F066195

General Info

Members Datasets Scaffolds Average Seq Length
111 35 111 476

Family's Representative Sequence

Representative Sequence 3300049741|Ga0501079_0100197|Ga0501079_0100197_474_1991
Length 505
Sequence MPGFTPGRRWQPPYSPFKKQNFGDRALQVIEYGVKGPLFGCRMCGNCLLQETAFICPMECPKGLRNGPCGGSTSEYCYVDKTRPCIWYKIYERSFRLGREELLLEVLPPLDWEKVGQDSWRDVFRSVAKMGLRKAVTGLLSRSGQVRRETWDGIFRPVRQPDWWQGDSQYHPPAYTTPASELERRLAAGEFVVTSEITPPLSAATDKLIRNIEATKQYVTALNFTDNASATPRMTSWACSQVALDHGAEPVLQISARNRSRASLQSEVIGATALGVRNILCVTGDSAKLSPSPRENMDINDIDAIQMLWILRRMRDESKYLDGRELKHPPKFFLGAAASPFSSNPVFQALREQKKVNAGAQFFQTNLVFDVHGMELWLNELAKRDVLDKVYILIGIAPLKSLKMAAMLAEVPGVYMPERIVRRMEAAHVAGGAHEEGLQIALELITKVKTYHGQGVHGIHLMPVGWDEVVPRLVMEAGLMPGELIQDYTLGGIVAAGDGGLSSQW

