F495369

General Info

Members Datasets Scaffolds Average Seq Length
1694 426 1694 101

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_11502967|Ga0105243_115029672
Length 117
Sequence MMGPEVTWYLIVASILFTIGALGVLVRRSPLIILLSLEIMLNGANLALIAFARHQGDADGQIFALTVMAVAASEVVVGLGLIVAMSRRRLPLDVDRMTTLRGRRPWPSAAGSACSLR

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
115 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
116 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
117 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
118 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
119 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
120 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
141 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
142 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
143 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
211 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
212 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
213 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
214 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
215 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
216 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
217 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
218 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
219 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
220 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
221 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
222 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
223 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
224 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
225 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
226 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
227 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
228 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
229 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
230 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
231 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
232 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
233 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
234 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
235 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
236 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
237 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
238 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
239 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
240 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
241 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
242 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
243 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
244 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
245 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
246 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
247 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
248 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
249 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
250 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
251 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
252 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
253 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
254 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
255 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
257 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
258 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
259 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
260 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
261 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
262 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
263 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
264 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
265 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
266 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
267 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
268 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
269 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
270 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
271 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
272 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
273 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
274 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
275 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
276 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
277 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
278 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
279 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
280 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
281 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
282 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
283 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
284 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
285 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
286 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
287 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
288 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
289 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
290 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
291 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
292 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
293 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
294 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
295 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
296 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
297 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
298 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
299 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
300 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
301 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
302 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
303 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
304 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
305 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
306 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
307 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
308 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
309 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
310 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
311 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
312 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
313 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
314 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
315 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
316 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
317 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
