F080060

General Info

Members Datasets Scaffolds Average Seq Length
114 54 114 342

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0027869|Ga0453684_0027869_6789_7886
Length 365
Sequence MQDSRFISILPILYILFQLPTMLLKNYRPQSKLIVKSTPVATPRFPVIDAHNHLGESFGGAWEKKPIRELLDRLDEAGVTHYVDLDGGWGEDILHAHLDAFKAKAPERFSVFGGVDWSQWAEKGDAFPAWAAGRLRLQKEHGADGLKIWKPFGLHVKDHLGQLAPIDDPRLDPIWQTAGELGLPVLIHIADPVAFFDPVDDHNERWEELGGNPDWAFTSPPFPPFLSLVNGLANLVARHPQTTFIGAHVGCYPENLAWVGVLLDRCPNFFVDISARIAELGRQPYTARKFFLQYADRILFGTDSGPNPEMYRIYYRFLETDDEYFNPNAGEIPWQGRWFIYGLYLPDNVLEKVYYGNAEKVLKIV

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
5 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
10 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
11 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
17 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
25 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
32 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
33 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
34 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
35 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
36 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
37 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
38 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
39 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
40 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
41 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
42 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
43 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
44 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
45 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
46 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
47 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
48 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
49 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
50 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
51 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
52 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
53 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
54 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_1339075 2162886006 Bacteria 3886
2 SwRhRL2b_contig_2149823 2162886007 Bacteria 26125
3 Ga0065707_10000466 3300005295 Bacteria 75195
4 Ga0065707_10084016 3300005295 Bacteria 7806
5 Ga0065707_10096555 3300005295 Bacteria 3257
6 Ga0065707_10106427 3300005295 Unclassified 2597
7 Ga0065707_10142878 3300005295 Bacteria 1750
8 Ga0070688_100105554 3300005365 Unclassified 1865
9 Ga0070694_100044731 3300005444 Bacteria 2964
10 Ga0070707_100091808 3300005468 Bacteria 2939
11 Ga0070698_100027816 3300005471 Bacteria 5875
12 Ga0070698_100157309 3300005471 Bacteria 2218
13 Ga0070698_100209838 3300005471 Bacteria 1882
14 Ga0070699_100021351 3300005518 Bacteria 5585
15 Ga0070699_100180359 3300005518 Bacteria 1874
16 Ga0070696_100220050 3300005546 Bacteria 1424
17 Ga0068859_100104674 3300005617 Unclassified 2889
18 Ga0068859_100180218 3300005617 Bacteria 2195
19 Ga0068864_100101851 3300005618 Bacteria 2548
20 Ga0068861_100020204 3300005719 Bacteria 4765
21 Ga0081539_10012106 3300005985 Bacteria 6703
22 Ga0081539_10069515 3300005985 Unclassified 1894
23 Ga0075427_10002522 3300006194 Bacteria 2464
24 Ga0075431_100003530 3300006847 Bacteria 15162
25 Ga0075431_100004491 3300006847 Bacteria 13691
26 Ga0075431_100013588 3300006847 Bacteria 8227
27 Ga0075431_100165689 3300006847 Bacteria 2272
28 Ga0075433_10007298 3300006852 Bacteria 8767
29 Ga0075434_100011627 3300006871 Bacteria 8312
30 Ga0075429_100002741 3300006880 Bacteria 14881
31 Ga0075429_100009974 3300006880 Bacteria 8233
32 Ga0075429_100022703 3300006880 Bacteria 5439
33 Ga0097620_100104671 3300006931 Unclassified 2889
34 Ga0097620_100180202 3300006931 Bacteria 2195
35 Ga0075435_100116841 3300007076 Unclassified 2223