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
5 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
6 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
7 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
9 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
10 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
11 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
12 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
13 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
14 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
15 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
16 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
17 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
18 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
19 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
21 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
22 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
23 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
24 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
25 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
26 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
27 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
28 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
29 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
30 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
31 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
32 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
33 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
34 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
35 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.2
Metatranscriptomes 1.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.2
Stem 0
Stem Tuber 0
Unclassified 1.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1837361 2162886007 Bacteria 5025
2 Ga0065704_10000466 3300005289 Bacteria 25227
3 Ga0065707_10000841 3300005295 Bacteria 28277
4 Ga0065707_10090001 3300005295 Bacteria 4231
5 Ga0065707_10105548 3300005295 Unclassified 2639
6 Ga0070707_100027013 3300005468 Bacteria 5457
7 Ga0070699_100005891 3300005518 Bacteria 10712
8 Ga0070699_100010901 3300005518 Bacteria 7860
9 Ga0070699_100040149 3300005518 Bacteria 4053
10 Ga0068862_100033592 3300005844 Bacteria 4338
11 Ga0081539_10001257 3300005985 Bacteria 44920
12 Ga0075434_100093222 3300006871 Bacteria 3015
13 Ga0075434_100191297 3300006871 Bacteria 2067
14 Ga0075429_100005283 3300006880 Bacteria 11109
15 Ga0114129_10000864 3300009147 Bacteria 39418
16 Ga0114129_10025082 3300009147 Bacteria 8449
17 Ga0114129_10265248 3300009147 Unclassified 2299
18 Ga0207708_10107508 3300026075 Bacteria 2163
19 Ga0265334_10006421 3300028573 Bacteria 5067
20 Ga0265331_10004031 3300031250 Bacteria 9257
21 Ga0265316_10072006 3300031344 Bacteria 2663
22 Ga0316575_10032512 3300031665 Bacteria 2044
23 Ga0316579_10008928 3300031691 Unclassified 4202
24 Ga0316579_10043940 3300031691 Bacteria 2080
25 Ga0316576_10016629 3300031727 Bacteria 4976
26 Ga0316576_10026511 3300031727 Unclassified 4068
27 Ga0316576_10068263 3300031727 Bacteria 2619
28 Ga0316576_10073913 3300031727 Bacteria 2519
29 Ga0316576_10126185 3300031727 Bacteria 1923
30 Ga0316576_10137290 3300031727 Bacteria 1840
31 Ga0316576_10172620 3300031727 Bacteria 1632
32 Ga0316578_10005345 3300031728 Bacteria 6212
33 Ga0316578_10014525 3300031728 Bacteria 4210
34 Ga0316578_10017523 3300031728 Bacteria 3900
35 Ga0316578_10049677 3300031728 Bacteria 2452
36 Ga0316578_10097712 3300031728 Bacteria 1759
37 Ga0316593_10032777 3300032168 Unclassified 1698
38 Ga0316593_10036999 3300032168 Bacteria 1611
39 Ga0316574_0074709 3300035398 Bacteria 2145
40 Ga0316584_0002372 3300036712 Bacteria 11890
41 Ga0316584_0005046 3300036712 Bacteria 8798
42 Ga0316584_0049449 3300036712 Bacteria 3143
43 Ga0316584_0055589 3300036712 Bacteria 2964
44 Ga0316584_0087900 3300036712 Bacteria 2327
45 Ga0316584_0104186 3300036712 Bacteria 2124
46 Ga0400488_13219 3300038741 Bacteria 2404
47 Ga0400487_25918 3300039110 Bacteria 1464
48 Ga0451577_0003134 3300042876 Bacteria 18641
49 Ga0451577_0004578 3300042876 Bacteria 14534
50 Ga0451577_0007285 3300042876 Bacteria 10898
51 Ga0451577_0046870 3300042876 Bacteria 3865
52 Ga0453683_0001481 3300044673 Bacteria 20127
53 Ga0453683_0004043 3300044673 Bacteria 10568
54 Ga0453683_0007522 3300044673 Bacteria 7377
55 Ga0453683_0041996 3300044673 Bacteria 2872
56 Ga0453683_0054159 3300044673 Bacteria 2511
57 Ga0453683_0100878 3300044673 Bacteria 1812
58 Ga0453684_0000007 3300044712 Bacteria 1301482
59 Ga0453684_0000157 3300044712 Bacteria 304259
60 Ga0453684_0000267 3300044712 Bacteria 225314
61 Ga0453684_0000372 3300044712 Bacteria 183969
62 Ga0453684_0001258 3300044712 Bacteria 76274
63 Ga0453684_0001558 3300044712 Bacteria 63769
64 Ga0453684_0002426 3300044712 Bacteria 45351
65 Ga0453684_0004854 3300044712 Bacteria 27601
66 Ga0453684_0007653 3300044712 Bacteria 19770
67 Ga0453684_0010058 3300044712 Bacteria 16264
68 Ga0453684_0010497 3300044712 Bacteria 15824
69 Ga0453684_0017534 3300044712 Bacteria 11083
70 Ga0453684_0018941 3300044712 Bacteria 10525
71 Ga0453684_0019401 3300044712 Bacteria 10355
72 Ga0453684_0027157 3300044712 Bacteria 8224
73 Ga0453684_0028154 3300044712 Bacteria 8031
74 Ga0453684_0029952 3300044712 Bacteria 7705
75 Ga0453684_0045181 3300044712 Bacteria 5880
76 Ga0453684_0072107 3300044712 Bacteria 4362
77 Ga0453684_0072504 3300044712 Bacteria 4347
78 Ga0453684_0073148 3300044712 Unclassified 4324
79 Ga0453684_0117645 3300044712 Bacteria 3216
80 Ga0453684_0144304 3300044712 Bacteria 2838
81 Ga0453684_0156761 3300044712 Unclassified 2698
82 Ga0453684_0162292 3300044712 Bacteria 2642
83 Ga0453684_0197383 3300044712 Bacteria 2348
84 Ga0453684_0253993 3300044712 Bacteria 2017
85 Ga0453684_0257348 3300044712 Unclassified 2001
86 Ga0453684_0328916 3300044712 Bacteria 1729
87 Ga0453684_0331480 3300044712 Bacteria 1721
88 Ga0453684_0514441 3300044712 Unclassified 1323
89 Ga0451576_0001278 3300045051 Bacteria 43871
90 Ga0451576_0002014 3300045051 Bacteria 32125
91 Ga0451576_0006214 3300045051 Bacteria 14707
92 Ga0451576_0006813 3300045051 Bacteria 13881
93 Ga0451576_0009453 3300045051 Bacteria 11300
94 Ga0451576_0021029 3300045051 Bacteria 7099
95 Ga0451576_0025892 3300045051 Bacteria 6318
96 Ga0451576_0058542 3300045051 Bacteria 4026
97 Ga0451576_0074150 3300045051 Unclassified 3541
98 Ga0451576_0118981 3300045051 Unclassified 2750
99 Ga0451576_0232742 3300045051 Bacteria 1924
100 Ga0451576_0323479 3300045051 Bacteria 1614
101 Ga0501071_0147290 3300049587 Bacteria 1755
102 Ga0501075_0001195 3300049591 Bacteria 16789
103 Ga0501079_0041134 3300049741 Unclassified 3567
104 Ga0501079_0100197 3300049741 Unclassified 2246
105 Ga0501080_0302642 3300049742 Bacteria 1450
106 nmdc:mga05p37_11293_c1 3300050507 Bacteria 10624
107 nmdc:mga05p37_1764_c1 3300050507 Bacteria 25269
108 nmdc:mga05p37_59767_c1 3300050507 Bacteria 4694
109 nmdc:mga09592_11259_c1 3300050508 Bacteria 7277
110 nmdc:mga0n895_239929_c1 3300050512 Bacteria 1839
111 Ga0501084_0118280 3300054114 Bacteria 2228