318 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
319 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
320 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
321 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
322 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
323 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
324 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
325 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
326 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
327 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
328 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
329 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
330 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
331 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
332 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
333 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
334 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
335 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
336 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
337 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
338 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
339 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
340 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
341 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
342 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
343 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
344 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
345 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
346 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
347 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
348 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
349 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
350 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
351 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
352 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
353 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
354 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
355 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
356 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
357 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
358 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
359 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
360 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
361 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
362 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
363 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
364 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
365 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
366 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
367 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
368 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
369 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
370 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
386 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
387 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
388 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
389 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
390 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
391 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
392 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
393 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
394 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
395 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
396 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
397 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
398 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
399 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
400 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
403 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
404 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
405 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
406 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
407 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
408 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
409 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
410 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
411 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
412 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
413 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
414 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
415 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
416 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
417 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
418 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
419 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
420 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
421 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
422 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
423 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
425 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
426 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.13
Nodule 0
Rhizoplane 12.28
Rhizosphere 84.3
Stem 0
Stem Tuber 0
Unclassified 1.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10012986 3300002077 Bacteria 1682
2 JGI25406J46586_10240879 3300003203 Bacteria 531
3 JGI25407J50210_10003996 3300003373 Bacteria 3573
4 JGI25407J50210_10020636 3300003373 Bacteria 1713
5 JGI25407J50210_10109576 3300003373 Bacteria 681
6 Ga0070658_10009094 3300005327 Bacteria 7989
7 Ga0070658_10239181 3300005327 Bacteria 1538
8 Ga0070658_11996711 3300005327 Bacteria 501
9 Ga0070676_11146248 3300005328 Bacteria 589
10 Ga0070683_100001123 3300005329 Bacteria 20219
11 Ga0070683_100004023 3300005329 Bacteria 12033
12 Ga0070683_100034459 3300005329 Bacteria 4625
13 Ga0070683_100062160 3300005329 Bacteria 3472
14 Ga0070683_100067109 3300005329 Bacteria 3341
15 Ga0070683_100280663 3300005329 Bacteria 1584
16 Ga0070683_100355630 3300005329 Bacteria 1395
17 Ga0070683_100589516 3300005329 Unclassified 1064
18 Ga0070683_100730677 3300005329 Bacteria 948
19 Ga0070683_101012100 3300005329 Bacteria 798
20 Ga0070683_101716411 3300005329 Bacteria 604
21 Ga0070690_100827125 3300005330 Bacteria 720
22 Ga0070670_101899389 3300005331 Unclassified 548
23 Ga0068869_101009118 3300005334 Bacteria 725
24 Ga0070666_10333780 3300005335 Bacteria 1083
25 Ga0070680_100018539 3300005336 Bacteria 5501
26 Ga0070680_100021389 3300005336 Bacteria 5141
27 Ga0070680_100024599 3300005336 Bacteria 4812
28 Ga0070680_100311515 3300005336 Bacteria 1336
29 Ga0070682_100001630 3300005337 Bacteria 12469
30 Ga0070682_100052036 3300005337 Bacteria 2562
31 Ga0070682_100091678 3300005337 Bacteria 1989
32 Ga0070682_100147296 3300005337 Bacteria 1612
33 Ga0070682_100286129 3300005337 Bacteria 1204
34 Ga0068868_100053023 3300005338 Bacteria 3194
35 Ga0068868_100757353 3300005338 Bacteria 873
