F017377

General Info

Members Datasets Scaffolds Average Seq Length
102 54 101 161

Family's Representative Sequence

Representative Sequence 3300049687|Ga0501258_003745|Ga0501258_003745_444_944
Length 166
Sequence MTAAFVKNLREVLARVRGALMRRGRNAQDADDLVQEAWVRLACYERDQPEQPVQRPEAFLMRTALNLSIDAHRAQTTRGEEVLVEDVVLIDIAPTAEATLLAKERLERLSVGVSRMSDTTRNIFLSHRIDGLTIVELARLHGLSTTTVHKHIAKATLQLTTWMEGW

Samples

Sample ID Description Type Environment
1 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
5 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
6 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
7 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
8 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
9 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
10 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
11 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
12 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
13 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
14 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
15 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
16 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
17 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
18 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
19 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
20 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
21 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
22 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
23 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
24 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
25 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
26 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
27 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
28 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
29 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
30 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
31 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
32 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
33 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
34 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
35 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
36 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
37 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
38 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
39 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
40 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
41 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
42 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
43 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
44 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
45 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
46 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
47 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
48 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
49 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
50 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
51 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
52 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
53 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
54 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0
Isolates 0.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.41
Nodule 0
Rhizoplane 3.92
Rhizosphere 34.31
Stem 0
Stem Tuber 0
Unclassified 32.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10134696 3300003322 Bacteria 7838
2 rootH1_10009676 3300003323 Bacteria 12316
3 rootH1_10114486 3300003323 Bacteria 2307
4 Ga0075369_10010536 3300006186 Plasmid 3617
5 Ga0075366_10002664 3300006195 Bacteria 9203
6 Ga0075366_10061032 3300006195 Unclassified 2240
7 Ga0075366_10070133 3300006195 Bacteria 2087
8 Ga0075366_10332962 3300006195 Unclassified 931
9 Ga0075370_10002989 3300006353 Bacteria 7954
10 Ga0075370_10050917 3300006353 Bacteria 2349
11 Ga0105238_10531704 3300009551 Bacteria 1179
12 Ga0213872_10000025 3300021361 Bacteria 151688
13 Ga0213872_10001908 3300021361 Bacteria 12782
14 Ga0213872_10102391 3300021361 Bacteria 1276