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0000007 Ga0453684_0000007_692086_693525 368
2 3300031727 Ga0316576_10137290 Ga0316576_101372902 372
3 3300031728 Ga0316578_10049677 Ga0316578_100496772 372
4 3300044712 Ga0453684_0019401 Ga0453684_0019401_2343_3830 374
5 3300044712 Ga0453684_0197383 Ga0453684_0197383_464_1891 377
6 3300044712 Ga0453684_0010497 Ga0453684_0010497_10877_12256 378
7 3300031727 Ga0316576_10073913 Ga0316576_100739132 379
8 3300031728 Ga0316578_10017523 Ga0316578_100175232 379
9 3300044712 Ga0453684_0117645 Ga0453684_0117645_622_2100 379
10 3300044712 Ga0453684_0514441 Ga0453684_0514441_20_1282 379
11 3300005518 Ga0070699_100005891 Ga0070699_1000058912 381
12 3300031728 Ga0316578_10097712 Ga0316578_100977122 381
13 3300042876 Ga0451577_0004578 Ga0451577_0004578_11044_12483 381
14 3300044712 Ga0453684_0000372 Ga0453684_0000372_128448_129887 381
15 3300044712 Ga0453684_0253993 Ga0453684_0253993_438_1877 381
16 3300045051 Ga0451576_0025892 Ga0451576_0025892_1181_2620 381
17 3300045051 Ga0451576_0232742 Ga0451576_0232742_453_1892 381
18 3300036712 Ga0316584_0002372 Ga0316584_0002372_8864_10015 382
19 3300044712 Ga0453684_0001258 Ga0453684_0001258_43532_44974 383
20 3300044712 Ga0453684_0010058 Ga0453684_0010058_3838_5349 383
21 3300044712 Ga0453684_0029952 Ga0453684_0029952_3146_4588 383
22 3300042876 Ga0451577_0003134 Ga0451577_0003134_16637_18082 384
23 3300044712 Ga0453684_0000267 Ga0453684_0000267_13729_15174 384
24 3300044712 Ga0453684_0004854 Ga0453684_0004854_12985_14430 384
25 3300044712 Ga0453684_0007653 Ga0453684_0007653_3606_5051 384
26 3300044712 Ga0453684_0045181 Ga0453684_0045181_3848_5290 384
27 3300031727 Ga0316576_10026511 Ga0316576_100265113 385
28 3300031727 Ga0316576_10126185 Ga0316576_101261852 385
29 3300031728 Ga0316578_10005345 Ga0316578_100053454 385
30 3300032168 Ga0316593_10036999 Ga0316593_100369991 385
31 3300036712 Ga0316584_0005046 Ga0316584_0005046_6907_8400 385
32 3300044712 Ga0453684_0018941 Ga0453684_0018941_2286_3776 385
33 3300035398 Ga0316574_0074709 Ga0316574_0074709_280_1776 386
34 3300044712 Ga0453684_0028154 Ga0453684_0028154_3778_5229 386
35 3300044673 Ga0453683_0001481 Ga0453683_0001481_7806_9074 387
36 3300044673 Ga0453683_0007522 Ga0453683_0007522_3534_4991 387
37 3300044712 Ga0453684_0144304 Ga0453684_0144304_751_2019 387
38 3300044712 Ga0453684_0331480 Ga0453684_0331480_470_1690 387
39 3300045051 Ga0451576_0002014 Ga0451576_0002014_16751_18019 387
40 3300028573 Ga0265334_10006421 Ga0265334_100064215 389
41 3300031250 Ga0265331_10004031 Ga0265331_100040313 389
42 3300031344 Ga0265316_10072006 Ga0265316_100720061 389
43 3300031727 Ga0316576_10068263 Ga0316576_100682633 389
44 3300044673 Ga0453683_0054159 Ga0453683_0054159_10_1299 389
45 3300044712 Ga0453684_0000157 Ga0453684_0000157_100714_102102 389
46 3300044712 Ga0453684_0328916 Ga0453684_0328916_486_1718 389
47 3300045051 Ga0451576_0006214 Ga0451576_0006214_10265_11725 389
48 3300005518 Ga0070699_100010901 Ga0070699_1000109016 391
49 3300044712 Ga0453684_0162292 Ga0453684_0162292_87_1553 391
50 3300031727 Ga0316576_10172620 Ga0316576_101726201 392
51 3300031728 Ga0316578_10014525 Ga0316578_100145251 392
52 3300036712 Ga0316584_0087900 Ga0316584_0087900_287_1756 392
53 3300044673 Ga0453683_0041996 Ga0453683_0041996_1201_2679 393
54 3300045051 Ga0451576_0001278 Ga0451576_0001278_36775_38253 393
55 3300031691 Ga0316579_10043940 Ga0316579_100439401 394
56 3300044673 Ga0453683_0004043 Ga0453683_0004043_7809_9254 394
