F083086

General Info

Members Datasets Scaffolds Average Seq Length
115 93 230 265

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100173642|Ga0070712_1001736422
Length 281
Sequence MLTVRPAAVAGLFYPGAPPALKASVCALLDAAPRPAADAEWPKALIVPHAGYIYSGPIAASAYARLIPGRSLIRRVVLLGPVHLVPIRGLALPGADSFVTPLGAVAVDAGAAARLRAMPQVDESEAAHSLEHSLEVQLPFLQTMLEDFTLVPLAVGDASPSEVAEVIERLWGGPETLIVVSSDLSHYHPYERAAEIDSSTVDDILALADTLDHQQACGATPINGFSLCARRHGLVPELLDLRNSGDTAGEKSHVVGYAAFAFARKLPESVATRRLEETVDA

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
4 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
14 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
15 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
16 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
17 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
18 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
20 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
21 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
29 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
30 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
40 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
41 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
42 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
43 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
44 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
45 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
46 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
47 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
48 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
49 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
50 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
51 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
53 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
54 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
55 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
56 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
57 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
58 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
59 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
60 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
61 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
62 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
63 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
64 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
65 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
66 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
73 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
74 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
75 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
76 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
77 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
78 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
79 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
80 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
81 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
82 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
83 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
84 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
85 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
86 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
87 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
88 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
89 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
90 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
91 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
92 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
93 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.26
Stem 0
Stem Tuber 0
Unclassified 1.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_100173642 3300006175 Bacteria 1674
2 Ga0070658_10002503 3300005327 Bacteria 15353
3 Ga0070710_10344839 3300005437 Bacteria 984
4 Ga0070711_100071912 3300005439 Bacteria 2439
5 Ga0070708_100042224 3300005445 Bacteria 4002
6 Ga0070708_100148722 3300005445 Unclassified 2177
7 Ga0070678_100003670 3300005456 Bacteria 8578
8 Ga0070706_100042105 3300005467 Bacteria 4218
9 Ga0070706_100196058 3300005467 Bacteria 1887
10 Ga0070707_100010705 3300005468 Bacteria 8545
11 Ga0070698_100000184 3300005471 Bacteria 59150
12 Ga0070698_100122022 3300005471 Bacteria 2565
13 Ga0070679_100103839 3300005530 Bacteria 2828
14 Ga0070696_100219957 3300005546 Bacteria 1425
15 Ga0068859_100273298 3300005617 Bacteria 1782
16 Ga0068851_10016497 3300005834 Bacteria 3535
17 Ga0075431_100346555 3300006847 Bacteria 1494
18 Ga0075433_10061979 3300006852 Bacteria 3276
19 Ga0075434_100175783 3300006871 Bacteria 2161
20 Ga0075436_100001130 3300006914 Bacteria 18040
21 Ga0097620_100273302 3300006931 Bacteria 1782
22 Ga0075435_100071726 3300007076 Bacteria 2829
23 Ga0099794_10030304 3300007265 Bacteria 2525
24 Ga0099795_10001352 3300007788 Bacteria 5256
25 Ga0111539_10004683 3300009094 Bacteria 17879
26 Ga0114129_10002520 3300009147 Bacteria 25430
27 Ga0114129_10243089 3300009147 Bacteria 2419
28 Ga0105242_10128679 3300009176 Bacteria 2183
29 Ga0099796_10004570 3300010159 Bacteria 3367
30 Ga0157374_10003446 3300013296 Bacteria 13293
31 Ga0157374_10154430 3300013296 Bacteria 2233
32 Ga0157378_10186211 3300013297 Bacteria 1955
33 Ga0157380_10338749 3300014326 Bacteria 1402
34 Ga0213876_10005886 3300021384 Bacteria 6705
35 Ga0207705_10001636 3300025909 Bacteria 17781
36 Ga0207684_10066837 3300025910 Bacteria 3054
37 Ga0207684_10205327 3300025910 Bacteria 1700
38 Ga0207652_10086872 3300025921 Bacteria 2743
39 Ga0207646_10039145 3300025922 Bacteria 4266
40 Ga0207686_10029654 3300025934 Bacteria 3230
41 Ga0207669_10169346 3300025937 Bacteria 1553
42 Ga0207683_10008362 3300026121 Bacteria 8848
43 Ga0209968_1013328 3300027526 Bacteria 1289
44 Ga0209971_1009400 3300027682 Bacteria 2315
45 Ga0209974_10002779 3300027876 Bacteria 6344