15 Ga0213872_10125122 3300021361 Unclassified 1135
16 Ga0213872_10334085 3300021361 Unclassified 624
17 Ga0209257_1020417 3300025304 Bacteria 2449
18 Ga0307517_10056189 3300028786 Bacteria 3846
19 Ga0307517_10122329 3300028786 Bacteria 1917
20 Ga0307517_10233366 3300028786 Bacteria 1101
21 Ga0307515_10000014 3300028794 Bacteria 562358
22 Ga0307515_10027057 3300028794 Bacteria 9830
23 Ga0307515_10032466 3300028794 Bacteria 8649
24 Ga0307515_10156420 3300028794 Unclassified 2349
25 Ga0307512_10008838 3300030522 Bacteria 9771
26 Ga0307512_10178623 3300030522 Unclassified 1198
27 Ga0307512_10394847 3300030522 Unclassified 584
28 Ga0307513_10112539 3300031456 Bacteria 2712
29 Ga0307513_10154122 3300031456 Bacteria 2200
30 Ga0307513_10325401 3300031456 Bacteria 1294
31 Ga0307513_10462671 3300031456 Unclassified 991
32 Ga0307509_10000409 3300031507 Bacteria 72273
33 Ga0307509_10002316 3300031507 Bacteria 31047
34 Ga0307509_10043136 3300031507 Bacteria 4883
35 Ga0307508_10000947 3300031616 Bacteria 33788
36 Ga0307508_10154296 3300031616 Unclassified 1900
37 Ga0307514_10235244 3300031649 Bacteria 1105
38 Ga0307516_10011997 3300031730 Bacteria 9368
39 Ga0307516_10021325 3300031730 Bacteria 6671
40 Ga0307414_10016197 3300032004 Bacteria 4525
41 Ga0307411_10004448 3300032005 Bacteria 6718
42 Ga0307510_10002123 3300033180 Bacteria 22411
43 Ga0307510_10005206 3300033180 Bacteria 15461
44 Ga0307510_10033771 3300033180 Bacteria 5741
45 Ga0307510_10251242 3300033180 Unclassified 1256
46 Ga0307510_10399250 3300033180 Unclassified 818
47 Ga0395905_0000063 3300037471 Bacteria 187830
48 Ga0436361_0023827 3300039447 Bacteria 9576
49 Ga0436361_0322838 3300039447 Bacteria 9706
50 Ga0436361_0379483 3300039447 Bacteria 6704
51 Ga0436361_0488098 3300039447 Bacteria 708
52 Ga0436361_0573930 3300039447 Bacteria 1018
53 Ga0436361_0912220 3300039447 Unclassified 625
54 Ga0436361_0916410 3300039447 Bacteria 83869
55 Ga0436361_1211494 3300039447 Bacteria 21168
56 Ga0451807_1958102 3300041486 Unclassified 532
57 Ga0450890_012026 3300042127 Bacteria 1121
58 Ga0453684_1716323 3300044712 Bacteria 641
59 Ga0451576_0604738 3300045051 Bacteria 1152
60 Ga0451576_1198420 3300045051 Bacteria 793
61 Ga0495606_0173232 3300046507 Bacteria 1250
62 Ga0495610_0082728 3300046512 Bacteria 1471
63 Ga0495632_0002835 3300046519 Bacteria 12810
64 Ga0495632_0227494 3300046519 Unclassified 842
65 Ga0495625_0002522 3300046660 Bacteria 19702
66 Ga0495649_0000877 3300046694 Bacteria 24130
67 Ga0495589_0054086 3300046794 Bacteria 1980
68 Ga0495687_017319 3300047443 Plasmid 3598
69 Ga0496102_0002731 3300048905 Bacteria 15043
70 Ga0496102_0004498 3300048905 Bacteria 11772
71 Ga0496106_0136597 3300048909 Bacteria 1926
72 Ga0496122_0494931 3300048925 Unclassified 595
73 Ga0496126_0427299 3300048929 Bacteria 1070
74 Ga0501223_022259 3300049663 Bacteria 1239
75 Ga0501227_009996 3300049665 Bacteria 2052
76 Ga0501253_108111 3300049683 Unclassified 660
77 Ga0501258_003745 3300049687 Bacteria 1409
78 Ga0501262_041285 3300049759 Bacteria 690
79 Ga0501267_007888 3300049764 Bacteria 1043
80 nmdc:mga0k408_132064_c1 3300050493 Bacteria 1482
81 nmdc:mga0k408_1516_c1 3300050493 Bacteria 12559
82 nmdc:mga0k408_224283_c1 3300050493 Unclassified 1122
83 nmdc:mga0k408_368676_c1 3300050493 Unclassified 856
84 nmdc:mga0k408_42819_c1 3300050493 Unclassified 2159
85 nmdc:mga0k408_72783_c1 3300050493 Bacteria 2007
86 nmdc:mga0k408_79118_c1 3300050493 Unclassified 1924
87 nmdc:mga07m45_107187_c1 3300050496 Unclassified 1607
88 nmdc:mga07m45_28611_c1 3300050496 Plasmid 3076
89 nmdc:mga07m45_446_c1 3300050496 Bacteria 17240
90 nmdc:mga07m45_92828_c1 3300050496 Bacteria 1730
91 nmdc:mga0sz30_12688_c1 3300050516 Plasmid 3282
92 Ga0500635_0036865 3300053080 Bacteria 1614
93 Ga0500594_0128462 3300053118 Unclassified 801
94 Ga0500652_085889 3300053131 Bacteria 1312
95 Ga0500652_314218 3300053131 Unclassified 602
96 Ga0500658_0018686 3300053134 Bacteria 2602
97 Ga0500577_0168078 3300053142 Unclassified 937
98 Ga0500616_0172905 3300053153 Unclassified 979
99 Ga0500616_0299812 3300053153 Unclassified 668
100 Ga0500570_120435 3300053724 Unclassified 1032
101 Ga0500587_013640 3300053739 Unclassified 1027

