F065877

General Info

Members Datasets Scaffolds Average Seq Length
111 74 110 231

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0000009|Ga0496108_0000009_148358_149143
Length 261
Sequence MPEWSPFVVRLPSFVPETYFTAHASRKELRVTLIEIRDVTKVYRMGDVEVHALRGVSLVIDEGELVAIMGPSGSGKSTLMNILGCLDQPTDGTYLLDDVDVGQLNDDQLAAIRNRKVGFVFQQYMLLQRTDALRNVELPLLYCSVPDRRARARTALEAVGMGERLHHKPNELSGGQQQRVAIARSLVNTPRIILADEPTGALDTATGEEIMQIFEKLNRDQGMTIILVTHEPMIAAHARRTIHVRDGLIVADERHAPAIAV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
27 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
28 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
37 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
38 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
39 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
40 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
41 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
42 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
43 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
44 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
45 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
46 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
47 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
49 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
50 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
51 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
52 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
53 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
54 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
55 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
56 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
57 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
58 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
59 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
60 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
61 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
62 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
63 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
64 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
65 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
66 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
67 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
68 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
69 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
70 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
71 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
72 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
73 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
74 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.2
Metatranscriptomes 0.9
Isolates 0.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 2.7
Rhizosphere 95.5
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_364859 2162886007 Bacteria 6586
2 JGI25406J46586_10045636 3300003203 Bacteria 1507
3 JGI25407J50210_10019790 3300003373 Bacteria 1750
4 Ga0065704_10000260 3300005289 Bacteria 50456
5 Ga0065707_10000628 3300005295 Bacteria 17722
6 Ga0065707_10000680 3300005295 Bacteria 25390
7 Ga0070690_100003708 3300005330 Bacteria 8411
8 Ga0070714_100072826 3300005435 Bacteria 2975