36 Ga0111539_10035706 3300009094 Bacteria 6018
37 Ga0114129_10004942 3300009147 Bacteria 18798
38 Ga0114129_10019553 3300009147 Bacteria 9643
39 Ga0114129_10050795 3300009147 Bacteria 5823
40 Ga0114129_10073014 3300009147 Bacteria 4780
41 Ga0114129_10086278 3300009147 Bacteria 4354
42 Ga0114129_10108911 3300009147 Bacteria 3824
43 Ga0114129_10133083 3300009147 Bacteria 3414
44 Ga0114129_10140471 3300009147 Unclassified 3311
45 Ga0105249_10101621 3300009553 Bacteria 2704
46 Ga0157380_10226902 3300014326 Bacteria 1675
47 Ga0207646_10097269 3300025922 Unclassified 2637
48 Ga0207670_10026999 3300025936 Bacteria 3625
49 Ga0207712_10097140 3300025961 Bacteria 2182
50 Ga0207708_10059900 3300026075 Bacteria 2906
51 Ga0207675_100007012 3300026118 Bacteria 10655
52 Ga0268265_10352827 3300028380 Bacteria 1344
53 Ga0265326_10037248 3300028558 Bacteria 1383
54 Ga0265338_10027880 3300028800 Bacteria 5651
55 Ga0265340_10000355 3300031247 Bacteria 24409
56 Ga0307408_100127502 3300031548 Bacteria 1981
57 Ga0316576_10002072 3300031727 Bacteria 11259
58 Ga0316576_10020158 3300031727 Bacteria 4581
59 Ga0316576_10067815 3300031727 Bacteria 2627
60 Ga0316576_10182779 3300031727 Bacteria 1581
61 Ga0316578_10016180 3300031728 Unclassified 4031
62 Ga0307413_10029759 3300031824 Unclassified 3060
63 Ga0307410_10061190 3300031852 Unclassified 2576
64 Ga0307416_100204828 3300032002 Bacteria 1876
65 Ga0307416_100217528 3300032002 Bacteria 1829
66 Ga0307414_10293025 3300032004 Bacteria 1373
67 Ga0307414_10333572 3300032004 Bacteria 1296
68 Ga0307411_10179646 3300032005 Unclassified 1605
69 Ga0316585_10036353 3300032137 Unclassified 1561
70 Ga0316574_0024168 3300035398 Unclassified 3635
71 Ga0316584_0007766 3300036712 Bacteria 7355
72 Ga0316584_0027216 3300036712 Bacteria 4208
73 Ga0316584_0050734 3300036712 Bacteria 3102
74 Ga0451577_0002882 3300042876 Bacteria 19756
75 Ga0451577_0005056 3300042876 Bacteria 13621
76 Ga0451577_0170560 3300042876 Bacteria 1961
77 Ga0453683_0099492 3300044673 Unclassified 1826
78 Ga0453683_0199322 3300044673 Bacteria 1271
79 Ga0453684_0000012 3300044712 Bacteria 1062512
80 Ga0453684_0000169 3300044712 Bacteria 289762
81 Ga0453684_0009345 3300044712 Bacteria 17184
82 Ga0453684_0013415 3300044712 Bacteria 13309
83 Ga0453684_0019263 3300044712 Bacteria 10402
84 Ga0453684_0027869 3300044712 Bacteria 8081
85 Ga0453684_0028990 3300044712 Bacteria 7875
86 Ga0453684_0080527 3300044712 Unclassified 4066
87 Ga0453684_0084796 3300044712 Unclassified 3939
88 Ga0453684_0095180 3300044712 Bacteria 3661
89 Ga0453684_0158857 3300044712 Bacteria 2676
90 Ga0453684_0180483 3300044712 Unclassified 2479
91 Ga0453684_0248876 3300044712 Bacteria 2042
92 Ga0453684_0273068 3300044712 Bacteria 1931
93 Ga0453684_0315694 3300044712 Bacteria 1772
94 Ga0453684_0321465 3300044712 Unclassified 1752
95 Ga0453684_0441382 3300044712 Bacteria 1450
96 Ga0453684_0448564 3300044712 Bacteria 1436
97 Ga0451576_0000058 3300045051 Bacteria 298769
98 Ga0451576_0010042 3300045051 Bacteria 10903
99 Ga0451576_0010247 3300045051 Bacteria 10775
100 Ga0451576_0032940 3300045051 Bacteria 5510
101 nmdc:mga05p37_4635_c1 3300050507 Bacteria 16080
102 nmdc:mga05p37_60601_c1 3300050507 Unclassified 4659
103 nmdc:mga05p37_64321_c1 3300050507 Unclassified 4514
104 nmdc:mga05p37_94851_c1 3300050507 Bacteria 3676
105 nmdc:mga05p37_97624_c1 3300050507 Unclassified 3619
106 nmdc:mga09592_140146_c1 3300050508 Bacteria 2084
107 nmdc:mga09592_71551_c1 3300050508 Bacteria 2943
108 nmdc:mga09592_9039_c1 3300050508 Bacteria 8098
109 nmdc:mga09592_99035_c1 3300050508 Bacteria 2496
110 nmdc:mga06r32_12605_c1 3300050510 Bacteria 7637
111 nmdc:mga06r32_2971_c1 3300050510 Bacteria 15194
112 nmdc:mga0n895_18531_c1 3300050512 Bacteria 6444
113 nmdc:mga0rr50_77253_c1 3300050513 Bacteria 2558
114 nmdc:mga0a205_88557_c1 3300050515 Bacteria 2992