36 Ga0068868_101973475 3300005338 Bacteria 554
37 Ga0070660_100003199 3300005339 Bacteria 11258
38 Ga0070660_100005098 3300005339 Bacteria 9076
39 Ga0070660_100008711 3300005339 Bacteria 7102
40 Ga0070660_100079462 3300005339 Bacteria 2573
41 Ga0070660_100618145 3300005339 Bacteria 906
42 Ga0070660_100651525 3300005339 Bacteria 882
43 Ga0070689_100028033 3300005340 Bacteria 4253
44 Ga0070691_10211013 3300005341 Bacteria 1024
45 Ga0070691_10323587 3300005341 Bacteria 849
46 Ga0070691_10352361 3300005341 Bacteria 818
47 Ga0070691_10461164 3300005341 Unclassified 727
48 Ga0070691_10488012 3300005341 Bacteria 710
49 Ga0070687_100211876 3300005343 Bacteria 1181
50 Ga0070687_100318406 3300005343 Bacteria 993
51 Ga0070687_100634872 3300005343 Unclassified 738
52 Ga0070661_100046429 3300005344 Bacteria 3177
53 Ga0070661_100282549 3300005344 Bacteria 1288
54 Ga0070661_100307664 3300005344 Bacteria 1235
55 Ga0070661_100415510 3300005344 Bacteria 1066
56 Ga0070692_10002322 3300005345 Bacteria 7333
57 Ga0070692_11382849 3300005345 Bacteria 508
58 Ga0070668_101300407 3300005347 Unclassified 661
59 Ga0070675_100074000 3300005354 Bacteria 2829
60 Ga0070675_100329239 3300005354 Bacteria 1351
61 Ga0070671_100765365 3300005355 Bacteria 840
62 Ga0070671_100955729 3300005355 Bacteria 750
63 Ga0070674_100008484 3300005356 Bacteria 6120
64 Ga0070674_100010597 3300005356 Bacteria 5579
65 Ga0070674_100089321 3300005356 Bacteria 2220
66 Ga0070674_100856364 3300005356 Bacteria 789
67 Ga0070673_100306823 3300005364 Bacteria 1399
68 Ga0070659_100001554 3300005366 Bacteria 16549
69 Ga0070659_100223056 3300005366 Bacteria 1556
70 Ga0070659_100272729 3300005366 Bacteria 1406
71 Ga0070667_100083412 3300005367 Bacteria 2738
72 Ga0070667_101486210 3300005367 Bacteria 636
73 Ga0070667_102155342 3300005367 Bacteria 525
74 Ga0070703_10119468 3300005406 Bacteria 954
75 Ga0070703_10300918 3300005406 Bacteria 669
76 Ga0070709_10418516 3300005434 Bacteria 1004
77 Ga0070714_100224091 3300005435 Bacteria 1729
78 Ga0070714_100499909 3300005435 Bacteria 1159
79 Ga0070714_100532839 3300005435 Bacteria 1123
80 Ga0070714_101026149 3300005435 Bacteria 803
81 Ga0070713_100704677 3300005436 Bacteria 964
82 Ga0070713_100955176 3300005436 Bacteria 826
83 Ga0070713_100969256 3300005436 Bacteria 820
84 Ga0070710_10738938 3300005437 Bacteria 698
85 Ga0070701_10109397 3300005438 Bacteria 1542
86 Ga0070701_10110334 3300005438 Bacteria 1536
87 Ga0070701_10944963 3300005438 Bacteria 598
88 Ga0070711_100511211 3300005439 Bacteria 992
89 Ga0070711_100851347 3300005439 Bacteria 776
90 Ga0070711_100908937 3300005439 Bacteria 752
91 Ga0070711_101331340 3300005439 Bacteria 624
92 Ga0070705_100211179 3300005440 Bacteria 1338
93 Ga0070705_100392813 3300005440 Bacteria 1025
94 Ga0070705_100753766 3300005440 Bacteria 770
95 Ga0070700_100005091 3300005441 Bacteria 6935
96 Ga0070700_100020662 3300005441 Bacteria 3819
97 Ga0070700_101530976 3300005441 Bacteria 568
98 Ga0070694_100696481 3300005444 Bacteria 826
99 Ga0070708_100061357 3300005445 Bacteria 3359
100 Ga0070708_100235216 3300005445 Bacteria 1719
101 Ga0070708_101470847 3300005445 Bacteria 635
102 Ga0070663_100021275 3300005455 Bacteria 4312
103 Ga0070663_100437344 3300005455 Bacteria 1076
104 Ga0070678_100000052 3300005456 Bacteria 40622
105 Ga0070678_100347097 3300005456 Bacteria 1275
106 Ga0070678_100412423 3300005456 Bacteria 1176
107 Ga0070678_100535698 3300005456 Bacteria 1038
108 Ga0070678_100656989 3300005456 Bacteria 941
109 Ga0070678_101361204 3300005456 Bacteria 662
110 Ga0070662_100006746 3300005457 Bacteria 7423
111 Ga0070681_10001855 3300005458 Bacteria 19089
112 Ga0070681_10008368 3300005458 Bacteria 10134
113 Ga0070681_10028294 3300005458 Bacteria 5634
114 Ga0070681_10312547 3300005458 Bacteria 1481
115 Ga0070681_10315939 3300005458 Bacteria 1472
116 Ga0070681_11003181 3300005458 Bacteria 755
117 Ga0070681_11540456 3300005458 Bacteria 590
118 Ga0068867_100094284 3300005459 Bacteria 2276
119 Ga0068867_100694923 3300005459 Bacteria 897
120 Ga0068867_101765543 3300005459 Unclassified 581
121 Ga0070685_10041321 3300005466 Bacteria 2627
122 Ga0070706_100003217 3300005467 Bacteria 16130
123 Ga0070706_101537085 3300005467 Bacteria 608
124 Ga0070707_100001362 3300005468 Bacteria 23998
125 Ga0070707_100781199 3300005468 Unclassified 919
126 Ga0070707_101718555 3300005468 Bacteria 595
127 Ga0070698_100224931 3300005471 Bacteria 1810
128 Ga0070698_100638457 3300005471 Bacteria 1006
129 Ga0070698_101930119 3300005471 Unclassified 543
130 Ga0070699_100029009 3300005518 Bacteria 4770
131 Ga0070699_100277486 3300005518 Bacteria 1501
132 Ga0070699_100683765 3300005518 Bacteria 937
133 Ga0070679_100006177 3300005530 Bacteria 11148
134 Ga0070679_100025932 3300005530 Bacteria 5751
135 Ga0070679_100113608 3300005530 Bacteria 2693
136 Ga0070679_100118938 3300005530 Bacteria 2627
137 Ga0070679_100234873 3300005530 Bacteria 1792
138 Ga0070679_100284838 3300005530 Bacteria 1604
139 Ga0070679_100974573 3300005530 Unclassified 792
140 Ga0070679_101501296 3300005530 Unclassified 621
141 Ga0070684_100000234 3300005535 Bacteria 38474
142 Ga0070684_100003158 3300005535 Bacteria 12307
143 Ga0070684_100043403 3300005535 Bacteria 3882
144 Ga0070684_100062867 3300005535 Bacteria 3253
145 Ga0070684_100108132 3300005535 Bacteria 2492
146 Ga0070684_100154937 3300005535 Bacteria 2077
147 Ga0070684_100205471 3300005535 Bacteria 1795
148 Ga0070684_100417282 3300005535 Bacteria 1238
149 Ga0070684_100772131 3300005535 Unclassified 898
150 Ga0070684_101245053 3300005535 Bacteria 700
151 Ga0070684_102050607 3300005535 Unclassified 540
152 Ga0070697_100197924 3300005536 Bacteria 1707
153 Ga0070697_100752641 3300005536 Bacteria 861
154 Ga0070697_100788371 3300005536 Bacteria 841
155 Ga0070697_101093138 3300005536 Bacteria 710
156 Ga0068853_100091196 3300005539 Bacteria 2680
157 Ga0068853_100291773 3300005539 Bacteria 1506
158 Ga0068853_100361686 3300005539 Bacteria 1352
159 Ga0068853_101888694 3300005539 Bacteria 579
160 Ga0070672_100019540 3300005543 Bacteria 4919
161 Ga0070672_100549313 3300005543 Bacteria 1003
162 Ga0070672_100554554 3300005543 Bacteria 998
163 Ga0070672_100644360 3300005543 Bacteria 925
164 Ga0070672_100680390 3300005543 Bacteria 900
165 Ga0070672_100874892 3300005543 Bacteria 793
166 Ga0070686_100001674 3300005544 Bacteria 12387
167 Ga0070686_100014826 3300005544 Bacteria 4499
168 Ga0070695_101236595 3300005545 Unclassified 615
169 Ga0070695_101499534 3300005545 Bacteria 561
170 Ga0070696_100110976 3300005546 Bacteria 1975
171 Ga0070696_100291027 3300005546 Bacteria 1248
172 Ga0070696_100537387 3300005546 Unclassified 935
173 Ga0070696_100808673 3300005546 Bacteria 772
174 Ga0070696_100839321 3300005546 Bacteria 759
175 Ga0070696_101662701 3300005546 Bacteria 550
176 Ga0070693_100025410 3300005547 Bacteria 3187
177 Ga0070693_100431365 3300005547 Bacteria 921
178 Ga0070693_100445105 3300005547 Bacteria 908
179 Ga0070665_100065988 3300005548 Bacteria 3630
180 Ga0070665_100143055 3300005548 Bacteria 2395
181 Ga0070665_100392291 3300005548 Bacteria 1396