9 Ga0070713_100004319 3300005436 Bacteria 9530
10 Ga0070694_100178403 3300005444 Bacteria 1569
11 Ga0070708_100049504 3300005445 Bacteria 3717
12 Ga0070708_100168228 3300005445 Bacteria 2045
13 Ga0070678_100011813 3300005456 Bacteria 5403
14 Ga0070706_100040161 3300005467 Bacteria 4319
15 Ga0070707_100014482 3300005468 Bacteria 7390
16 Ga0070707_100126159 3300005468 Bacteria 2487
17 Ga0070707_100438545 3300005468 Bacteria 1266
18 Ga0070698_100060204 3300005471 Bacteria 3832
19 Ga0070699_100017887 3300005518 Bacteria 6086
20 Ga0070699_100026277 3300005518 Bacteria 5021
21 Ga0070699_100069487 3300005518 Bacteria 3060
22 Ga0068857_100496657 3300005577 Bacteria 1145
23 Ga0081538_10001666 3300005981 Bacteria 22696
24 Ga0070717_10001021 3300006028 Bacteria 18778
25 Ga0075428_100183024 3300006844 Bacteria 2267
26 Ga0075431_100333551 3300006847 Bacteria 1527
27 Ga0075433_10041481 3300006852 Bacteria 3988
28 Ga0075429_100588685 3300006880 Bacteria 975
29 Ga0111539_10000052 3300009094 Bacteria 116307
30 Ga0105246_10435102 3300011119 Bacteria 1098
31 Ga0157375_10167906 3300013308 Bacteria 2340
32 Ga0157380_10507176 3300014326 Bacteria 1173
33 Ga0207684_10034338 3300025910 Bacteria 4310
34 Ga0207646_10000249 3300025922 Bacteria 73284
35 Ga0207646_10104196 3300025922 Bacteria 2544
36 Ga0207659_10385866 3300025926 Bacteria 1169
37 Ga0207687_10075739 3300025927 Bacteria 2415
38 Ga0207700_10002958 3300025928 Bacteria 9799
39 Ga0207664_10678710 3300025929 Bacteria 926
40 Ga0207689_10252700 3300025942 Bacteria 1458
41 Ga0268264_10374530 3300028381 Bacteria 1362
42 Ga0265323_10108540 3300028653 Bacteria 912
43 Ga0265316_10206838 3300031344 Bacteria 1453
44 Ga0265316_10315902 3300031344 Bacteria 1136
45 Ga0307408_100186543 3300031548 Bacteria 1668
46 Ga0316575_10051357 3300031665 Bacteria 1642
47 Ga0316579_10079263 3300031691 Bacteria 1563
48 Ga0316576_10106642 3300031727 Bacteria 2098
49 Ga0316577_10012419 3300031733 Bacteria 4640
50 Ga0316577_10183385 3300031733 Bacteria 1182
51 Ga0307413_10037944 3300031824 Bacteria 2788
52 Ga0307410_10278737 3300031852 Bacteria 1311
53 Ga0307416_100177988 3300032002 Bacteria 1990
54 Ga0316585_10015900 3300032137 Bacteria 2261
55 Ga0316593_10107913 3300032168 Bacteria 992
56 Ga0316574_0164569 3300035398 Bacteria 1428
57 Ga0316582_0054169 3300036647 Bacteria 2552
58 Ga0316582_0149664 3300036647 Bacteria 1577
59 Ga0316582_0173684 3300036647 Bacteria 1464
60 Ga0316584_0002266 3300036712 Bacteria 12101
61 Ga0316584_0262515 3300036712 Bacteria 1259
62 Ga0395900_0160990 3300037418 Bacteria 2289
63 Ga0395900_0307307 3300037418 Bacteria 1570
64 Ga0395905_0079714 3300037471 Bacteria 3069
65 Ga0316581_0039680 3300037588 Bacteria 1433
66 Ga0395901_0112849 3300038443 Bacteria 2854
67 Ga0395901_0132194 3300038443 Bacteria 2622
68 Ga0451797_1292170 3300041453 Bacteria 768
69 Ga0451577_0298699 3300042876 Bacteria 1459
70 Ga0451577_0426643 3300042876 Bacteria 1204
71 Ga0451577_0862941 3300042876 Bacteria 816
72 Ga0466972_0001335 3300044658 Bacteria 11953
73 Ga0453683_0022846 3300044673 Bacteria 3988
74 Ga0466965_0001070 3300044683 Bacteria 10630
75 Ga0453684_0000171 3300044712 Bacteria 286600
76 Ga0453684_0000263 3300044712 Bacteria 226494
77 Ga0453684_0000484 3300044712 Bacteria 157641
78 Ga0453684_0002493 3300044712 Bacteria 44463