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006871 Ga0075434_100011627 Ga0075434_1000116275 299
2 3300044712 Ga0453684_0273068 Ga0453684_0273068_11_919 299
3 3300028800 Ga0265338_10027880 Ga0265338_100278803 305
4 3300028558 Ga0265326_10037248 Ga0265326_100372482 306
5 3300031247 Ga0265340_10000355 Ga0265340_1000035516 306
6 3300005617 Ga0068859_100180218 Ga0068859_1001802181 319
7 3300006931 Ga0097620_100180202 Ga0097620_1001802021 319
8 3300031727 Ga0316576_10067815 Ga0316576_100678152 330
9 3300036712 Ga0316584_0007766 Ga0316584_0007766_3450_4487 330
10 3300006847 Ga0075431_100003530 Ga0075431_1000035305 331
11 3300050510 nmdc:mga06r32_2971_c1 nmdc:mga06r32_2971_c1_8929_9981 331
12 3300005617 Ga0068859_100104674 Ga0068859_1001046742 334
13 3300006931 Ga0097620_100104671 Ga0097620_1001046712 334
14 3300009147 Ga0114129_10140471 Ga0114129_101404712 334
15 3300050507 nmdc:mga05p37_97624_c1 nmdc:mga05p37_97624_c1_1858_2874 334
16 3300044712 Ga0453684_0180483 Ga0453684_0180483_239_1306 338
17 3300044712 Ga0453684_0019263 Ga0453684_0019263_9232_10287 339
18 3300044712 Ga0453684_0448564 Ga0453684_0448564_30_1052 340
19 3300032004 Ga0307414_10333572 Ga0307414_103335722 342
20 3300032005 Ga0307411_10179646 Ga0307411_101796462 342
21 3300005295 Ga0065707_10084016 Ga0065707_100840163 343
22 3300005295 Ga0065707_10096555 Ga0065707_100965552 343
23 3300005295 Ga0065707_10142878 Ga0065707_101428781 343
24 3300005444 Ga0070694_100044731 Ga0070694_1000447312 343
25 3300005468 Ga0070707_100091808 Ga0070707_1000918083 343
26 3300005471 Ga0070698_100027816 Ga0070698_1000278164 343
27 3300005471 Ga0070698_100157309 Ga0070698_1001573092 343
28 3300005471 Ga0070698_100209838 Ga0070698_1002098382 343
29 3300005518 Ga0070699_100021351 Ga0070699_1000213513 343
30 3300005518 Ga0070699_100180359 Ga0070699_1001803591 343
31 3300005618 Ga0068864_100101851 Ga0068864_1001018511 343
32 3300005719 Ga0068861_100020204 Ga0068861_1000202044 343
33 3300006847 Ga0075431_100165689 Ga0075431_1001656892 343
34 3300006880 Ga0075429_100009974 Ga0075429_1000099742 343
35 3300006880 Ga0075429_100022703 Ga0075429_1000227033 343
36 3300009147 Ga0114129_10004942 Ga0114129_100049428 343
37 3300009147 Ga0114129_10086278 Ga0114129_100862782 343
38 3300009147 Ga0114129_10108911 Ga0114129_101089112 343
39 3300009553 Ga0105249_10101621 Ga0105249_101016212 343
40 3300025936 Ga0207670_10026999 Ga0207670_100269993 343
41 3300026075 Ga0207708_10059900 Ga0207708_100599002 343
42 3300026118 Ga0207675_100007012 Ga0207675_1000070127 343
43 3300028380 Ga0268265_10352827 Ga0268265_103528272 343
44 3300031548 Ga0307408_100127502 Ga0307408_1001275022 343
45 3300031824 Ga0307413_10029759 Ga0307413_100297593 343
46 3300031852 Ga0307410_10061190 Ga0307410_100611902 343
47 3300032004 Ga0307414_10293025 Ga0307414_102930252 343
48 3300044673 Ga0453683_0099492 Ga0453683_0099492_579_1610 343