46 Ga0265324_10037493 3300029957 Bacteria 1684
47 Ga0265328_10002853 3300031239 Bacteria 7711
48 Ga0265331_10000109 3300031250 Bacteria 108845
49 Ga0265327_10000005 3300031251 Bacteria 790146
50 Ga0265327_10000243 3300031251 Bacteria 108869
51 Ga0265327_10021292 3300031251 Bacteria 3917
52 Ga0307408_100293205 3300031548 Bacteria 1359
53 Ga0316575_10023425 3300031665 Bacteria 2387
54 Ga0316576_10021079 3300031727 Bacteria 4500
55 Ga0316578_10088732 3300031728 Bacteria 1845
56 Ga0307405_10096199 3300031731 Bacteria 1974
57 Ga0307412_10053219 3300031911 Bacteria 2683
58 Ga0307411_10164948 3300032005 Bacteria 1664
59 Ga0316587_1006163 3300033529 Bacteria 1823
60 Ga0373957_0108923 3300035120 Bacteria 1114
61 Ga0316574_0013790 3300035398 Bacteria 4655
62 Ga0316574_0058323 3300035398 Bacteria 2418
63 Ga0316574_0068821 3300035398 Bacteria 2233
64 Ga0316574_0173344 3300035398 Bacteria 1388
65 Ga0373935_0075067 3300035692 Bacteria 2187
66 Ga0373937_0112980 3300036401 Bacteria 2527
67 Ga0316582_0097676 3300036647 Bacteria 1941
68 Ga0316582_0341052 3300036647 Bacteria 1031
69 Ga0316584_0018666 3300036712 Bacteria 5006
70 Ga0373925_0062685 3300037068 Bacteria 2796
71 Ga0436365_1778286 3300039437 Bacteria 19394
72 Ga0451577_0006681 3300042876 Bacteria 11446
73 Ga0451577_0163476 3300042876 Bacteria 2005
74 Ga0453684_0030949 3300044712 Bacteria 7541
75 Ga0453684_0135511 3300044712 Bacteria 2949
76 Ga0451576_0038947 3300045051 Bacteria 5031
77 Ga0451576_0042401 3300045051 Bacteria 4804
78 Ga0451576_0801330 3300045051 Bacteria 989
79 Ga0495580_0354134 3300046472 Bacteria 994
80 Ga0495621_0004826 3300046539 Bacteria 3823
81 Ga0495636_0002481 3300047318 Bacteria 7074
82 Ga0495636_0025961 3300047318 Bacteria 2381
83 Ga0501036_0168895 3300049572 Bacteria 1843
84 Ga0501038_0082726 3300049574 Bacteria 2703
85 Ga0501039_0028353 3300049575 Bacteria 4310
86 Ga0501040_0002542 3300049576 Bacteria 11760
87 Ga0501041_0005711 3300049577 Bacteria 7270
88 Ga0501048_0170988 3300049582 Bacteria 1539
89 Ga0501067_0019779 3300049583 Bacteria 3727
90 Ga0501069_0058472 3300049585 Bacteria 2150
91 Ga0501071_0052215 3300049587 Bacteria 2948
92 Ga0501072_0047823 3300049588 Bacteria 3369
93 Ga0501072_0114814 3300049588 Bacteria 2144
94 Ga0501072_0721465 3300049588 Bacteria 783
95 Ga0501075_0008836 3300049591 Bacteria 7024
96 Ga0501076_0000777 3300049592 Bacteria 20630
97 Ga0501076_0554725 3300049592 Bacteria 947
98 Ga0501077_0022815 3300049593 Bacteria 3967
99 Ga0501079_0047633 3300049741 Bacteria 3307
100 Ga0501080_0012186 3300049742 Bacteria 7878
101 Ga0501080_0212502 3300049742 Bacteria 1773
102 Ga0501081_0001386 3300049743 Bacteria 14788
103 Ga0501083_0060465 3300049744 Bacteria 2531
104 Ga0501045_0034625 3300049824 Bacteria 3666
105 nmdc:mga05p37_43553_c1 3300050507 Bacteria 5522
106 nmdc:mga09592_236681_c1 3300050508 Unclassified 1582
107 nmdc:mga06r32_314928_c1 3300050510 Bacteria 1550
108 nmdc:mga08y16_93130_c1 3300050511 Bacteria 3140
109 nmdc:mga0n895_211830_c1 3300050512 Bacteria 1968
110 nmdc:mga08x19_41676_c1 3300050514 Bacteria 2925
111 nmdc:mga0a205_24176_c1 3300050515 Bacteria 3958
112 Ga0501084_0188667 3300054114 Bacteria 1739
113 Ga0501082_0005329 3300060353 Bacteria 11176
114 Ga0530510_0048611 3300061734 Bacteria 3066
115 Ga0530510_0078296 3300061734 Bacteria 2403
116 Ga0070712_100173642
117 Ga0070658_10002503
118 Ga0070710_10344839
119 Ga0070711_100071912
120 Ga0070708_100042224
121 Ga0070708_100148722
122 Ga0070678_100003670
123 Ga0070706_100042105
124 Ga0070706_100196058
125 Ga0070707_100010705
126 Ga0070698_100000184
127 Ga0070698_100122022
128 Ga0070679_100103839
129 Ga0070696_100219957
130 Ga0068859_100273298
131 Ga0068851_10016497
132 Ga0075431_100346555
133 Ga0075433_10061979
134 Ga0075434_100175783
135 Ga0075436_100001130
136 Ga0097620_100273302
137 Ga0075435_100071726
138 Ga0099794_10030304
139 Ga0099795_10001352
140 Ga0111539_10004683
141 Ga0114129_10002520
142 Ga0114129_10243089
143 Ga0105242_10128679
144 Ga0099796_10004570
145 Ga0157374_10003446
146 Ga0157374_10154430
147 Ga0157378_10186211
148 Ga0157380_10338749
149 Ga0213876_10005886
150 Ga0207705_10001636
151 Ga0207684_10066837
152 Ga0207684_10205327
153 Ga0207652_10086872
154 Ga0207646_10039145
155 Ga0207686_10029654
156 Ga0207669_10169346
157 Ga0207683_10008362
158 Ga0209968_1013328
159 Ga0209971_1009400
160 Ga0209974_10002779
161 Ga0265324_10037493
162 Ga0265328_10002853
163 Ga0265331_10000109
164 Ga0265327_10000005
165 Ga0265327_10000243
166 Ga0265327_10021292
167 Ga0307408_100293205
168 Ga0316575_10023425
169 Ga0316576_10021079
170 Ga0316578_10088732
171 Ga0307405_10096199
172 Ga0307412_10053219
173 Ga0307411_10164948
174 Ga0316587_1006163
175 Ga0373957_0108923
176 Ga0316574_0013790
177 Ga0316574_0058323
178 Ga0316574_0068821
179 Ga0316574_0173344
180 Ga0373935_0075067
181 Ga0373937_0112980
182 Ga0316582_0097676
183 Ga0316582_0341052
184 Ga0316584_0018666
185 Ga0373925_0062685
186 Ga0436365_1778286
187 Ga0451577_0006681
188 Ga0451577_0163476
189 Ga0453684_0030949
190 Ga0453684_0135511
191 Ga0451576_0038947
192 Ga0451576_0042401
193 Ga0451576_0801330
194 Ga0495580_0354134
195 Ga0495621_0004826
196 Ga0495636_0002481
197 Ga0495636_0025961
198 Ga0501036_0168895
199 Ga0501038_0082726
200 Ga0501039_0028353
201 Ga0501040_0002542
202 Ga0501041_0005711
203 Ga0501048_0170988
204 Ga0501067_0019779
205 Ga0501069_0058472
206 Ga0501071_0052215
207 Ga0501072_0047823
208 Ga0501072_0114814
209 Ga0501072_0721465
210 Ga0501075_0008836
211 Ga0501076_0000777
212 Ga0501076_0554725
213 Ga0501077_0022815
214 Ga0501079_0047633
215 Ga0501080_0012186
216 Ga0501080_0212502
217 Ga0501081_0001386
218 Ga0501083_0060465
219 Ga0501045_0034625
220 nmdc:mga05p37_43553_c1
221 nmdc:mga09592_236681_c1
222 nmdc:mga06r32_314928_c1
223 nmdc:mga08y16_93130_c1
224 nmdc:mga0n895_211830_c1
225 nmdc:mga08x19_41676_c1
226 nmdc:mga0a205_24176_c1
227 Ga0501084_0188667
228 Ga0501082_0005329
229 Ga0530510_0048611
230 Ga0530510_0078296