182 Ga0070704_100106392 3300005549 Bacteria 2126
183 Ga0070704_100456275 3300005549 Unclassified 1101
184 Ga0070704_100457132 3300005549 Unclassified 1101
185 Ga0070704_102285321 3300005549 Bacteria 503
186 Ga0068855_100006224 3300005563 Bacteria 14542
187 Ga0068855_100018402 3300005563 Bacteria 8394
188 Ga0068855_100224479 3300005563 Bacteria 2105
189 Ga0068855_100695267 3300005563 Bacteria 1089
190 Ga0068855_100942815 3300005563 Unclassified 910
191 Ga0068855_101502034 3300005563 Unclassified 692
192 Ga0070664_100019861 3300005564 Bacteria 5529
193 Ga0070664_100372160 3300005564 Bacteria 1303
194 Ga0070664_100524529 3300005564 Bacteria 1094
195 Ga0070664_100722486 3300005564 Unclassified 929
196 Ga0068857_100006298 3300005577 Bacteria 10156
197 Ga0068857_100060416 3300005577 Bacteria 3366
198 Ga0068857_100135663 3300005577 Bacteria 2222
199 Ga0068857_100538374 3300005577 Bacteria 1099
200 Ga0068857_101149901 3300005577 Unclassified 750
201 Ga0068857_102427685 3300005577 Bacteria 515
202 Ga0068854_100214575 3300005578 Bacteria 1520
203 Ga0068856_100107787 3300005614 Bacteria 2781
204 Ga0068856_100151809 3300005614 Bacteria 2325
205 Ga0068856_100153092 3300005614 Bacteria 2315
206 Ga0068856_100345847 3300005614 Bacteria 1506
207 Ga0068856_101599419 3300005614 Bacteria 665
208 Ga0070702_100005952 3300005615 Bacteria 5734
209 Ga0070702_100091055 3300005615 Bacteria 1850
210 Ga0070702_100150150 3300005615 Bacteria 1495
211 Ga0070702_100352716 3300005615 Bacteria 1037
212 Ga0070702_100994014 3300005615 Bacteria 664
213 Ga0070702_101053063 3300005615 Bacteria 647
214 Ga0068852_100027363 3300005616 Bacteria 4647
215 Ga0068852_100517944 3300005616 Unclassified 1190
216 Ga0068852_100875428 3300005616 Bacteria 915
217 Ga0068859_100118937 3300005617 Bacteria 2708
218 Ga0068859_100744780 3300005617 Bacteria 1069
219 Ga0068859_102164307 3300005617 Bacteria 614
220 Ga0068864_100356093 3300005618 Unclassified 1382
221 Ga0068864_100874320 3300005618 Bacteria 887
222 Ga0068864_101226657 3300005618 Unclassified 749
223 Ga0068866_10192921 3300005718 Bacteria 1211
224 Ga0068861_100145187 3300005719 Bacteria 1941
225 Ga0068851_10054376 3300005834 Bacteria 2039
226 Ga0068851_10807788 3300005834 Unclassified 583
227 Ga0068870_10280026 3300005840 Bacteria 1045
228 Ga0068870_10577571 3300005840 Bacteria 761
229 Ga0068863_101525123 3300005841 Bacteria 677
230 Ga0068863_101777743 3300005841 Unclassified 626
231 Ga0068863_102517094 3300005841 Bacteria 524
232 Ga0068858_100088628 3300005842 Bacteria 2879
233 Ga0068858_100352375 3300005842 Bacteria 1410
234 Ga0068858_100750272 3300005842 Bacteria 951
235 Ga0068858_101545095 3300005842 Bacteria 655
236 Ga0068860_100061414 3300005843 Bacteria 3571
237 Ga0068860_100542250 3300005843 Bacteria 1165
238 Ga0068862_100081916 3300005844 Bacteria 2800
239 Ga0068862_102057354 3300005844 Unclassified 582
240 Ga0081455_10007161 3300005937 Bacteria 11796
241 Ga0081455_10010378 3300005937 Bacteria 9462
242 Ga0081455_10011940 3300005937 Bacteria 8693
243 Ga0081455_10021800 3300005937 Bacteria 6000
244 Ga0081455_10022266 3300005937 Bacteria 5926
245 Ga0081455_10130858 3300005937 Bacteria 1962
246 Ga0081455_10505796 3300005937 Bacteria 810
247 Ga0081455_10798679 3300005937 Bacteria 593
248 Ga0081455_10907186 3300005937 Bacteria 548
249 Ga0081538_10000094 3300005981 Bacteria 86715
250 Ga0081538_10000407 3300005981 Bacteria 48780
251 Ga0081538_10003829 3300005981 Bacteria 14051
252 Ga0081538_10004943 3300005981 Bacteria 12143
253 Ga0081538_10009890 3300005981 Bacteria 7885
254 Ga0081538_10028915 3300005981 Bacteria 3799
255 Ga0081538_10049856 3300005981 Bacteria 2535
256 Ga0081539_10000867 3300005985 Bacteria 57938
257 Ga0081539_10001480 3300005985 Bacteria 39812
258 Ga0081539_10025681 3300005985 Bacteria 3783
259 Ga0081539_10038792 3300005985 Bacteria 2818
260 Ga0081539_10145691 3300005985 Bacteria 1145
261 Ga0070717_10352195 3300006028 Bacteria 1316
262 Ga0070717_10449134 3300006028 Bacteria 1162
263 Ga0070717_11265950 3300006028 Bacteria 671
264 Ga0075365_10020258 3300006038 Bacteria 4120
265 Ga0075365_10053748 3300006038 Bacteria 2669
266 Ga0075365_10082605 3300006038 Bacteria 2178
267 Ga0075365_10237831 3300006038 Bacteria 1279
268 Ga0075365_10977703 3300006038 Bacteria 596
269 Ga0075363_100019619 3300006048 Bacteria 3382
270 Ga0075363_100123013 3300006048 Bacteria 1450
271 Ga0075363_100196456 3300006048 Bacteria 1152
272 Ga0075363_100203691 3300006048 Bacteria 1131
273 Ga0075363_100227136 3300006048 Bacteria 1071
274 Ga0075363_100850359 3300006048 Bacteria 557
275 Ga0075364_10013092 3300006051 Bacteria 5090
276 Ga0075364_10108894 3300006051 Bacteria 1848
277 Ga0075364_10134696 3300006051 Bacteria 1659
278 Ga0075364_10185762 3300006051 Bacteria 1407
279 Ga0075364_11023004 3300006051 Bacteria 561
280 Ga0075364_11036244 3300006051 Bacteria 557
281 Ga0075432_10317997 3300006058 Bacteria 651
282 Ga0070715_10002428 3300006163 Bacteria 5717
283 Ga0070715_10324728 3300006163 Bacteria 832
284 Ga0070716_100481107 3300006173 Bacteria 912
285 Ga0070716_100775318 3300006173 Bacteria 740
286 Ga0070716_100787548 3300006173 Bacteria 735
287 Ga0070712_100524226 3300006175 Bacteria 995
288 Ga0070712_101236028 3300006175 Bacteria 650
289 Ga0070712_101311534 3300006175 Bacteria 631
290 Ga0075362_10141509 3300006177 Bacteria 1150
291 Ga0075367_10120362 3300006178 Bacteria 1617
292 Ga0097621_100670431 3300006237 Bacteria 953
293 Ga0068871_100089567 3300006358 Bacteria 2561
294 Ga0068871_100300370 3300006358 Unclassified 1409
295 Ga0068871_100425879 3300006358 Bacteria 1186
296 Ga0068871_101544795 3300006358 Bacteria 628
297 Ga0075428_100047766 3300006844 Bacteria 4700
298 Ga0075428_100075537 3300006844 Bacteria 3679
299 Ga0075428_101911630 3300006844 Unclassified 616
300 Ga0075430_100003824 3300006846 Bacteria 12675
301 Ga0075430_100165699 3300006846 Bacteria 1839
302 Ga0075430_100313724 3300006846 Bacteria 1297
303 Ga0075430_101209425 3300006846 Bacteria 622
304 Ga0075431_100035956 3300006847 Bacteria 5101
305 Ga0075431_100071900 3300006847 Bacteria 3569
306 Ga0075431_100405111 3300006847 Unclassified 1365
307 Ga0075433_10000542 3300006852 Bacteria 24806
308 Ga0075433_10341885 3300006852 Unclassified 1323
309 Ga0075433_10939474 3300006852 Bacteria 754
310 Ga0075433_11803164 3300006852 Bacteria 526
311 Ga0075434_100000720 3300006871 Bacteria 25896
312 Ga0075434_100006458 3300006871 Bacteria 10745
313 Ga0075434_100573396 3300006871 Bacteria 1148
314 Ga0075434_100645721 3300006871 Bacteria 1077
315 Ga0075434_100862498 3300006871 Bacteria 921
316 Ga0075434_101032332 3300006871 Bacteria 836
317 Ga0075434_101344650 3300006871 Bacteria 725
318 Ga0075429_100000966 3300006880 Bacteria 22797
319 Ga0075429_100224743 3300006880 Bacteria 1644
320 Ga0075429_100793103 3300006880 Bacteria 829
321 Ga0068865_100003300 3300006881 Bacteria 9661
322 Ga0068865_100068695 3300006881 Bacteria 2506
323 Ga0068865_100457997 3300006881 Bacteria 1056
324 Ga0068865_100709956 3300006881 Bacteria 860
325 Ga0075436_100606161 3300006914 Bacteria 807
326 Ga0097620_100118936 3300006931 Bacteria 2708