49 3300044712 Ga0453684_0000169 Ga0453684_0000169_148072_149103 343
50 3300044712 Ga0453684_0080527 Ga0453684_0080527_281_1321 343
51 3300044712 Ga0453684_0158857 Ga0453684_0158857_1289_2320 343
52 3300044712 Ga0453684_0315694 Ga0453684_0315694_412_1443 343
53 3300044712 Ga0453684_0321465 Ga0453684_0321465_105_1145 343
54 3300045051 Ga0451576_0000058 Ga0451576_0000058_105989_107026 343
55 3300045051 Ga0451576_0010042 Ga0451576_0010042_8837_9877 343
56 3300045051 Ga0451576_0010247 Ga0451576_0010247_2897_3928 343
57 3300045051 Ga0451576_0032940 Ga0451576_0032940_812_1843 343
58 3300050507 nmdc:mga05p37_60601_c1 nmdc:mga05p37_60601_c1_3079_4110 343
59 3300050507 nmdc:mga05p37_94851_c1 nmdc:mga05p37_94851_c1_2529_3560 343
60 3300050508 nmdc:mga09592_140146_c1 nmdc:mga09592_140146_c1_326_1357 343
61 3300050508 nmdc:mga09592_71551_c1 nmdc:mga09592_71551_c1_1838_2869 343
62 3300050508 nmdc:mga09592_9039_c1 nmdc:mga09592_9039_c1_1060_2091 343
63 2162886006 SwRhRL3b_contig_1339075 SwRhRL3b_0780.00000370 344
64 2162886007 SwRhRL2b_contig_2149823 SwRhRL2b_0793.00003450 344
65 3300005295 Ga0065707_10000466 Ga0065707_1000046651 344
66 3300005295 Ga0065707_10106427 Ga0065707_101064272 344
67 3300005365 Ga0070688_100105554 Ga0070688_1001055542 344
68 3300005546 Ga0070696_100220050 Ga0070696_1002200502 344
69 3300005985 Ga0081539_10012106 Ga0081539_100121066 344
70 3300005985 Ga0081539_10069515 Ga0081539_100695152 344
71 3300006194 Ga0075427_10002522 Ga0075427_100025221 344
72 3300006847 Ga0075431_100004491 Ga0075431_1000044918 344
73 3300006847 Ga0075431_100013588 Ga0075431_1000135887 344
74 3300006852 Ga0075433_10007298 Ga0075433_100072987 344
75 3300006880 Ga0075429_100002741 Ga0075429_1000027415 344
76 3300007076 Ga0075435_100116841 Ga0075435_1001168412 344
77 3300009094 Ga0111539_10035706 Ga0111539_100357063 344
78 3300009147 Ga0114129_10019553 Ga0114129_100195534 344
79 3300009147 Ga0114129_10050795 Ga0114129_100507952 344
80 3300009147 Ga0114129_10073014 Ga0114129_100730143 344
81 3300009147 Ga0114129_10133083 Ga0114129_101330834 344
82 3300014326 Ga0157380_10226902 Ga0157380_102269022 344
83 3300025922 Ga0207646_10097269 Ga0207646_100972692 344
84 3300025961 Ga0207712_10097140 Ga0207712_100971401 344
85 3300031727 Ga0316576_10002072 Ga0316576_100020727 344
86 3300031727 Ga0316576_10020158 Ga0316576_100201584 344
87 3300031727 Ga0316576_10182779 Ga0316576_101827792 344
88 3300031728 Ga0316578_10016180 Ga0316578_100161802 344
89 3300032002 Ga0307416_100204828 Ga0307416_1002048282 344
90 3300032002 Ga0307416_100217528 Ga0307416_1002175282 344
91 3300032137 Ga0316585_10036353 Ga0316585_100363532 344
92 3300035398 Ga0316574_0024168 Ga0316574_0024168_249_1292 344
93 3300036712 Ga0316584_0027216 Ga0316584_0027216_3071_4108 344
94 3300036712 Ga0316584_0050734 Ga0316584_0050734_716_1759 344