57 3300044712 Ga0453684_0027157 Ga0453684_0027157_3835_5271 394
58 3300045051 Ga0451576_0006813 Ga0451576_0006813_1027_2499 394
59 3300045051 Ga0451576_0118981 Ga0451576_0118981_424_1869 394
60 3300005295 Ga0065707_10105548 Ga0065707_101055482 396
61 3300031691 Ga0316579_10008928 Ga0316579_100089282 396
62 3300036712 Ga0316584_0055589 Ga0316584_0055589_798_2279 396
63 3300044712 Ga0453684_0001558 Ga0453684_0001558_13241_14728 396
64 3300045051 Ga0451576_0058542 Ga0451576_0058542_1158_2384 396
65 3300045051 Ga0451576_0323479 Ga0451576_0323479_95_1408 396
66 3300049587 Ga0501071_0147290 Ga0501071_0147290_57_1367 397
67 3300049591 Ga0501075_0001195 Ga0501075_0001195_15132_16442 397
68 3300049741 Ga0501079_0041134 Ga0501079_0041134_289_1599 397
69 3300049741 Ga0501079_0100197 Ga0501079_0100197_474_1991 397
70 3300054114 Ga0501084_0118280 Ga0501084_0118280_11_1303 397
71 3300005985 Ga0081539_10001257 Ga0081539_1000125744 400
72 3300042876 Ga0451577_0046870 Ga0451577_0046870_2433_3845 400
73 3300044712 Ga0453684_0002426 Ga0453684_0002426_11022_12521 400
74 3300044712 Ga0453684_0072107 Ga0453684_0072107_514_2004 400
75 3300044712 Ga0453684_0073148 Ga0453684_0073148_1808_3229 400
76 3300044712 Ga0453684_0156761 Ga0453684_0156761_465_1955 400
77 3300044712 Ga0453684_0257348 Ga0453684_0257348_467_1957 400
78 3300031727 Ga0316576_10016629 Ga0316576_100166293 401
79 3300032168 Ga0316593_10032777 Ga0316593_100327771 401
80 3300036712 Ga0316584_0104186 Ga0316584_0104186_534_2030 401
81 3300038741 Ga0400488_13219 Ga0400488_13219_641_2137 401
82 3300039110 Ga0400487_25918 Ga0400487_25918_28_1449 401
83 3300044673 Ga0453683_0100878 Ga0453683_0100878_65_1558 401
84 3300045051 Ga0451576_0021029 Ga0451576_0021029_2472_3965 401
85 3300006871 Ga0075434_100093222 Ga0075434_1000932223 402
86 3300036712 Ga0316584_0049449 Ga0316584_0049449_935_2146 402
87 3300044712 Ga0453684_0017534 Ga0453684_0017534_6700_7968 402
88 3300045051 Ga0451576_0009453 Ga0451576_0009453_6621_7952 402
89 3300005295 Ga0065707_10090001 Ga0065707_100900013 403
90 3300042876 Ga0451577_0007285 Ga0451577_0007285_3229_4728 403
91 3300044712 Ga0453684_0072504 Ga0453684_0072504_658_2157 403
92 3300050507 nmdc:mga05p37_11293_c1 nmdc:mga05p37_11293_c1_8485_9984 403
93 3300009147 Ga0114129_10025082 Ga0114129_100250822 404
94 3300009147 Ga0114129_10265248 Ga0114129_102652482 404
95 3300031665 Ga0316575_10032512 Ga0316575_100325122 404
96 2162886007 SwRhRL2b_contig_1837361 SwRhRL2b_0659.00003140 406
97 3300005289 Ga0065704_10000466 Ga0065704_100004661 406
98 3300005295 Ga0065707_10000841 Ga0065707_1000084123 406
99 3300005468 Ga0070707_100027013 Ga0070707_1000270133 406
100 3300005518 Ga0070699_100040149 Ga0070699_1000401493 406
101 3300005844 Ga0068862_100033592 Ga0068862_1000335922 406
102 3300006871 Ga0075434_100191297 Ga0075434_1001912972 406
103 3300006880 Ga0075429_100005283 Ga0075429_1000052835 406
104 3300009147 Ga0114129_10000864 Ga0114129_1000086431 406
105 3300026075 Ga0207708_10107508 Ga0207708_101075082 406
106 3300045051 Ga0451576_0074150 Ga0451576_0074150_1602_2822 406
107 3300049742 Ga0501080_0302642 Ga0501080_0302642_41_1423 406
108 3300050507 nmdc:mga05p37_1764_c1 nmdc:mga05p37_1764_c1_18302_19810 406
109 3300050507 nmdc:mga05p37_59767_c1 nmdc:mga05p37_59767_c1_2034_3542 406
110 3300050508 nmdc:mga09592_11259_c1 nmdc:mga09592_11259_c1_4384_5892 406
111 3300050512 nmdc:mga0n895_239929_c1 nmdc:mga0n895_239929_c1_248_1756 406