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028794 Ga0307515_10027057 Ga0307515_100270579 151
2 3300050493 nmdc:mga0k408_72783_c1 nmdc:mga0k408_72783_c1_158_613 151
3 iso_pu_bacteria 2643221639 2644219215 153
4 3300003322 rootL2_10134696 rootL2_101346963 157
5 3300003323 rootH1_10009676 rootH1_1000967610 157
6 3300003323 rootH1_10114486 rootH1_101144863 157
7 3300006186 Ga0075369_10010536 Ga0075369_100105363 157
8 3300006195 Ga0075366_10002664 Ga0075366_100026647 157
9 3300006195 Ga0075366_10061032 Ga0075366_100610324 157
10 3300006195 Ga0075366_10070133 Ga0075366_100701332 157
11 3300006195 Ga0075366_10332962 Ga0075366_103329622 157
12 3300006353 Ga0075370_10002989 Ga0075370_100029899 157
13 3300006353 Ga0075370_10050917 Ga0075370_100509172 157
14 3300009551 Ga0105238_10531704 Ga0105238_105317042 157
15 3300021361 Ga0213872_10000025 Ga0213872_1000002518 157
16 3300021361 Ga0213872_10001908 Ga0213872_100019085 157
17 3300021361 Ga0213872_10102391 Ga0213872_101023911 157
18 3300021361 Ga0213872_10125122 Ga0213872_101251222 157
19 3300021361 Ga0213872_10334085 Ga0213872_103340851 157
20 3300025304 Ga0209257_1020417 Ga0209257_10204173 157
21 3300028786 Ga0307517_10056189 Ga0307517_100561893 157
22 3300028786 Ga0307517_10122329 Ga0307517_101223291 157
23 3300028786 Ga0307517_10233366 Ga0307517_102333662 157
24 3300028794 Ga0307515_10000014 Ga0307515_10000014153 157
25 3300028794 Ga0307515_10032466 Ga0307515_100324662 157
26 3300028794 Ga0307515_10156420 Ga0307515_101564202 157
27 3300030522 Ga0307512_10008838 Ga0307512_100088385 157
28 3300030522 Ga0307512_10178623 Ga0307512_101786232 157
29 3300030522 Ga0307512_10394847 Ga0307512_103948471 157
30 3300031456 Ga0307513_10112539 Ga0307513_101125392 157
31 3300031456 Ga0307513_10154122 Ga0307513_101541222 157
32 3300031456 Ga0307513_10325401 Ga0307513_103254012 157
33 3300031456 Ga0307513_10462671 Ga0307513_104626712 157
34 3300031507 Ga0307509_10000409 Ga0307509_1000040962 157
35 3300031507 Ga0307509_10002316 Ga0307509_1000231619 157
36 3300031507 Ga0307509_10043136 Ga0307509_100431367 157
37 3300031616 Ga0307508_10000947 Ga0307508_1000094729 157
38 3300031616 Ga0307508_10154296 Ga0307508_101542961 157
39 3300031649 Ga0307514_10235244 Ga0307514_102352442 157
40 3300031730 Ga0307516_10011997 Ga0307516_100119976 157
41 3300031730 Ga0307516_10021325 Ga0307516_100213257 157
42 3300032004 Ga0307414_10016197 Ga0307414_100161972 157
43 3300032005 Ga0307411_10004448 Ga0307411_100044482 157
44 3300033180 Ga0307510_10002123 Ga0307510_100021231 157
45 3300033180 Ga0307510_10005206 Ga0307510_1000520616 157
46 3300033180 Ga0307510_10033771 Ga0307510_100337714 157
47 3300033180 Ga0307510_10251242 Ga0307510_102512422 157
48 3300033180 Ga0307510_10399250 Ga0307510_103992501 157
49 3300037471 Ga0395905_0000063 Ga0395905_0000063_125514_125999 157
50 3300039447 Ga0436361_0023827 Ga0436361_0023827_175_654 157
51 3300039447 Ga0436361_0322838 Ga0436361_0322838_4322_4861 157
52 3300039447 Ga0436361_0379483 Ga0436361_0379483_203_694 157
53 3300039447 Ga0436361_0488098 Ga0436361_0488098_111_590 157
54 3300039447 Ga0436361_0573930 Ga0436361_0573930_385_876 157
55 3300039447 Ga0436361_0912220 Ga0436361_0912220_71_547 157
56 3300039447 Ga0436361_0916410 Ga0436361_0916410_66198_66689 157