95 3300042876 Ga0451577_0002882 Ga0451577_0002882_17709_18743 344
96 3300042876 Ga0451577_0005056 Ga0451577_0005056_8465_9499 344
97 3300042876 Ga0451577_0170560 Ga0451577_0170560_129_1166 344
98 3300044673 Ga0453683_0199322 Ga0453683_0199322_154_1188 344
99 3300044712 Ga0453684_0000012 Ga0453684_0000012_167446_168480 344
100 3300044712 Ga0453684_0009345 Ga0453684_0009345_14856_15896 344
101 3300044712 Ga0453684_0013415 Ga0453684_0013415_1014_2048 344
102 3300044712 Ga0453684_0027869 Ga0453684_0027869_6789_7886 344
103 3300044712 Ga0453684_0028990 Ga0453684_0028990_5402_6439 344
104 3300044712 Ga0453684_0084796 Ga0453684_0084796_1851_2894 344
105 3300044712 Ga0453684_0095180 Ga0453684_0095180_2299_3348 344
106 3300044712 Ga0453684_0248876 Ga0453684_0248876_215_1252 344
107 3300044712 Ga0453684_0441382 Ga0453684_0441382_80_1129 344
108 3300050507 nmdc:mga05p37_4635_c1 nmdc:mga05p37_4635_c1_10306_11340 344
109 3300050507 nmdc:mga05p37_64321_c1 nmdc:mga05p37_64321_c1_3281_4315 344
110 3300050508 nmdc:mga09592_99035_c1 nmdc:mga09592_99035_c1_34_1080 344
111 3300050510 nmdc:mga06r32_12605_c1 nmdc:mga06r32_12605_c1_2300_3337 344
112 3300050512 nmdc:mga0n895_18531_c1 nmdc:mga0n895_18531_c1_3907_4941 344
113 3300050513 nmdc:mga0rr50_77253_c1 nmdc:mga0rr50_77253_c1_1448_2491 344
114 3300050515 nmdc:mga0a205_88557_c1 nmdc:mga0a205_88557_c1_1526_2560 344

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

48

364

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uvz-assembly5.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.704 24 344
6uvz-assembly3.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6994 24 344
6uvz-assembly5.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.699 24 344
6uvz-assembly3.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6943 24 344
6uvz-assembly4.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6803 24 344
ID Description Score Start End Superfamily
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7587 45 344 3.20.20.140
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7143 44 343 3.20.20.140
3k4wC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.6942 24 343 3.20.20.140
3k4wC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.6852 24 343 3.20.20.140
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.6659 45 344 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A3D4YV94-F1-model_v4 deleted 0.9729 13 305
AF-X1EK51-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9703 38 285 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A847MIB4-F1-model_v4 Amidohydrolase family protein 0.9702 43 344 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A7C3LF30-F1-model_v4 Amidohydrolase 0.9691 109 344 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A3D4YV94-F1-model_v4 deleted 0.9664 13 305

Feature Viewer

pLDDT pTM Quality
91.91 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map