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12225

DUF5981

Methylene-tetrahydrofolate reductase C terminal

23

113

0.93

PF02219

MTHFR

Methylenetetrahydrofolate reductase

181

478

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fmo-assembly1.cif.gz_A ala177val mutant of e. coli methylenetetrahydrofolate reductase 0.8687 94 385
2fmo-assembly1.cif.gz_A ala177val mutant of e. coli methylenetetrahydrofolate reductase 0.8656 94 385
2fmo-assembly1.cif.gz_C ala177val mutant of e. coli methylenetetrahydrofolate reductase 0.8629 94 385
3fst-assembly1.cif.gz_C crystal structure of escherichia coli methylenetetrahydrofolate reductase mutant phe223leu at ph 7.4 0.8621 94 385
3fsu-assembly1.cif.gz_C crystal structure of escherichia coli methylenetetrahydrofolate reductase double mutant phe223leuglu28gln complexed with methyltetrahydrofolate 0.8618 94 385
ID Description Score Start End Superfamily
af_Q2G121_302_599_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8786 75 377 3.20.20.220
af_Q2G121_302_599_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8676 75 377 3.20.20.220
1v93A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.82 85 383 3.20.20.220
af_Q17693_57_348_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8162 86 379 3.20.20.220
af_P46151_1_302_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8095 88 381 3.20.20.220
ID Description Score Start End GO Terms
AF-A0A1F8KHZ1-F1-model_v4 Methylenetetrahydrofolate reductase 0.9835 87 389 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A7X9DN37-F1-model_v4 Methylenetetrahydrofolate reductase 0.9802 98 370 GO:0004489
GO:0005829
GO:0009086
GO:0035999
GO:0071949
AF-A0A7X9DN37-F1-model_v4 Methylenetetrahydrofolate reductase 0.9731 98 370 GO:0004489
GO:0005829
GO:0009086
GO:0035999
GO:0071949
AF-A0A7X9J711-F1-model_v4 Methylenetetrahydrofolate reductase 0.9721 157 386 GO:0004489
GO:0005829
GO:0009086
GO:0035999
GO:0071949
AF-A0A4S0LFL5-F1-model_v4 deleted 0.9714 205 308

Feature Viewer

pLDDT pTM Quality
86.77 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map