327 Ga0097620_100744710 3300006931 Bacteria 1069
328 Ga0097620_102163827 3300006931 Bacteria 614
329 Ga0075435_100011415 3300007076 Bacteria 6534
330 Ga0075435_100012427 3300007076 Bacteria 6305
331 Ga0075435_100295491 3300007076 Bacteria 1385
332 Ga0075435_101242634 3300007076 Bacteria 652
333 Ga0105240_10181136 3300009093 Bacteria 2486
334 Ga0105240_10290275 3300009093 Bacteria 1875
335 Ga0105240_10331603 3300009093 Bacteria 1731
336 Ga0105240_10433406 3300009093 Bacteria 1474
337 Ga0105240_10577057 3300009093 Bacteria 1241
338 Ga0105240_10633229 3300009093 Bacteria 1174
339 Ga0105240_10887151 3300009093 Bacteria 960
340 Ga0111539_10021970 3300009094 Bacteria 7842
341 Ga0111539_10213196 3300009094 Bacteria 2250
342 Ga0111539_10259216 3300009094 Bacteria 2024
343 Ga0111539_10295723 3300009094 Bacteria 1884
344 Ga0111539_10434689 3300009094 Bacteria 1528
345 Ga0111539_10653181 3300009094 Bacteria 1225
346 Ga0111539_10777895 3300009094 Bacteria 1114
347 Ga0111539_11281468 3300009094 Bacteria 851
348 Ga0105245_10005436 3300009098 Bacteria 11191
349 Ga0105245_10010135 3300009098 Bacteria 8208
350 Ga0105245_10067164 3300009098 Bacteria 3247
351 Ga0105245_10090095 3300009098 Bacteria 2821
352 Ga0105245_10246339 3300009098 Bacteria 1735
353 Ga0105245_10454261 3300009098 Bacteria 1290
354 Ga0105245_11005153 3300009098 Unclassified 878
355 Ga0105245_11454327 3300009098 Unclassified 736
356 Ga0105245_11556137 3300009098 Bacteria 713
357 Ga0105247_10002937 3300009101 Bacteria 11326
358 Ga0105247_10175357 3300009101 Bacteria 1428
359 Ga0105247_10881877 3300009101 Bacteria 689
360 Ga0105247_11204467 3300009101 Bacteria 603
361 Ga0114129_10018938 3300009147 Bacteria 9808
362 Ga0114129_10059963 3300009147 Bacteria 5320
363 Ga0114129_10080885 3300009147 Bacteria 4516
364 Ga0114129_10096674 3300009147 Bacteria 4089
365 Ga0114129_10317988 3300009147 Bacteria 2070
366 Ga0114129_10372747 3300009147 Bacteria 1886
367 Ga0114129_10692343 3300009147 Bacteria 1311
368 Ga0114129_10875603 3300009147 Bacteria 1140
369 Ga0114129_11289208 3300009147 Bacteria 906
370 Ga0114129_11691094 3300009147 Bacteria 772
371 Ga0114129_12666049 3300009147 Bacteria 596
372 Ga0105243_10004146 3300009148 Bacteria 11509
373 Ga0105243_10007909 3300009148 Bacteria 8165
374 Ga0105243_10144929 3300009148 Bacteria 2031
375 Ga0105243_10302150 3300009148 Bacteria 1451
376 Ga0105243_10350871 3300009148 Bacteria 1355
377 Ga0105243_10453542 3300009148 Bacteria 1204
378 Ga0105243_11181549 3300009148 Bacteria 777
379 Ga0105243_11502967 3300009148 Unclassified 697
380 Ga0105243_11831570 3300009148 Unclassified 638
381 Ga0105243_12195083 3300009148 Bacteria 589
382 Ga0105241_10010179 3300009174 Bacteria 6907
383 Ga0105241_10590005 3300009174 Bacteria 1002
384 Ga0105241_12321299 3300009174 Unclassified 534
385 Ga0105242_10009065 3300009176 Bacteria 7645
386 Ga0105242_10029156 3300009176 Bacteria 4399
387 Ga0105242_10303695 3300009176 Bacteria 1458
388 Ga0105242_10475719 3300009176 Bacteria 1183
389 Ga0105242_11219430 3300009176 Bacteria 772
390 Ga0105242_11417516 3300009176 Bacteria 723
391 Ga0105242_11675390 3300009176 Bacteria 671
392 Ga0105242_12112363 3300009176 Bacteria 607
393 Ga0105248_10448913 3300009177 Bacteria 1453
394 Ga0105248_10966365 3300009177 Unclassified 962
395 Ga0105248_11981432 3300009177 Bacteria 661
396 Ga0105248_12113713 3300009177 Bacteria 640
397 Ga0105248_12715578 3300009177 Bacteria 565
398 Ga0105238_10215607 3300009551 Bacteria 1896
399 Ga0105238_10853559 3300009551 Bacteria 928
400 Ga0105238_11628684 3300009551 Bacteria 676
401 Ga0105238_11665163 3300009551 Bacteria 669
402 Ga0105238_12793541 3300009551 Bacteria 525
403 Ga0105249_10130687 3300009553 Bacteria 2397
404 Ga0105249_10211921 3300009553 Bacteria 1902
405 Ga0105249_10353100 3300009553 Bacteria 1490
406 Ga0105249_11438737 3300009553 Bacteria 761
407 Ga0105249_11471461 3300009553 Bacteria 753
408 Ga0105249_12006691 3300009553 Bacteria 651
409 Ga0105239_10102746 3300010375 Bacteria 3163
410 Ga0105239_10427124 3300010375 Bacteria 1502
411 Ga0105239_11072175 3300010375 Bacteria 927
412 Ga0105239_11636749 3300010375 Bacteria 745
413 Ga0105239_12499159 3300010375 Bacteria 602
414 Ga0105246_10004352 3300011119 Bacteria 8616
415 Ga0105246_10059612 3300011119 Bacteria 2649
416 Ga0105246_10063578 3300011119 Bacteria 2575
417 Ga0157346_1011378 3300012480 Bacteria 659
418 Ga0157320_1011444 3300012481 Bacteria 699
419 Ga0157343_1040723 3300012488 Bacteria 505
420 Ga0157322_1035040 3300012490 Unclassified 553
421 Ga0157341_1005923 3300012494 Bacteria 932
422 Ga0157341_1045672 3300012494 Bacteria 521
423 Ga0157324_1022420 3300012506 Unclassified 654
424 Ga0154012_114477 3300013059 Unclassified 558
425 Ga0157373_10128005 3300013100 Bacteria 1786
426 Ga0157373_10872566 3300013100 Bacteria 666
427 Ga0157373_11505059 3300013100 Unclassified 514
428 Ga0157371_10580358 3300013102 Bacteria 833
429 Ga0157371_11479657 3300013102 Bacteria 529
430 Ga0157370_10074739 3300013104 Bacteria 3196
431 Ga0157370_10093060 3300013104 Bacteria 2829
432 Ga0157370_10127274 3300013104 Bacteria 2377
433 Ga0157370_10287106 3300013104 Bacteria 1520
434 Ga0157369_10013890 3300013105 Bacteria 9097
435 Ga0157369_10067662 3300013105 Bacteria 3839
436 Ga0157369_10075281 3300013105 Bacteria 3620
437 Ga0157369_10155465 3300013105 Bacteria 2416
438 Ga0157369_10188962 3300013105 Bacteria 2165
439 Ga0157369_10302916 3300013105 Bacteria 1662
440 Ga0157369_10421271 3300013105 Bacteria 1384
441 Ga0157369_10473054 3300013105 Bacteria 1297
442 Ga0157369_10778016 3300013105 Bacteria 984
443 Ga0157369_11043524 3300013105 Bacteria 836
444 Ga0157369_11783475 3300013105 Bacteria 625
445 Ga0157369_12011747 3300013105 Bacteria 586
446 Ga0157374_10151821 3300013296 Bacteria 2252
447 Ga0157374_10315835 3300013296 Bacteria 1547
448 Ga0157374_10563033 3300013296 Bacteria 1148
449 Ga0157374_10889216 3300013296 Unclassified 908
450 Ga0157374_11063804 3300013296 Unclassified 829
451 Ga0157374_11315398 3300013296 Bacteria 745
452 Ga0157378_10001752 3300013297 Bacteria 19468
453 Ga0157378_10929023 3300013297 Bacteria 902
454 Ga0163162_10760787 3300013306 Bacteria 1088
455 Ga0163162_11416628 3300013306 Bacteria 791
456 Ga0157372_10117694 3300013307 Bacteria 3048
457 Ga0157372_10191691 3300013307 Bacteria 2367
458 Ga0157372_12137328 3300013307 Unclassified 643
459 Ga0157372_12177824 3300013307 Bacteria 637
460 Ga0157372_12477855 3300013307 Bacteria 596
461 Ga0157375_10105006 3300013308 Bacteria 2914
462 Ga0157375_10118416 3300013308 Bacteria 2755
463 Ga0157375_10123928 3300013308 Bacteria 2697
464 Ga0157375_10709544 3300013308 Bacteria 1159
465 Ga0157375_10893814 3300013308 Bacteria 1033
466 Ga0157375_10909858 3300013308 Bacteria 1023
467 Ga0157375_11162491 3300013308 Bacteria 904
468 Ga0157375_11993456 3300013308 Bacteria 690
469 Ga0157375_12075412 3300013308 Bacteria 676
470 Ga0163163_10336506 3300014325 Bacteria 1564
471 Ga0163163_10480721 3300014325 Bacteria 1303
472 Ga0163163_12527685 3300014325 Bacteria 571
473 Ga0163163_12672807 3300014325 Unclassified 556
