F027511

General Info

Members Datasets Scaffolds Average Seq Length
104 88 208 309

Family's Representative Sequence

Representative Sequence 3300035090|Ga0373949_0001317|Ga0373949_0001317_2294_3280
Length 328
Sequence VRLAHCSDLHLLSHDGARWLDLANKRWIGAMNLLSNRSRHYHVEAFDDMVSDLNATGVDHVLCTGDVTNLALRCEFEFARARFDRLALGPRGVTVIPGNHDAYVAEGVPLFAELFADYAASDPGWEWTAAALAPDETPSELRWPIVRVRGELALIGTSTSRATPWFTAYGRLGAGQLARLATALADPRLARKVRVVAIHHPPAGKRAESRIRGLRDHAAFAEVIARAGADLVVHGHEHRDMTEALPGPSGPVPVRGIASGTYFHNKPDRVARYRIYELDGGRVVSDTVRVWDRAGRAFVAERPSDCEPGAHPPAGLFRSRPTLAKPGT

Samples

Sample ID Description Type Environment
1 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
48 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
49 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
50 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
51 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
52 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
53 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
54 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
55 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
56 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
57 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
58 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
59 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
60 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
61 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
62 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
63 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
64 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
67 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
68 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
69 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
70 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
71 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
72 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
73 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
74 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
75 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
76 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
77 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
78 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
79 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
80 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
81 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
82 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
83 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
84 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
85 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
86 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
87 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
88 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.46
Nodule 0
Rhizoplane 1.92
Rhizosphere 75.96
Stem 0
Stem Tuber 0
Unclassified 18.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373949_0001317 3300035090 Bacteria 7158
2 rootL2_10128855 3300003322 Bacteria 2645
3 Ga0070658_10100747 3300005327 Bacteria 2388
4 Ga0068869_100289154 3300005334 Unclassified 1320
5 Ga0070689_100026769 3300005340 Bacteria 4343
6 Ga0070689_100040819 3300005340 Bacteria 3559
7 Ga0070692_10158196 3300005345 Bacteria 1296
8 Ga0070668_100200281 3300005347 Unclassified 1639
9 Ga0070674_100103273 3300005356 Bacteria 2080
10 Ga0070667_100193135 3300005367 Bacteria 1804
11 Ga0070708_100297391 3300005445 Bacteria 1520
12 Ga0070681_10216939 3300005458 Unclassified 1829
13 Ga0070685_10101354 3300005466 Bacteria 1759
14 Ga0070698_100100609 3300005471 Bacteria 2863
15 Ga0070679_100148411 3300005530 Bacteria 2322
16 Ga0070679_100282071 3300005530 Bacteria 1614
17 Ga0070665_100008513 3300005548 Bacteria 10376
18 Ga0068856_100052065 3300005614 Bacteria 4036
19 Ga0070702_100070436 3300005615 Bacteria 2064
20 Ga0070702_100128899 3300005615 Bacteria 1595
21 Ga0068852_100199193 3300005616 Bacteria 1894
22 Ga0068859_100277600 3300005617 Bacteria 1768
23 Ga0068859_100310348 3300005617 Unclassified 1671
24 Ga0068864_100395705 3300005618 Bacteria 1312
25 Ga0068861_100236446 3300005719 Bacteria 1552
26 Ga0070717_10005867 3300006028 Bacteria 8993
27 Ga0070717_10014062 3300006028 Bacteria 6152
28 Ga0075428_100423253 3300006844 Bacteria 1427
29 Ga0075429_100048363 3300006880 Bacteria 3698
30 Ga0075429_100091719 3300006880 Bacteria 2650
31 Ga0097620_100277620 3300006931 Bacteria 1768
32 Ga0097620_100310348 3300006931 Unclassified 1671
33 Ga0105245_10000015 3300009098 Bacteria 224549
34 Ga0114129_10354148 3300009147 Bacteria 1944
35 Ga0105242_10243992 3300009176 Bacteria 1616
36 Ga0105237_10401704 3300009545 Unclassified 1375
37 Ga0105238_10315518 3300009551 Unclassified 1549
38 Ga0105249_10073028 3300009553 Bacteria 3173
39 Ga0163163_10455425 3300014325 Unclassified 1340
40 Ga0157376_10155427 3300014969 Unclassified 2067
41 Ga0207671_10257013 3300025914 Unclassified 1374
42 Ga0207652_10523617 3300025921 Bacteria 1067
43 Ga0207686_10107247 3300025934 Bacteria 1877
44 Ga0207670_10033724 3300025936 Bacteria 3301
45 Ga0207669_10103535 3300025937 Unclassified 1888