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01875

Memo

Memo-like protein

6

261

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bcz-assembly1.cif.gz_A crystal structure of memo 0.8895 4 265
7m8h-assembly4.cif.gz_D structure of memo1 c244s metal binding site mutant at 1.75a 0.881 4 265
3bcz-assembly1.cif.gz_A crystal structure of memo 0.8674 4 265
7m8h-assembly4.cif.gz_D structure of memo1 c244s metal binding site mutant at 1.75a 0.8593 4 265
5l33-assembly1.cif.gz_A crystal structure of a de novo designed protein with curved beta-sheet 0.6619 193 242
ID Description Score Start End Superfamily
af_Q54NZ1_1_286_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8994 3 262 3.40.830.10
af_C0H4B1_3_295_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8924 3 263 3.40.830.10
af_A4ICL8_45_369_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8826 3 262 3.40.830.10
af_A0A1D8PFU2_2_335_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8814 3 263 3.40.830.10
af_Q9VG04_2_293_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8758 3 262 3.40.830.10
ID Description Score Start End GO Terms
AF-A0A809SAH3-F1-model_v4 AmmeMemoRadiSam system protein B 0.9941 177 266
AF-A0A2W4QR67-F1-model_v4 AmmeMemoRadiSam system protein B 0.9938 175 264
AF-A0A661E1A1-F1-model_v4 AmmeMemoRadiSam system protein B 0.9928 181 262
AF-A0A7Y2HS31-F1-model_v4 AmmeMemoRadiSam system protein B 0.9923 89 262
AF-A0A536UMP7-F1-model_v4 AmmeMemoRadiSam system protein B 0.9912 45 267

Map