474 Ga0163163_13058453 3300014325 Bacteria 522
475 Ga0157380_10025502 3300014326 Bacteria 4483
476 Ga0157380_12961544 3300014326 Unclassified 541
477 Ga0182008_10303194 3300014497 Bacteria 836
478 Ga0157377_10006373 3300014745 Bacteria 5624
479 Ga0157379_10009631 3300014968 Bacteria 8410
480 Ga0157379_10817801 3300014968 Bacteria 880
481 Ga0157379_12008854 3300014968 Bacteria 571
482 Ga0157376_10265054 3300014969 Bacteria 1611
483 Ga0157376_11628394 3300014969 Bacteria 680
484 Ga0197907_10441792 3300020069 Bacteria 1450
485 Ga0197907_10469260 3300020069 Unclassified 1037
486 Ga0206356_10070943 3300020070 Bacteria 1132
487 Ga0206356_10643260 3300020070 Bacteria 2046
488 Ga0206356_11413429 3300020070 Bacteria 754
489 Ga0206354_10107059 3300020081 Bacteria 2776
490 Ga0206354_11636799 3300020081 Bacteria 1211
491 Ga0206353_10321845 3300020082 Bacteria 1830
492 Ga0206353_10410348 3300020082 Bacteria 1402
493 Ga0206353_10608362 3300020082 Unclassified 857
494 Ga0206353_11189367 3300020082 Bacteria 4545
495 Ga0213876_10018808 3300021384 Bacteria 3649
496 Ga0213875_10210278 3300021388 Bacteria 916
497 Ga0213871_10029909 3300021441 Bacteria 1415
498 Ga0224712_10046446 3300022467 Bacteria 1666
499 Ga0207656_10012992 3300025321 Bacteria 3173
500 Ga0207653_10082902 3300025885 Bacteria 1113
501 Ga0207653_10119334 3300025885 Bacteria 948
502 Ga0207692_10153238 3300025898 Bacteria 1322
503 Ga0207692_10982290 3300025898 Bacteria 557
504 Ga0207710_10008578 3300025900 Bacteria 4309
505 Ga0207688_10012501 3300025901 Bacteria 4620
506 Ga0207688_10116407 3300025901 Bacteria 1556
507 Ga0207688_10600600 3300025901 Unclassified 693
508 Ga0207680_10366302 3300025903 Bacteria 1014
509 Ga0207685_10101825 3300025905 Bacteria 1229
510 Ga0207685_10121099 3300025905 Bacteria 1149
511 Ga0207699_10450299 3300025906 Bacteria 923
512 Ga0207699_10618101 3300025906 Bacteria 790
513 Ga0207645_10485313 3300025907 Bacteria 836
514 Ga0207645_10562592 3300025907 Bacteria 774
515 Ga0207643_10144344 3300025908 Bacteria 1423
516 Ga0207643_10410917 3300025908 Bacteria 857
517 Ga0207705_10006903 3300025909 Bacteria 8387
518 Ga0207705_10013505 3300025909 Bacteria 5893
519 Ga0207705_10013940 3300025909 Bacteria 5796
520 Ga0207705_10101931 3300025909 Bacteria 2112
521 Ga0207684_10807562 3300025910 Unclassified 793
522 Ga0207654_10029494 3300025911 Bacteria 3004
523 Ga0207654_10295441 3300025911 Unclassified 1100
524 Ga0207654_10324514 3300025911 Bacteria 1053
525 Ga0207707_10002919 3300025912 Bacteria 15249
526 Ga0207707_10007563 3300025912 Bacteria 9464
527 Ga0207707_10062016 3300025912 Bacteria 3253
528 Ga0207707_10145570 3300025912 Bacteria 2071
529 Ga0207707_11048178 3300025912 Unclassified 667
530 Ga0207707_11229859 3300025912 Bacteria 605
531 Ga0207695_10524065 3300025913 Unclassified 1067
532 Ga0207695_10563794 3300025913 Bacteria 1020
533 Ga0207695_11025731 3300025913 Unclassified 705
534 Ga0207695_11086277 3300025913 Bacteria 680
535 Ga0207695_11134703 3300025913 Unclassified 662
536 Ga0207671_10388865 3300025914 Bacteria 1109
537 Ga0207693_10137749 3300025915 Bacteria 1919
538 Ga0207693_10336845 3300025915 Bacteria 1181
539 Ga0207693_10744930 3300025915 Bacteria 757
540 Ga0207693_10878991 3300025915 Bacteria 688
541 Ga0207693_10922670 3300025915 Bacteria 669
542 Ga0207693_10950915 3300025915 Unclassified 658
543 Ga0207663_10344035 3300025916 Bacteria 1127
544 Ga0207663_10616125 3300025916 Bacteria 854
545 Ga0207663_10660680 3300025916 Bacteria 825
546 Ga0207660_10003668 3300025917 Bacteria 10008
547 Ga0207660_10072439 3300025917 Bacteria 2509
548 Ga0207660_10088968 3300025917 Bacteria 2285
549 Ga0207660_10127156 3300025917 Bacteria 1937
550 Ga0207660_10226093 3300025917 Bacteria 1470
551 Ga0207660_10279320 3300025917 Bacteria 1325
552 Ga0207660_10460010 3300025917 Unclassified 1030
553 Ga0207662_10151348 3300025918 Bacteria 1476
554 Ga0207662_10158739 3300025918 Bacteria 1443
555 Ga0207662_10500324 3300025918 Bacteria 837
556 Ga0207657_10000166 3300025919 Bacteria 67098
557 Ga0207657_10001699 3300025919 Bacteria 23745
558 Ga0207657_10005205 3300025919 Bacteria 13632
559 Ga0207657_10005284 3300025919 Bacteria 13530
560 Ga0207657_10019418 3300025919 Bacteria 6455
561 Ga0207657_10175202 3300025919 Bacteria 1736
562 Ga0207657_10592712 3300025919 Bacteria 865
563 Ga0207657_10780014 3300025919 Bacteria 740
564 Ga0207657_11237043 3300025919 Unclassified 566
565 Ga0207649_10009752 3300025920 Bacteria 5259
566 Ga0207649_10073463 3300025920 Bacteria 2191
567 Ga0207649_10112373 3300025920 Bacteria 1822
568 Ga0207649_10359181 3300025920 Bacteria 1080
569 Ga0207649_10997853 3300025920 Archaea 659
570 Ga0207649_11033954 3300025920 Bacteria 647
571 Ga0207652_10019956 3300025921 Bacteria 5519
572 Ga0207652_10022272 3300025921 Bacteria 5240
573 Ga0207652_10064550 3300025921 Bacteria 3168
574 Ga0207652_10349207 3300025921 Bacteria 1335
575 Ga0207652_10368668 3300025921 Bacteria 1296
576 Ga0207652_10546332 3300025921 Bacteria 1041
577 Ga0207652_10581209 3300025921 Bacteria 1005
578 Ga0207652_10881615 3300025921 Bacteria 791
579 Ga0207652_10929227 3300025921 Bacteria 767
580 Ga0207652_11024682 3300025921 Unclassified 725
581 Ga0207646_10001072 3300025922 Bacteria 34848
582 Ga0207646_10564029 3300025922 Bacteria 1023
583 Ga0207694_10044430 3300025924 Bacteria 3430
584 Ga0207694_10049470 3300025924 Bacteria 3254
585 Ga0207650_11453427 3300025925 Unclassified 583
586 Ga0207659_10115634 3300025926 Bacteria 2047
587 Ga0207659_10360942 3300025926 Bacteria 1207
588 Ga0207659_11737710 3300025926 Unclassified 531
589 Ga0207687_10029907 3300025927 Bacteria 3667
590 Ga0207687_10196115 3300025927 Bacteria 1575
591 Ga0207687_10301265 3300025927 Bacteria 1291
592 Ga0207687_10628047 3300025927 Unclassified 907
593 Ga0207687_10629289 3300025927 Bacteria 906
594 Ga0207687_10772692 3300025927 Unclassified 818
595 Ga0207687_10864157 3300025927 Bacteria 773
596 Ga0207687_10929605 3300025927 Unclassified 745
597 Ga0207700_10263860 3300025928 Bacteria 1476
598 Ga0207700_10600549 3300025928 Bacteria 979
599 Ga0207700_10670640 3300025928 Bacteria 925
600 Ga0207664_10114382 3300025929 Bacteria 2248
601 Ga0207664_10115436 3300025929 Bacteria 2239
602 Ga0207664_10271156 3300025929 Bacteria 1486
603 Ga0207664_11296515 3300025929 Bacteria 648
604 Ga0207664_11412679 3300025929 Bacteria 617
605 Ga0207644_10419859 3300025931 Bacteria 1096
606 Ga0207644_10553413 3300025931 Bacteria 952
607 Ga0207644_11396133 3300025931 Bacteria 588
608 Ga0207690_10026366 3300025932 Bacteria 3659
609 Ga0207690_10087116 3300025932 Bacteria 2196
610 Ga0207690_10544441 3300025932 Bacteria 943
611 Ga0207690_11744506 3300025932 Bacteria 520
612 Ga0207706_10019164 3300025933 Bacteria 6154
613 Ga0207706_11045816 3300025933 Bacteria 684
614 Ga0207686_10018351 3300025934 Bacteria 3960
615 Ga0207686_10239463 3300025934 Bacteria 1320
616 Ga0207686_10458471 3300025934 Bacteria 982
617 Ga0207686_11028492 3300025934 Bacteria 669
618 Ga0207709_10043978 3300025935 Bacteria 2696
619 Ga0207709_10081205 3300025935 Bacteria 2090
