Ga0500588_0031628_49_414 121
52 3300005834 Ga0068851_10094894 Ga0068851_100948942 122
53 3300009177 Ga0105248_11190073 Ga0105248_111900733 122
54 3300013296 Ga0157374_10031520 Ga0157374_100315201 122
55 3300031239 Ga0265328_10027411 Ga0265328_100274112 122
56 3300033528 Ga0316588_1040085 Ga0316588_10400853 122
57 3300046514 Ga0495618_0175505 Ga0495618_0175505_669_1037 122
58 3300046533 Ga0495640_0107014 Ga0495640_0107014_638_1006 122
59 3300046663 Ga0495635_0188931 Ga0495635_0188931_633_1001 122
60 3300046678 Ga0495599_0721790 Ga0495599_0721790_118_486 122
61 3300048912 Ga0496109_0060039 Ga0496109_0060039_139_507 122
62 3300048913 Ga0496110_0020910 Ga0496110_0020910_3391_3759 122
63 3300006028 Ga0070717_11011151 Ga0070717_110111512 123
64 3300031240 Ga0265320_10050898 Ga0265320_100508982 123
65 3300035171 Ga0373946_0382630 Ga0373946_0382630_294_665 123
66 3300035692 Ga0373935_0188038 Ga0373935_0188038_566_937 123
67 3300038742 Ga0400486_23241 Ga0400486_23241_25184_25561 123
68 3300039093 Ga0400489_12784 Ga0400489_12784_305_691 123
69 3300039447 Ga0436361_0917025 Ga0436361_0917025_1127_1498 123
70 3300039453 Ga0436362_0946174 Ga0436362_0946174_1426_1797 123
71 3300042001 Ga0439441_038736 Ga0439441_038736_205_576 123
72 3300044694 Ga0466963_0421887 Ga0466963_0421887_223_594 123
73 3300044694 Ga0466963_0555609 Ga0466963_0555609_219_590 123
74 3300046474 Ga0495605_0231741 Ga0495605_0231741_261_632 123
75 3300046507 Ga0495606_0015997 Ga0495606_0015997_808_1179 123
76 3300046616 Ga0495668_0000014 Ga0495668_0000014_263764_264135 123
77 3300046684 Ga0495669_0028304 Ga0495669_0028304_1310_1681 123
78 3300046694 Ga0495649_0004066 Ga0495649_0004066_5944_6315 123
79 3300047323 Ga0495683_0015738 Ga0495683_0015738_376_747 123
80 3300048908 Ga0496105_0391517 Ga0496105_0391517_121_492 123
81 3300048918 Ga0496115_0071474 Ga0496115_0071474_2202_2603 123
82 3300048918 Ga0496115_1129178 Ga0496115_1129178_48_419 123
83 3300048922 Ga0496119_0000213 Ga0496119_0000213_15764_16135 123
84 3300003760 Ga0055527_1000138 Ga0055527_100013847 124
85 3300003761 Ga0055535_1000118 Ga0055535_10001183 124
86 3300003762 Ga0055542_1000064 Ga0055542_1000064137 124
87 3300003763 Ga0055529_1000072 Ga0055529_10000723 124
88 3300005340 Ga0070689_100371645 Ga0070689_1003716453 124
89 3300013308 Ga0157375_10166295 Ga0157375_101662953 124
90 3300021388 Ga0213875_10078910 Ga0213875_100789101 124
91 3300025228 Ga0209672_100008 Ga0209672_100008268 124
92 3300025242 Ga0209258_100004 Ga0209258_100004922 124
93 3300025242 Ga0209258_100008 Ga0209258_100008547 124
94 3300025254 Ga0209148_1000041 Ga0209148_100004149 124
95 3300025272 Ga0209455_1000007 Ga0209455_1000007667 124
96 3300025909 Ga0207705_10617311 Ga0207705_106173112 124
97 3300025913 Ga0207695_10825601 Ga0207695_108256011 124
98 3300025914 Ga0207671_10483281 Ga0207671_104832812 124
99 3300025919 Ga0207657_10342991 Ga0207657_103429912 124
100 3300028381 Ga0268264_11960950 Ga0268264_119609501 124
101 3300035085 Ga0373929_0039017 Ga0373929_0039017_168_542 124
102 3300035112 Ga0373932_0017687 Ga0373932_0017687_929_1303 124
103 3300035691 Ga0373931_0037465 Ga0373931_0037465_1183_1557 124
104 3300037853 Ga0436364_0956301 Ga0436364_0956301_97_471 124
105 3300039453 Ga0436362_0740825 Ga0436362_0740825_287_661 124
106 3300045976 Ga0466967_0246583 Ga0466967_0246583_360_743 124
107 3300048907 Ga0496104_0106884 Ga0496104_0106884_1014_1388 124
108 3300048908 Ga0496105_0098924 Ga0496105_0098924_1933_2307 124
109 3300048913 Ga0496110_0336163 Ga0496110_0336163_875_1255 124
110 3300048913 Ga0496110_1338852 Ga0496110_1338852_184_558 124
111 3300048918 Ga0496115_1412626 Ga0496115_1412626_69_443 124
112 3300048922 Ga0496119_0182530 Ga0496119_0182530_706_1083 124
113 3300048927 Ga0496124_0476036 Ga0496124_0476036_360_740 124
114 3300048928 Ga0496125_0319356 Ga0496125_0319356_242_622 124
115 3300049572 Ga0501036_0901145 Ga0501036_0901145_298_678 124
116 3300053125 Ga0500618_011485 Ga0500618_011485_1216_1599 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

14

124

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6a7v-assembly1.cif.gz_E crystal structure of mycobacterium tuberculosis vapbc11 toxin-antitoxin complex 0.7973 2 121
4chg-assembly3.cif.gz_E crystal structure of vapbc15 complex from mycobacterium tuberculosis 0.7827 1 118
6a7v-assembly1.cif.gz_E crystal structure of mycobacterium tuberculosis vapbc11 toxin-antitoxin complex 0.7698 2 121
4chg-assembly3.cif.gz_E crystal structure of vapbc15 complex from mycobacterium tuberculosis 0.7444 1 118
7by2-assembly1.cif.gz_B-2 toxin-antitoxin complex from klebsiella pneumoniae 0.7363 1 105
ID Description Score Start End Superfamily
af_P9WF73_1_115_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9872 1 114 3.40.50.1010
af_P9WF73_1_115_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9704 1 114 3.40.50.1010
af_P95007_2_136_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7938 1 121 3.40.50.1010
af_P95007_2_136_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7714 1 121 3.40.50.1010
af_P9WFA5_1_133_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7698 1 119 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A450TEE8-F1-model_v4 PIN domain-containing protein 0.9934 1 119
AF-A0A4V2PGN2-F1-model_v4 PIN domain-containing protein 0.9932 1 120
AF-A0A1V0KIB9-F1-model_v4 deleted 0.9931 1 120
AF-A0A127M406-F1-model_v4 Ribonuclease 0.9927 1 122
AF-A0A6P0CHK5-F1-model_v4 PIN domain-containing protein 0.9927 1 121

Feature Viewer

pLDDT pTM Quality
93.69 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map