F060304

General Info

Members Datasets Scaffolds Average Seq Length
110 82 220 197

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0261691|Ga0451577_0261691_663_1319
Length 218
Sequence VATPPSIKRCDWVLSDPLYVRYHDDEWGVPVTDDKTLFEFLLLEGAQAGLSWLTILRKRENYRRAFADFDPRKVARFDAEKIERLLKDPGIVRNRAKLASAVKNARAFLAVQEEFGSFAAYQWRFVDGRPVQNRFSNLKEVPPRSEISDAFSKDLRARGFSFVGSTIMYAHMQAVGMVNDHLMTCHRYKPVAQLGKTFQAPSARTTSSMPSAKRTRGQ

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
29 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
30 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
47 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
48 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
51 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
52 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
53 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
54 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
55 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
56 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
57 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
58 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
59 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
62 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
68 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
69 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
70 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
71 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
72 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
77 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
79 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
80 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
81 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
82 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.55
Metatranscriptomes 5.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 94.55
Stem 0
Stem Tuber 0
Unclassified 9.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0261691 3300042876 Bacteria 1566
2 Ga0070683_100092907 3300005329 Bacteria 2834
3 Ga0070670_100564439 3300005331 Bacteria 1016
4 Ga0070680_100044027 3300005336 Bacteria 3626
5 Ga0070692_10070001 3300005345 Bacteria 1867
6 Ga0070673_100446311 3300005364 Bacteria 1163
7 Ga0070709_10150482 3300005434 Bacteria 1608
8 Ga0070708_100361899 3300005445 Bacteria 1367
9 Ga0070706_100195779 3300005467 Bacteria 1888
10 Ga0070699_100001119 3300005518 Bacteria 24966
11 Ga0070697_100294603 3300005536 Bacteria 1394
12 Ga0070672_100014622 3300005543 Bacteria 5566
13 Ga0070695_100478622 3300005545 Bacteria 959
14 Ga0070693_100181141 3300005547 Bacteria 1356
15 Ga0070665_100039780 3300005548 Bacteria 4726
16 Ga0068855_101081876 3300005563 Bacteria 839
17 Ga0068862_100598890 3300005844 Bacteria 1058
18 Ga0081540_1000083 3300005983 Bacteria 100350
19 Ga0070716_100133440 3300006173 Bacteria 1573
20 Ga0097621_100165059 3300006237 Bacteria 1906
21 Ga0075428_100031945 3300006844 Bacteria 5816
22 Ga0075431_100613719 3300006847 Bacteria 1071
23 Ga0114129_10388502 3300009147 Bacteria 1841
24 Ga0105243_10662596 3300009148 Bacteria 1013
25 Ga0157370_10194336 3300013104 Bacteria 1883
26 Ga0157378_10493163 3300013297 Bacteria 1222
27 Ga0157372_10319353 3300013307 Bacteria 1808
28 Ga0157379_11355185 3300014968 Bacteria 688
29 Ga0157376_10125725 3300014969 Unclassified 2280
30 Ga0206356_10283487 3300020070 Bacteria 1874
31 Ga0206349_1653989 3300020075 Bacteria 1911
32 Ga0206352_10875233 3300020078 Bacteria 1812
33 Ga0206350_11618143 3300020080 Bacteria 3909
34 Ga0224712_10024102 3300022467 Bacteria 2121
35 Ga0224712_10032597 3300022467 Bacteria 1900
36 Ga0207681_10710911 3300025923 Bacteria 836
37 Ga0207650_10840955 3300025925 Bacteria 778