620 Ga0207709_10113079 3300025935 Bacteria 1819
621 Ga0207709_10130734 3300025935 Bacteria 1711
622 Ga0207709_10179927 3300025935 Unclassified 1492
623 Ga0207709_10317519 3300025935 Bacteria 1165
624 Ga0207709_10456672 3300025935 Unclassified 989
625 Ga0207709_11821006 3300025935 Bacteria 506
626 Ga0207670_10012786 3300025936 Bacteria 4924
627 Ga0207669_10012793 3300025937 Bacteria 4140
628 Ga0207669_10543226 3300025937 Unclassified 936
629 Ga0207669_10572078 3300025937 Bacteria 915
630 Ga0207669_11057249 3300025937 Unclassified 684
631 Ga0207704_10080689 3300025938 Bacteria 2101
632 Ga0207704_10198411 3300025938 Bacteria 1466
633 Ga0207704_10331670 3300025938 Bacteria 1178
634 Ga0207704_10335989 3300025938 Bacteria 1171
635 Ga0207704_10525775 3300025938 Bacteria 957
636 Ga0207665_10198419 3300025939 Bacteria 1461
637 Ga0207665_10251520 3300025939 Bacteria 1306
638 Ga0207665_10661794 3300025939 Bacteria 819
639 Ga0207665_10683200 3300025939 Bacteria 806
640 Ga0207665_11413021 3300025939 Bacteria 554
641 Ga0207691_10003565 3300025940 Bacteria 15148
642 Ga0207691_10548400 3300025940 Bacteria 980
643 Ga0207711_11177126 3300025941 Bacteria 708
644 Ga0207661_10005687 3300025944 Bacteria 8794
645 Ga0207661_10010549 3300025944 Bacteria 6655
646 Ga0207661_10052680 3300025944 Bacteria 3252
647 Ga0207661_10092301 3300025944 Bacteria 2524
648 Ga0207661_10129140 3300025944 Bacteria 2162
649 Ga0207661_10155136 3300025944 Bacteria 1982
650 Ga0207661_10316755 3300025944 Bacteria 1401
651 Ga0207661_10358227 3300025944 Bacteria 1317
652 Ga0207661_10443721 3300025944 Bacteria 1181
653 Ga0207661_11052841 3300025944 Unclassified 749
654 Ga0207661_11255078 3300025944 Bacteria 681
655 Ga0207661_11318222 3300025944 Bacteria 663
656 Ga0207679_10030325 3300025945 Bacteria 3775
657 Ga0207679_10411063 3300025945 Bacteria 1192
658 Ga0207679_10454339 3300025945 Bacteria 1137
659 Ga0207679_10786104 3300025945 Bacteria 867
660 Ga0207667_10115455 3300025949 Bacteria 2767
661 Ga0207667_10159143 3300025949 Bacteria 2323
662 Ga0207667_10288094 3300025949 Bacteria 1678
663 Ga0207667_10379077 3300025949 Bacteria 1441
664 Ga0207667_10437807 3300025949 Bacteria 1329
665 Ga0207667_10484249 3300025949 Bacteria 1256
666 Ga0207667_10695792 3300025949 Bacteria 1019
667 Ga0207667_11068061 3300025949 Unclassified 792
668 Ga0207667_11203872 3300025949 Bacteria 737
669 Ga0207651_10137641 3300025960 Bacteria 1881
670 Ga0207651_11736848 3300025960 Unclassified 562
671 Ga0207651_12089382 3300025960 Unclassified 509
672 Ga0207712_10110345 3300025961 Bacteria 2062
673 Ga0207712_10231008 3300025961 Unclassified 1485
674 Ga0207712_10322820 3300025961 Bacteria 1274
675 Ga0207668_10014721 3300025972 Bacteria 4847
676 Ga0207668_10222088 3300025972 Bacteria 1518
677 Ga0207640_10343704 3300025981 Bacteria 1196
678 Ga0207640_10849837 3300025981 Bacteria 794
679 Ga0207640_11022224 3300025981 Bacteria 728
680 Ga0207658_10064115 3300025986 Bacteria 2755
681 Ga0207658_11988017 3300025986 Bacteria 529
682 Ga0207677_10009947 3300026023 Bacteria 5365
683 Ga0207677_10647002 3300026023 Bacteria 933
684 Ga0207677_11726557 3300026023 Bacteria 581
685 Ga0207703_10206718 3300026035 Bacteria 1748
686 Ga0207703_10634225 3300026035 Bacteria 1013
687 Ga0207639_10020961 3300026041 Bacteria 4688
688 Ga0207639_10042523 3300026041 Bacteria 3405
689 Ga0207639_10351459 3300026041 Unclassified 1317
690 Ga0207639_10665921 3300026041 Unclassified 964
691 Ga0207639_11490187 3300026041 Bacteria 635
692 Ga0207678_10007283 3300026067 Bacteria 9807
693 Ga0207678_10197991 3300026067 Bacteria 1717
694 Ga0207678_10622228 3300026067 Unclassified 947
695 Ga0207678_10773164 3300026067 Bacteria 847
696 Ga0207708_10002241 3300026075 Bacteria 14249
697 Ga0207708_10004129 3300026075 Bacteria 10688
698 Ga0207708_10471137 3300026075 Bacteria 1049
699 Ga0207708_10616268 3300026075 Bacteria 921
700 Ga0207708_11386301 3300026075 Bacteria 617
701 Ga0207708_11389010 3300026075 Unclassified 616
702 Ga0207708_11478966 3300026075 Bacteria 597
703 Ga0207708_11488483 3300026075 Bacteria 595
704 Ga0207702_10020789 3300026078 Bacteria 5429
705 Ga0207702_10149129 3300026078 Bacteria 2126
706 Ga0207702_10335743 3300026078 Bacteria 1443
707 Ga0207702_10757490 3300026078 Unclassified 959
708 Ga0207702_11366791 3300026078 Unclassified 702
709 Ga0207702_11772217 3300026078 Bacteria 610
710 Ga0207641_10970009 3300026088 Unclassified 846
711 Ga0207641_11032592 3300026088 Bacteria 819
712 Ga0207648_10055146 3300026089 Bacteria 3470
713 Ga0207648_10799901 3300026089 Bacteria 877
714 Ga0207648_11039098 3300026089 Bacteria 768
715 Ga0207648_11276249 3300026089 Unclassified 690
716 Ga0207676_10802807 3300026095 Bacteria 918
717 Ga0207674_10038314 3300026116 Bacteria 4977
718 Ga0207674_10049297 3300026116 Bacteria 4307
719 Ga0207674_10124545 3300026116 Bacteria 2543
720 Ga0207674_10128699 3300026116 Bacteria 2496
721 Ga0207674_10529873 3300026116 Bacteria 1138
722 Ga0207674_10756955 3300026116 Unclassified 938
723 Ga0207674_11441773 3300026116 Bacteria 658
724 Ga0207675_100033537 3300026118 Bacteria 4784
725 Ga0207675_102220104 3300026118 Bacteria 564
726 Ga0207683_10000088 3300026121 Bacteria 72940
727 Ga0207683_10176396 3300026121 Bacteria 1937
728 Ga0207683_10177128 3300026121 Bacteria 1933
729 Ga0207683_10229294 3300026121 Bacteria 1693
730 Ga0207683_10305271 3300026121 Bacteria 1456
731 Ga0207683_11269017 3300026121 Bacteria 682
732 Ga0207698_10123877 3300026142 Bacteria 2194
733 Ga0207698_11049820 3300026142 Bacteria 826
734 Ga0207428_10031186 3300027907 Bacteria 4403
735 Ga0207428_10165577 3300027907 Bacteria 1677
736 Ga0207428_10380004 3300027907 Bacteria 1036
737 Ga0207428_10414372 3300027907 Bacteria 985
738 Ga0207428_10971048 3300027907 Unclassified 598
739 Ga0268266_10236460 3300028379 Bacteria 1684
740 Ga0268266_10403557 3300028379 Bacteria 1293
741 Ga0268266_10612116 3300028379 Bacteria 1047
742 Ga0268265_11177395 3300028380 Bacteria 763
743 Ga0268265_11202900 3300028380 Bacteria 755
744 Ga0268265_12357735 3300028380 Bacteria 539
745 Ga0268265_12434016 3300028380 Bacteria 530
746 Ga0268264_10232267 3300028381 Bacteria 1704
747 Ga0268264_10288560 3300028381 Bacteria 1540
748 Ga0268264_11704436 3300028381 Unclassified 641
749 Ga0265326_10067007 3300028558 Bacteria 1015
750 Ga0265319_1013301 3300028563 Bacteria 3281
751 Ga0265319_1042289 3300028563 Bacteria 1533
752 Ga0265319_1077469 3300028563 Bacteria 1059
753 Ga0265319_1086625 3300028563 Bacteria 991
754 Ga0265319_1110413 3300028563 Bacteria 860
755 Ga0265319_1118058 3300028563 Bacteria 827
756 Ga0265334_10130101 3300028573 Bacteria 896
757 Ga0265334_10135689 3300028573 Bacteria 874
758 Ga0265318_10014422 3300028577 Bacteria 3317
759 Ga0265318_10071286 3300028577 Unclassified 1288
760 Ga0265318_10116422 3300028577 Bacteria 982
761 Ga0265318_10343207 3300028577 Unclassified 545
762 Ga0265318_10355892 3300028577 Unclassified 534
763 Ga0265322_10012886 3300028654 Bacteria 2422
764 Ga0265322_10027569 3300028654 Bacteria 1623
765 Ga0265338_10009062 3300028800 Bacteria 11970
766 Ga0265338_10102308 3300028800 Bacteria 2330