57 3300039447 Ga0436361_1211494 Ga0436361_1211494_15368_15859 157
58 3300041486 Ga0451807_1958102 Ga0451807_1958102_27_518 157
59 3300042127 Ga0450890_012026 Ga0450890_012026_351_836 157
60 3300044712 Ga0453684_1716323 Ga0453684_1716323_34_525 157
61 3300045051 Ga0451576_0604738 Ga0451576_0604738_231_722 157
62 3300045051 Ga0451576_1198420 Ga0451576_1198420_283_774 157
63 3300046507 Ga0495606_0173232 Ga0495606_0173232_513_998 157
64 3300046512 Ga0495610_0082728 Ga0495610_0082728_746_1225 157
65 3300046519 Ga0495632_0002835 Ga0495632_0002835_8634_9113 157
66 3300046519 Ga0495632_0227494 Ga0495632_0227494_210_689 157
67 3300046660 Ga0495625_0002522 Ga0495625_0002522_11007_11498 157
68 3300046694 Ga0495649_0000877 Ga0495649_0000877_10207_10692 157
69 3300046794 Ga0495589_0054086 Ga0495589_0054086_1088_1573 157
70 3300047443 Ga0495687_017319 Ga0495687_017319_1139_1618 157
71 3300048905 Ga0496102_0002731 Ga0496102_0002731_3559_4038 157
72 3300048905 Ga0496102_0004498 Ga0496102_0004498_4737_5216 157
73 3300048909 Ga0496106_0136597 Ga0496106_0136597_20_499 157
74 3300048925 Ga0496122_0494931 Ga0496122_0494931_84_563 157
75 3300048929 Ga0496126_0427299 Ga0496126_0427299_73_546 157
76 3300049663 Ga0501223_022259 Ga0501223_022259_61_552 157
77 3300049665 Ga0501227_009996 Ga0501227_009996_1325_1816 157
78 3300049683 Ga0501253_108111 Ga0501253_108111_41_532 157
79 3300049687 Ga0501258_003745 Ga0501258_003745_444_944 157
80 3300049759 Ga0501262_041285 Ga0501262_041285_78_608 157
81 3300049764 Ga0501267_007888 Ga0501267_007888_26_526 157
82 3300050493 nmdc:mga0k408_132064_c1 nmdc:mga0k408_132064_c1_362_853 157
83 3300050493 nmdc:mga0k408_1516_c1 nmdc:mga0k408_1516_c1_4514_4993 157
84 3300050493 nmdc:mga0k408_224283_c1 nmdc:mga0k408_224283_c1_251_733 157
85 3300050493 nmdc:mga0k408_368676_c1 nmdc:mga0k408_368676_c1_285_764 157
86 3300050493 nmdc:mga0k408_42819_c1 nmdc:mga0k408_42819_c1_1312_1803 157
87 3300050493 nmdc:mga0k408_79118_c1 nmdc:mga0k408_79118_c1_412_891 157
88 3300050496 nmdc:mga07m45_107187_c1 nmdc:mga07m45_107187_c1_229_708 157
89 3300050496 nmdc:mga07m45_28611_c1 nmdc:mga07m45_28611_c1_1539_2018 157
90 3300050496 nmdc:mga07m45_446_c1 nmdc:mga07m45_446_c1_1851_2330 157
91 3300050496 nmdc:mga07m45_92828_c1 nmdc:mga07m45_92828_c1_1127_1618 157
92 3300050516 nmdc:mga0sz30_12688_c1 nmdc:mga0sz30_12688_c1_1689_2168 157
93 3300053080 Ga0500635_0036865 Ga0500635_0036865_458_943 157
94 3300053118 Ga0500594_0128462 Ga0500594_0128462_68_547 157
95 3300053131 Ga0500652_085889 Ga0500652_085889_789_1268 157
96 3300053131 Ga0500652_314218 Ga0500652_314218_49_534 157
97 3300053134 Ga0500658_0018686 Ga0500658_0018686_52_531 157
98 3300053142 Ga0500577_0168078 Ga0500577_0168078_203_694 157
99 3300053153 Ga0500616_0172905 Ga0500616_0172905_193_672 157
100 3300053153 Ga0500616_0299812 Ga0500616_0299812_63_542 157
101 3300053724 Ga0500570_120435 Ga0500570_120435_226_705 157
102 3300053739 Ga0500587_013640 Ga0500587_013640_384_863 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08281

Sigma70_r4_2

Sigma-70, region 4

106

159

0.91

PF04542

Sigma70_r2

Sigma-70 region 2

9

78

0.89

Feature Viewer

pLDDT pTM Quality
88.43 0.45 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map