38 Ga0207706_10487390 3300025933 Bacteria 1065
39 Ga0207691_10010211 3300025940 Bacteria 9007
40 Ga0207661_10089676 3300025944 Bacteria 2559
41 Ga0207667_10391730 3300025949 Bacteria 1415
42 Ga0207651_10542752 3300025960 Bacteria 1010
43 Ga0207677_10482221 3300026023 Bacteria 1069
44 Ga0207708_10250700 3300026075 Bacteria 1426
45 Ga0207702_10544153 3300026078 Bacteria 1135
46 Ga0268266_10105104 3300028379 Bacteria 2494
47 Ga0265326_10020900 3300028558 Bacteria 1876
48 Ga0265323_10017808 3300028653 Unclassified 2754
49 Ga0265336_10038414 3300028666 Bacteria 1470
50 Ga0265338_10018362 3300028800 Bacteria 7491
51 Ga0265338_10132831 3300028800 Bacteria 1962
52 Ga0265324_10000140 3300029957 Bacteria 56463
53 Ga0265330_10002095 3300031235 Bacteria 11019
54 Ga0265330_10006017 3300031235 Bacteria 6007
55 Ga0265330_10036543 3300031235 Bacteria 2189
56 Ga0265320_10027429 3300031240 Unclassified 2970
57 Ga0265320_10117502 3300031240 Unclassified 1215
58 Ga0265329_10015181 3300031242 Unclassified 2697
59 Ga0265329_10048582 3300031242 Bacteria 1353
60 Ga0265340_10016700 3300031247 Unclassified 3798
61 Ga0265339_10000009 3300031249 Bacteria 221449
62 Ga0265339_10064425 3300031249 Unclassified 1967
63 Ga0265331_10020885 3300031250 Unclassified 3356
64 Ga0265316_10000325 3300031344 Bacteria 53021
65 Ga0265316_10027526 3300031344 Bacteria 4705
66 Ga0265316_10055614 3300031344 Unclassified 3094
67 Ga0265316_10119431 3300031344 Bacteria 1992
68 Ga0307513_10110697 3300031456 Bacteria 2740
69 Ga0265313_10004557 3300031595 Bacteria 10560
70 Ga0265314_10000030 3300031711 Bacteria 266231
71 Ga0265342_10000936 3300031712 Bacteria 29007
72 Ga0265342_10018847 3300031712 Bacteria 4462
73 Ga0265342_10099177 3300031712 Bacteria 1661
74 Ga0316577_10488577 3300031733 Bacteria 700
75 Ga0373937_0733181 3300036401 Bacteria 935
76 Ga0395899_0608366 3300037312 Bacteria 695
77 Ga0395900_0775184 3300037418 Bacteria 888
78 Ga0395905_0083330 3300037471 Unclassified 2996
79 Ga0400485_11239 3300038735 Bacteria 25061
80 Ga0400486_28205 3300038742 Bacteria 5522
81 Ga0400489_12366 3300039093 Bacteria 5944
82 Ga0400489_39430 3300039093 Bacteria 30428
83 Ga0436365_0694009 3300039437 Bacteria 1992
84 Ga0439458_0034108 3300042157 Bacteria 1221
85 Ga0439460_0073540 3300042461 Bacteria 1062
86 Ga0451577_0000033 3300042876 Bacteria 378714
87 Ga0451577_0003653 3300042876 Bacteria 16875
88 Ga0451577_0007916 3300042876 Bacteria 10385
89 Ga0451577_0121471 3300042876 Bacteria 2340
90 Ga0453684_0000034 3300044712 Bacteria 728457
91 Ga0453684_0000109 3300044712 Bacteria 361015
92 Ga0453684_0000140 3300044712 Bacteria 319864
93 Ga0453684_0000991 3300044712 Bacteria 92722
94 Ga0453684_0055294 3300044712 Bacteria 5161
95 Ga0453684_0079697 3300044712 Bacteria 4093
96 Ga0453684_0277355 3300044712 Bacteria 1913
97 Ga0453684_1123246 3300044712 Bacteria 829
98 Ga0451576_0004180 3300045051 Bacteria 18992
99 Ga0451576_0036121 3300045051 Bacteria 5240
100 Ga0451576_0629869 3300045051 Bacteria 1127
101 Ga0451576_0723956 3300045051 Bacteria 1045
102 Ga0466967_0222559 3300045976 Archaea 1794
103 Ga0495672_0000913 3300047320 Bacteria 30912
104 Ga0501034_0217533 3300049571 Bacteria 1864
105 Ga0501067_0004804 3300049583 Bacteria 7493
106 Ga0501068_0225341 3300049584 Bacteria 1192
107 Ga0501069_0474969 3300049585 Bacteria 744
108 Ga0501077_0250490 3300049593 Bacteria 1126
109 nmdc:mga0a205_126512_c1 3300050515 Bacteria 1484
110 nmdc:mga0a205_460519_c1 3300050515 Bacteria 1131
111 Ga0451577_0261691
112 Ga0070683_100092907
113 Ga0070670_100564439
114 Ga0070680_100044027
115 Ga0070692_10070001
116 Ga0070673_100446311
117 Ga0070709_10150482
118 Ga0070708_100361899
119 Ga0070706_100195779
120 Ga0070699_100001119
121 Ga0070697_100294603
122 Ga0070672_100014622
123 Ga0070695_100478622