79 Ga0453684_0003836 3300044712 Bacteria 33167
80 Ga0453684_0008070 3300044712 Bacteria 19033
81 Ga0453684_0011103 3300044712 Bacteria 15196
82 Ga0453684_0015151 3300044712 Bacteria 12231
83 Ga0453684_0052590 3300044712 Bacteria 5324
84 Ga0453684_0131811 3300044712 Bacteria 2998
85 Ga0453684_0154477 3300044712 Bacteria 2723
86 Ga0453684_0187548 3300044712 Bacteria 2422
87 Ga0453684_0210238 3300044712 Bacteria 2262
88 Ga0453684_0277554 3300044712 Bacteria 1912
89 Ga0453684_0533865 3300044712 Bacteria 1294
90 Ga0453684_0626278 3300044712 Bacteria 1176
91 Ga0453684_0979939 3300044712 Bacteria 900
92 Ga0453684_1156091 3300044712 Bacteria 815
93 Ga0466968_0083325 3300044735 Bacteria 1408
94 Ga0466960_0001258 3300044901 Bacteria 9188
95 Ga0451576_0048947 3300045051 Bacteria 4437
96 Ga0451576_0409124 3300045051 Bacteria 1423
97 Ga0496108_0000009 3300048911 Bacteria 276390
98 Ga0496110_0086318 3300048913 Bacteria 2802
99 Ga0501227_045019 3300049665 Bacteria 1100
100 Ga0501212_012090 3300049851 Bacteria 1252
101 nmdc:mga05p37_1199088_c1 3300050507 Bacteria 784
102 nmdc:mga05p37_857694_c1 3300050507 Bacteria 985
103 nmdc:mga05p37_93372_c1 3300050507 Bacteria 3708
104 nmdc:mga09592_57570_c1 3300050508 Bacteria 3286
105 nmdc:mga08y16_254530_c1 3300050511 Bacteria 1814
106 nmdc:mga0a205_51101_c1 3300050515 Bacteria 3990
107 nmdc:mga0a205_66542_c1 3300050515 Bacteria 3482
108 Ga0495655_0000031 3300053083 Bacteria 30487
109 Ga0500556_0001388 3300053104 Bacteria 10573
110 Ga0530510_0398609 3300061734 Bacteria 1037

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050515 nmdc:mga0a205_66542_c1 nmdc:mga0a205_66542_c1_2806_3387 193
2 3300044712 Ga0453684_0979939 Ga0453684_0979939_218_874 206
3 3300044712 Ga0453684_1156091 Ga0453684_1156091_20_676 206
4 3300005436 Ga0070713_100004319 Ga0070713_1000043194 208
5 3300005445 Ga0070708_100049504 Ga0070708_1000495043 208
6 3300005445 Ga0070708_100168228 Ga0070708_1001682281 208
7 3300005456 Ga0070678_100011813 Ga0070678_1000118132 208
8 3300005467 Ga0070706_100040161 Ga0070706_1000401612 208
9 3300005468 Ga0070707_100438545 Ga0070707_1004385452 208
10 3300005518 Ga0070699_100026277 Ga0070699_1000262773 208
11 3300005577 Ga0068857_100496657 Ga0068857_1004966572 208
12 3300009094 Ga0111539_10000052 Ga0111539_1000005215 208
13 3300025910 Ga0207684_10034338 Ga0207684_100343383 208
14 3300025922 Ga0207646_10104196 Ga0207646_101041963 208
15 3300025928 Ga0207700_10002958 Ga0207700_100029587 208
16 3300044712 Ga0453684_0000484 Ga0453684_0000484_3007_3696 208
17 3300053083 Ga0495655_0000031 Ga0495655_0000031_2382_3131 208
18 3300003203 JGI25406J46586_10045636 JGI25406J46586_100456362 209
19 3300031665 Ga0316575_10051357 Ga0316575_100513572 209
20 3300031727 Ga0316576_10106642 Ga0316576_101066422 209
21 3300031733 Ga0316577_10012419 Ga0316577_100124193 209
22 3300032137 Ga0316585_10015900 Ga0316585_100159002 209
23 3300032168 Ga0316593_10107913 Ga0316593_101079131 209
24 3300035398 Ga0316574_0164569 Ga0316574_0164569_190_867 209
25 3300036647 Ga0316582_0054169 Ga0316582_0054169_213_890 209
26 3300036712 Ga0316584_0002266 Ga0316584_0002266_5022_5699 209
27 3300037588 Ga0316581_0039680 Ga0316581_0039680_500_1177 209
28 3300044712 Ga0453684_0003836 Ga0453684_0003836_24843_25532 209