46 Ga0207712_10173280 3300025961 Bacteria 1688
47 Ga0207668_10220441 3300025972 Unclassified 1523
48 Ga0207658_10191231 3300025986 Bacteria 1701
49 Ga0207708_10346037 3300026075 Bacteria 1218
50 Ga0207674_10071020 3300026116 Bacteria 3499
51 Ga0207698_10199403 3300026142 Bacteria 1791
52 Ga0268266_10004099 3300028379 Bacteria 14071
53 Ga0268264_10066150 3300028381 Bacteria 3047
54 Ga0307517_10021242 3300028786 Bacteria 8214
55 Ga0265332_10009194 3300031238 Bacteria 4420
56 Ga0307513_10002373 3300031456 Bacteria 26137
57 Ga0307509_10000010 3300031507 Bacteria 307427
58 Ga0307509_10013698 3300031507 Bacteria 9579
59 Ga0307509_10063474 3300031507 Bacteria 3889
60 Ga0307509_10141527 3300031507 Bacteria 2340
61 Ga0307406_10012836 3300031901 Bacteria 4785
62 Ga0373936_0000002 3300035113 Bacteria 452874
63 Ga0373941_0062246 3300035115 Bacteria 1217
64 Ga0373961_0000080 3300035241 Bacteria 51718
65 Ga0395899_0010851 3300037312 Bacteria 6983
66 Ga0395900_0028934 3300037418 Bacteria 5680
67 Ga0395905_0184265 3300037471 Bacteria 1960
68 Ga0395905_0381660 3300037471 Unclassified 1303
69 Ga0436365_0300875 3300039437 Bacteria 2754
70 Ga0436365_1286305 3300039437 Bacteria 3065
71 Ga0453684_0669935 3300044712 Bacteria 1130
72 Ga0495686_0095951 3300047472 Bacteria 1795
73 Ga0496112_0659381 3300048915 Bacteria 976
74 Ga0496115_0153193 3300048918 Unclassified 1904
75 Ga0501292_003085 3300049515 Unclassified 2200
76 Ga0501034_0264602 3300049571 Bacteria 1662
77 Ga0501047_0010782 3300049581 Bacteria 8640
78 Ga0501047_0241323 3300049581 Bacteria 1658
79 Ga0501069_0016478 3300049585 Bacteria 3971
80 Ga0501070_0028232 3300049586 Bacteria 4705
81 Ga0501070_0050195 3300049586 Bacteria 3463
82 Ga0501072_0121941 3300049588 Bacteria 2077
83 Ga0501227_000170 3300049665 Bacteria 12563
84 Ga0501233_003915 3300049668 Bacteria 2700
85 Ga0501221_005637 3300049704 Bacteria 2098
86 Ga0501083_0068665 3300049744 Bacteria 2358
87 Ga0501044_0033486 3300049823 Bacteria 5400
88 Ga0501044_0355740 3300049823 Bacteria 1383
89 nmdc:mga09592_85352_c1 3300050508 Bacteria 2693
90 nmdc:mga0rr50_499410_c1 3300050513 Bacteria 1034
91 Ga0500635_0087669 3300053080 Unclassified 1127
92 Ga0500566_0003501 3300053094 Bacteria 9362
93 Ga0500566_0024823 3300053094 Bacteria 3516
94 Ga0500640_000927 3300053095 Bacteria 8238
95 Ga0500554_000286 3300053102 Bacteria 10925
96 Ga0500595_000155 3300053119 Bacteria 45063
97 Ga0500597_000506 3300053120 Bacteria 8308
98 Ga0500614_000034 3300053123 Bacteria 30355
99 Ga0500559_0029426 3300053136 Bacteria 2352
100 Ga0500568_0005737 3300053139 Bacteria 6360
101 Ga0500585_076347 3300053144 Unclassified 1211
102 Ga0500603_005041 3300053150 Bacteria 2833
103 Ga0500637_0181778 3300053178 Unclassified 1205
104 Ga0500601_004024 3300053737 Unclassified 1596
105 Ga0373949_0001317
106 rootL2_10128855
107 Ga0070658_10100747
108 Ga0068869_100289154
109 Ga0070689_100026769
110 Ga0070689_100040819
111 Ga0070692_10158196
112 Ga0070668_100200281
113 Ga0070674_100103273
114 Ga0070667_100193135
115 Ga0070708_100297391
116 Ga0070681_10216939
117 Ga0070685_10101354
118 Ga0070698_100100609
119 Ga0070679_100148411
120 Ga0070679_100282071
121 Ga0070665_100008513
122 Ga0068856_100052065
123 Ga0070702_100070436
124 Ga0070702_100128899
125 Ga0068852_100199193
126 Ga0068859_100277600
127 Ga0068859_100310348
128 Ga0068864_100395705
129 Ga0068861_100236446
130 Ga0070717_10005867
131 Ga0070717_10014062
132 Ga0075428_100423253
133 Ga0075429_100048363
134 Ga0075429_100091719
135 Ga0097620_100277620
136 Ga0097620_100310348
137 Ga0105245_10000015
138 Ga0114129_10354148
139 Ga0105242_10243992
140 Ga0105237_10401704
141 Ga0105238_10315518
142 Ga0105249_10073028
143 Ga0163163_10455425
144 Ga0157376_10155427
145 Ga0207671_10257013
146 Ga0207652_10523617
147 Ga0207686_10107247
148 Ga0207670_10033724
149 Ga0207669_10103535
150 Ga0207712_10173280
151 Ga0207668_10220441
152 Ga0207658_10191231
153 Ga0207708_10346037
154 Ga0207674_10071020
155 Ga0207698_10199403
156 Ga0268266_10004099
157 Ga0268264_10066150
158 Ga0307517_10021242
159 Ga0265332_10009194
160 Ga0307513_10002373
161 Ga0307509_10000010
162 Ga0307509_10013698
163 Ga0307509_10063474
164 Ga0307509_10141527
165 Ga0307406_10012836
166 Ga0373936_0000002
167 Ga0373941_0062246
168 Ga0373961_0000080
169 Ga0395899_0010851
170 Ga0395900_0028934
171 Ga0395905_0184265
172 Ga0395905_0381660
173 Ga0436365_0300875
174 Ga0436365_1286305
175 Ga0453684_0669935
176 Ga0495686_0095951
177 Ga0496112_0659381
178 Ga0496115_0153193
179 Ga0501292_003085
180 Ga0501034_0264602
181 Ga0501047_0010782
182 Ga0501047_0241323
183 Ga0501069_0016478
184 Ga0501070_0028232
185 Ga0501070_0050195
186 Ga0501072_0121941
187 Ga0501227_000170
188 Ga0501233_003915
189 Ga0501221_005637
190 Ga0501083_0068665
191 Ga0501044_0033486
192 Ga0501044_0355740
193 nmdc:mga09592_85352_c1
194 nmdc:mga0rr50_499410_c1
195 Ga0500635_0087669
196 Ga0500566_0003501
197 Ga0500566_0024823
198 Ga0500640_000927
199 Ga0500554_000286
200 Ga0500595_000155
201 Ga0500597_000506
202 Ga0500614_000034
203 Ga0500559_0029426
204 Ga0500568_0005737
205 Ga0500585_076347
206 Ga0500603_005041
207 Ga0500637_0181778
208 Ga0500601_004024