124 Ga0070693_100181141
125 Ga0070665_100039780
126 Ga0068855_101081876
127 Ga0068862_100598890
128 Ga0081540_1000083
129 Ga0070716_100133440
130 Ga0097621_100165059
131 Ga0075428_100031945
132 Ga0075431_100613719
133 Ga0114129_10388502
134 Ga0105243_10662596
135 Ga0157370_10194336
136 Ga0157378_10493163
137 Ga0157372_10319353
138 Ga0157379_11355185
139 Ga0157376_10125725
140 Ga0206356_10283487
141 Ga0206349_1653989
142 Ga0206352_10875233
143 Ga0206350_11618143
144 Ga0224712_10024102
145 Ga0224712_10032597
146 Ga0207681_10710911
147 Ga0207650_10840955
148 Ga0207706_10487390
149 Ga0207691_10010211
150 Ga0207661_10089676
151 Ga0207667_10391730
152 Ga0207651_10542752
153 Ga0207677_10482221
154 Ga0207708_10250700
155 Ga0207702_10544153
156 Ga0268266_10105104
157 Ga0265326_10020900
158 Ga0265323_10017808
159 Ga0265336_10038414
160 Ga0265338_10018362
161 Ga0265338_10132831
162 Ga0265324_10000140
163 Ga0265330_10002095
164 Ga0265330_10006017
165 Ga0265330_10036543
166 Ga0265320_10027429
167 Ga0265320_10117502
168 Ga0265329_10015181
169 Ga0265329_10048582
170 Ga0265340_10016700
171 Ga0265339_10000009
172 Ga0265339_10064425
173 Ga0265331_10020885
174 Ga0265316_10000325
175 Ga0265316_10027526
176 Ga0265316_10055614
177 Ga0265316_10119431
178 Ga0307513_10110697
179 Ga0265313_10004557
180 Ga0265314_10000030
181 Ga0265342_10000936
182 Ga0265342_10018847
183 Ga0265342_10099177
184 Ga0316577_10488577
185 Ga0373937_0733181
186 Ga0395899_0608366
187 Ga0395900_0775184
188 Ga0395905_0083330
189 Ga0400485_11239
190 Ga0400486_28205
191 Ga0400489_12366
192 Ga0400489_39430
193 Ga0436365_0694009
194 Ga0439458_0034108
195 Ga0439460_0073540
196 Ga0451577_0000033
197 Ga0451577_0003653
198 Ga0451577_0007916
199 Ga0451577_0121471
200 Ga0453684_0000034
201 Ga0453684_0000109
202 Ga0453684_0000140
203 Ga0453684_0000991
204 Ga0453684_0055294
205 Ga0453684_0079697
206 Ga0453684_0277355
207 Ga0453684_1123246
208 Ga0451576_0004180
209 Ga0451576_0036121
210 Ga0451576_0629869
211 Ga0451576_0723956
212 Ga0466967_0222559
213 Ga0495672_0000913
214 Ga0501034_0217533
215 Ga0501067_0004804
216 Ga0501068_0225341
217 Ga0501069_0474969
218 Ga0501077_0250490
219 nmdc:mga0a205_126512_c1
220 nmdc:mga0a205_460519_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03352

Adenine_glyco

Methyladenine glycosylase

12

188

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ai5-assembly3.cif.gz_C crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine 0.9726 8 184
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9725 7 184
4aia-assembly4.cif.gz_D the structural basis of 3-methyladenine recognition by 3- methyladenine dna glycosylase i (tag) from staphylococcus aureus 0.9693 8 184
4ai4-assembly1.cif.gz_A crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus 0.9568 8 184
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9465 7 184
ID Description Score Start End Superfamily
af_Q2FXR7_1_186_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.979 13 184 1.10.340.30
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9775 6 187 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9745 7 186 1.10.340.30
af_A0A1D6I4F4_25_202_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9485 12 185 1.10.340.30
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9468 6 187 1.10.340.30
ID Description Score Start End GO Terms
AF-G2H8S2-F1-model_v4 deleted 0.9985 6 188
AF-A0A7W1DPP4-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9981 6 186 GO:0006284
GO:0008725
GO:0046872
AF-A0A357VPW6-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9978 32 188 GO:0006284
GO:0008725
GO:0046872
AF-A0A4R2KPL8-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9977 6 188 GO:0006284
GO:0008725
GO:0046872
AF-A0A7T9GAR2-F1-model_v4 deleted 0.9976 6 188

Map