29 3300044712 Ga0453684_0533865 Ga0453684_0533865_235_912 209
30 3300006844 Ga0075428_100183024 Ga0075428_1001830242 210
31 3300006847 Ga0075431_100333551 Ga0075431_1003335512 210
32 3300011119 Ga0105246_10435102 Ga0105246_104351022 210
33 3300014326 Ga0157380_10507176 Ga0157380_105071762 210
34 3300031344 Ga0265316_10206838 Ga0265316_102068382 210
35 3300031548 Ga0307408_100186543 Ga0307408_1001865432 210
36 3300031824 Ga0307413_10037944 Ga0307413_100379442 210
37 3300031852 Ga0307410_10278737 Ga0307410_102787372 210
38 3300036647 Ga0316582_0173684 Ga0316582_0173684_235_957 210
39 3300044673 Ga0453683_0022846 Ga0453683_0022846_2825_3505 210
40 3300044712 Ga0453684_0011103 Ga0453684_0011103_5101_5820 210
41 3300044712 Ga0453684_0131811 Ga0453684_0131811_1979_2659 210
42 3300044712 Ga0453684_0154477 Ga0453684_0154477_1766_2446 210
43 3300044712 Ga0453684_0187548 Ga0453684_0187548_1728_2408 210
44 3300044712 Ga0453684_0277554 Ga0453684_0277554_576_1256 210
45 3300045051 Ga0451576_0409124 Ga0451576_0409124_717_1397 210
46 3300049665 Ga0501227_045019 Ga0501227_045019_261_938 210
47 3300049851 Ga0501212_012090 Ga0501212_012090_324_1001 210
48 3300050507 nmdc:mga05p37_857694_c1 nmdc:mga05p37_857694_c1_150_854 210
49 3300050507 nmdc:mga05p37_93372_c1 nmdc:mga05p37_93372_c1_1186_1869 210
50 3300050508 nmdc:mga09592_57570_c1 nmdc:mga09592_57570_c1_815_1498 210
51 3300028653 Ga0265323_10108540 Ga0265323_101085401 211
52 3300031344 Ga0265316_10315902 Ga0265316_103159022 211
53 3300042876 Ga0451577_0426643 Ga0451577_0426643_240_923 211
54 3300044712 Ga0453684_0000171 Ga0453684_0000171_109454_110137 211
55 3300044712 Ga0453684_0000263 Ga0453684_0000263_60531_61214 211
56 3300044712 Ga0453684_0210238 Ga0453684_0210238_1286_1987 211
57 3300042876 Ga0451577_0298699 Ga0451577_0298699_468_1157 212
58 3300044712 Ga0453684_0015151 Ga0453684_0015151_9054_9743 212
59 3300005435 Ga0070714_100072826 Ga0070714_1000728262 213
60 3300005468 Ga0070707_100014482 Ga0070707_1000144824 213
61 3300005471 Ga0070698_100060204 Ga0070698_1000602042 213
62 3300005518 Ga0070699_100017887 Ga0070699_1000178872 213
63 3300006028 Ga0070717_10001021 Ga0070717_1000102110 213
64 3300025922 Ga0207646_10000249 Ga0207646_1000024953 213
65 3300025929 Ga0207664_10678710 Ga0207664_106787102 213
66 3300053104 Ga0500556_0001388 Ga0500556_0001388_9811_10524 214
67 3300031691 Ga0316579_10079263 Ga0316579_100792632 215
68 3300013308 Ga0157375_10167906 Ga0157375_101679062 216
69 3300025926 Ga0207659_10385866 Ga0207659_103858662 216
70 3300025927 Ga0207687_10075739 Ga0207687_100757392 216
71 3300025942 Ga0207689_10252700 Ga0207689_102527002 216
72 3300028381 Ga0268264_10374530 Ga0268264_103745302 216
73 3300044712 Ga0453684_0008070 Ga0453684_0008070_11728_12426 216
74 3300048913 Ga0496110_0086318 Ga0496110_0086318_467_1153 216
75 3300006852 Ga0075433_10041481 Ga0075433_100414815 217
76 3300031733 Ga0316577_10183385 Ga0316577_101833851 217
77 3300036647 Ga0316582_0149664 Ga0316582_0149664_807_1508 217
78 3300036712 Ga0316584_0262515 Ga0316584_0262515_406_1107 217
79 3300044712 Ga0453684_0002493 Ga0453684_0002493_26277_26978 217
80 3300048911 Ga0496108_0000009 Ga0496108_0000009_148358_149143 217
81 3300050515 nmdc:mga0a205_51101_c1 nmdc:mga0a205_51101_c1_411_1106 217
82 3300042876 Ga0451577_0862941 Ga0451577_0862941_81_788 218