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

1

240

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
3msw-assembly1.cif.gz_A crystal structure of a protein with unknown function (bf3112) from bacteroides fragilis nctc 9343 at 1.90 a resolution 0.8273 272 302
2hyo-assembly1.cif.gz_A-2 crystal structure of rv0805 n97a mutant 0.7977 2 302
2hyp-assembly1.cif.gz_A-2 crystal structure of rv0805 d66a mutant 0.7953 2 302
2hy1-assembly1.cif.gz_A-2 crystal structure of rv0805 0.7902 2 302
2hyo-assembly1.cif.gz_A-2 crystal structure of rv0805 n97a mutant 0.7779 2 302
ID Description Score Start End Superfamily
af_A0A0P0W3M2_22_316_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.8346 272 301 2.120.10.80
3d03A01 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;GpdQ, catalytic alpha/beta sandwich domain 0.8048 1 118 3.60.21.40
2hypA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7953 2 302 3.60.21.10
2hypA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7768 2 302 3.60.21.10
af_P40433_396_638_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.7728 272 303 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A7J5EY73-F1-model_v4 Metallophosphoesterase 0.9789 54 301 GO:0016787
AF-A0A7V9RGX2-F1-model_v4 Metallophosphoesterase 0.9686 1 303 GO:0016787
AF-A0A7V9RGX2-F1-model_v4 Metallophosphoesterase 0.9624 1 303 GO:0016787
AF-A0A3M2DW00-F1-model_v4 Metallophosphoesterase 0.9538 1 276 GO:0016787
AF-A0A3M2DW00-F1-model_v4 Metallophosphoesterase 0.9502 1 276 GO:0016787

Map