83 3300050511 nmdc:mga08y16_254530_c1 nmdc:mga08y16_254530_c1_503_1228 218
84 3300041453 Ga0451797_1292170 Ga0451797_1292170_46_741 219
85 3300044712 Ga0453684_0052590 Ga0453684_0052590_3395_4105 219
86 3300050507 nmdc:mga05p37_1199088_c1 nmdc:mga05p37_1199088_c1_32_691 219
87 3300006880 Ga0075429_100588685 Ga0075429_1005886852 220
88 3300032002 Ga0307416_100177988 Ga0307416_1001779884 220
89 3300005330 Ga0070690_100003708 Ga0070690_1000037084 224
90 3300003373 JGI25407J50210_10019790 JGI25407J50210_100197903 225
91 3300005981 Ga0081538_10001666 Ga0081538_1000166615 225
92 3300037418 Ga0395900_0160990 Ga0395900_0160990_1319_2044 225
93 3300037418 Ga0395900_0307307 Ga0395900_0307307_263_988 225
94 3300037471 Ga0395905_0079714 Ga0395905_0079714_1744_2469 225
95 3300038443 Ga0395901_0112849 Ga0395901_0112849_1812_2537 225
96 3300038443 Ga0395901_0132194 Ga0395901_0132194_1762_2487 225
97 iso_pu_bacteria 2870782633 2870788882 225
98 3300044658 Ga0466972_0001335 Ga0466972_0001335_10657_11382 226
99 3300044683 Ga0466965_0001070 Ga0466965_0001070_7872_8597 226
100 3300044735 Ga0466968_0083325 Ga0466968_0083325_229_954 226
101 3300044901 Ga0466960_0001258 Ga0466960_0001258_1367_2092 226
102 3300045051 Ga0451576_0048947 Ga0451576_0048947_353_1069 226
103 3300061734 Ga0530510_0398609 Ga0530510_0398609_169_939 226
104 3300044712 Ga0453684_0626278 Ga0453684_0626278_13_750 227
105 2162886007 SwRhRL2b_contig_364859 SwRhRL2b_0999.00006730 228
106 3300005289 Ga0065704_10000260 Ga0065704_100002603 228
107 3300005295 Ga0065707_10000628 Ga0065707_1000062816 228
108 3300005295 Ga0065707_10000680 Ga0065707_1000068018 228
109 3300005444 Ga0070694_100178403 Ga0070694_1001784032 228
110 3300005468 Ga0070707_100126159 Ga0070707_1001261592 228
111 3300005518 Ga0070699_100069487 Ga0070699_1000694873 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

53

200

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9773 8 212
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9746 1 213
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9725 8 211
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9725 1 212
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9693 1 211
ID Description Score Start End Superfamily
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9725 8 211 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9718 8 212 3.40.50.300
af_P9WQK5_1_219_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9709 8 201 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9707 1 207 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9695 3 213 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7W4E403-F1-model_v4 ABC transporter ATP-binding protein 0.9952 9 209 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A1E3YS07-F1-model_v4 Macrolide ABC transporter ATP-binding protein 0.9946 22 215 GO:0005524
GO:0005886
GO:0016887
AF-A0A1S8R5E0-F1-model_v4 deleted 0.993 8 212
AF-A0A1L7D6L8-F1-model_v4 Peptide ABC transporter ATP-binding protein 0.9921 8 208 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7V5GYT8-F1-model_v4 ABC transporter ATP-binding protein 0.992 9 213 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Feature Viewer

pLDDT pTM Quality
90.36 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map