767 Ga0265338_10225576 3300028800 Bacteria 1397
768 Ga0265338_10313886 3300028800 Archaea 1136
769 Ga0265338_10551573 3300028800 Bacteria 807
770 Ga0265338_10574946 3300028800 Bacteria 787
771 Ga0265338_11033740 3300028800 Bacteria 555
772 Ga0265324_10040619 3300029957 Bacteria 1611
773 Ga0265324_10175032 3300029957 Bacteria 729
774 Ga0265330_10072031 3300031235 Bacteria 1495
775 Ga0265332_10118222 3300031238 Bacteria 1114
776 Ga0265328_10103313 3300031239 Bacteria 1056
777 Ga0265320_10022089 3300031240 Bacteria 3410
778 Ga0265320_10091477 3300031240 Bacteria 1409
779 Ga0265320_10114728 3300031240 Bacteria 1232
780 Ga0265320_10162658 3300031240 Bacteria 1005
781 Ga0265325_10056453 3300031241 Bacteria 2005
782 Ga0265329_10065226 3300031242 Bacteria 1152
783 Ga0265340_10008080 3300031247 Bacteria 5696
784 Ga0265340_10314514 3300031247 Bacteria 693
785 Ga0265339_10094960 3300031249 Bacteria 1558
786 Ga0265339_10398264 3300031249 Bacteria 644
787 Ga0265331_10145984 3300031250 Bacteria 1075
788 Ga0265327_10051663 3300031251 Bacteria 2144
789 Ga0265327_10151399 3300031251 Unclassified 1077
790 Ga0265316_10385660 3300031344 Bacteria 1010
791 Ga0265316_10784097 3300031344 Unclassified 669
792 Ga0265316_11054972 3300031344 Archaea 564
793 Ga0307408_100428254 3300031548 Bacteria 1143
794 Ga0307408_100773170 3300031548 Bacteria 869
795 Ga0265313_10007477 3300031595 Bacteria 7453
796 Ga0265313_10088275 3300031595 Bacteria 1396
797 Ga0316579_10114280 3300031691 Bacteria 1296
798 Ga0265314_10099409 3300031711 Bacteria 1874
799 Ga0265314_10296344 3300031711 Bacteria 909
800 Ga0265314_10302221 3300031711 Bacteria 897
801 Ga0265314_10704023 3300031711 Bacteria 510
802 Ga0265342_10052692 3300031712 Bacteria 2424
803 Ga0316576_11222284 3300031727 Bacteria 530
804 Ga0307405_10288754 3300031731 Bacteria 1239
805 Ga0307405_11224521 3300031731 Bacteria 650
806 Ga0316577_10457990 3300031733 Bacteria 725
807 Ga0307413_11362963 3300031824 Bacteria 623
808 Ga0307406_10035647 3300031901 Bacteria 3061
809 Ga0307407_10402904 3300031903 Unclassified 982
810 Ga0307412_10062425 3300031911 Bacteria 2509
811 Ga0307412_10596258 3300031911 Bacteria 935
812 Ga0307412_10727214 3300031911 Bacteria 855
813 Ga0307409_100527310 3300031995 Bacteria 1155
814 Ga0307409_100745159 3300031995 Bacteria 983
815 Ga0307409_101425560 3300031995 Unclassified 719
816 Ga0307416_100199710 3300032002 Bacteria 1896
817 Ga0307416_100625672 3300032002 Bacteria 1159
818 Ga0307416_100772995 3300032002 Unclassified 1054
819 Ga0307416_100897204 3300032002 Unclassified 986
820 Ga0307416_101235113 3300032002 Bacteria 853
821 Ga0307415_100060203 3300032126 Bacteria 2623
822 Ga0307415_101412609 3300032126 Bacteria 663
823 Ga0373926_0109212 3300035083 Bacteria 1038
824 Ga0373944_0025012 3300035089 Bacteria 1755
825 Ga0373944_0179167 3300035089 Bacteria 759
826 Ga0373936_0014471 3300035113 Bacteria 3016
827 Ga0373936_0094536 3300035113 Bacteria 1256
828 Ga0373945_0002030 3300035116 Bacteria 6298
829 Ga0373945_0034277 3300035116 Bacteria 1808
830 Ga0373945_0418549 3300035116 Bacteria 589
831 Ga0373953_0178426 3300035117 Bacteria 916
832 Ga0373954_0092224 3300035118 Bacteria 1456
833 Ga0373943_0000350 3300035170 Bacteria 19435
834 Ga0373943_0008333 3300035170 Bacteria 4653
835 Ga0373943_0229729 3300035170 Bacteria 1036
836 Ga0373943_0611213 3300035170 Bacteria 643
837 Ga0373946_0019246 3300035171 Bacteria 2630
838 Ga0373946_0598463 3300035171 Bacteria 572
839 Ga0373955_0513601 3300035172 Bacteria 732
840 Ga0373962_0019918 3300035242 Bacteria 1758
841 Ga0316574_0128761 3300035398 Bacteria 1628
842 Ga0316574_0160863 3300035398 Unclassified 1446
843 Ga0373924_0495914 3300035410 Bacteria 549
844 Ga0373935_0018135 3300035692 Bacteria 4278
845 Ga0373935_0209100 3300035692 Bacteria 1351
846 Ga0373927_0005037 3300035695 Bacteria 9143
847 Ga0373927_0009585 3300035695 Bacteria 6496
848 Ga0373927_0708055 3300035695 Bacteria 665
849 Ga0373933_1068345 3300035724 Bacteria 532
850 Ga0373947_0000185 3300035725 Bacteria 34341
851 Ga0373947_0002783 3300035725 Bacteria 10458
852 Ga0373947_0009967 3300035725 Bacteria 5456
853 Ga0373947_0203978 3300035725 Bacteria 1295
854 Ga0373947_0304183 3300035725 Bacteria 1064
855 Ga0373937_0213267 3300036401 Bacteria 1817
856 Ga0373937_0253233 3300036401 Bacteria 1660
857 Ga0373937_0351396 3300036401 Bacteria 1396
858 Ga0316582_0334561 3300036647 Bacteria 1041
859 Ga0373925_0006480 3300037068 Bacteria 8609
860 Ga0373925_0009540 3300037068 Bacteria 7067
861 Ga0373925_0009968 3300037068 Bacteria 6900
862 Ga0373925_1550746 3300037068 Unclassified 542
863 Ga0395899_0001247 3300037312 Bacteria 22094
864 Ga0395899_0012226 3300037312 Bacteria 6573
865 Ga0395899_0022398 3300037312 Bacteria 4791
866 Ga0395899_0055815 3300037312 Bacteria 2921
867 Ga0395899_0096302 3300037312 Bacteria 2140
868 Ga0395899_0135140 3300037312 Bacteria 1758
869 Ga0395899_0151750 3300037312 Bacteria 1642
870 Ga0395899_0367536 3300037312 Bacteria 959
871 Ga0395899_0403293 3300037312 Bacteria 904
872 Ga0395899_0441999 3300037312 Unclassified 853
873 Ga0395899_0467454 3300037312 Unclassified 823
874 Ga0395899_0596717 3300037312 Bacteria 704
875 Ga0395899_0782858 3300037312 Bacteria 591
876 Ga0395900_0000929 3300037418 Bacteria 38304
877 Ga0395900_0012327 3300037418 Bacteria 8745
878 Ga0395900_0020618 3300037418 Bacteria 6734
879 Ga0395900_0035190 3300037418 Bacteria 5159
880 Ga0395900_0061443 3300037418 Bacteria 3862
881 Ga0395900_0079018 3300037418 Bacteria 3380
882 Ga0395900_0107562 3300037418 Bacteria 2865
883 Ga0395900_0112994 3300037418 Bacteria 2788
884 Ga0395900_0121200 3300037418 Bacteria 2683
885 Ga0395900_0182550 3300037418 Bacteria 2131
886 Ga0395900_0261674 3300037418 Bacteria 1727
887 Ga0395900_0299173 3300037418 Bacteria 1596
888 Ga0395900_0314797 3300037418 Bacteria 1547
889 Ga0395900_0377006 3300037418 Bacteria 1387
890 Ga0395900_0798003 3300037418 Bacteria 872
891 Ga0395900_0916604 3300037418 Bacteria 799
892 Ga0395900_0970130 3300037418 Bacteria 771
893 Ga0395900_1036771 3300037418 Unclassified 739
894 Ga0395900_1085930 3300037418 Bacteria 718
895 Ga0395898_0003495 3300037466 Bacteria 17560
896 Ga0395898_0007203 3300037466 Bacteria 11807
897 Ga0395898_0008588 3300037466 Bacteria 10780
898 Ga0395898_0009600 3300037466 Bacteria 10161
899 Ga0395898_0017551 3300037466 Bacteria 7305
900 Ga0395898_0033238 3300037466 Bacteria 5149
901 Ga0395898_0034664 3300037466 Bacteria 5026
902 Ga0395898_0044823 3300037466 Bacteria 4350
903 Ga0395898_0074768 3300037466 Bacteria 3273
904 Ga0395898_0376200 3300037466 Bacteria 1354
905 Ga0395898_0388005 3300037466 Bacteria 1332
906 Ga0395898_0425892 3300037466 Bacteria 1265
907 Ga0395898_0576835 3300037466 Bacteria 1067
908 Ga0395898_0703654 3300037466 Unclassified 952
909 Ga0395898_0705008 3300037466 Bacteria 951
910 Ga0395898_0876072 3300037466 Bacteria 837
911 Ga0395898_0940049 3300037466 Unclassified 802
912 Ga0395898_0972850 3300037466 Unclassified 785
913 Ga0395898_1035529 3300037466 Bacteria 756
914 Ga0395898_1713893 3300037466 Bacteria 551
915 Ga0395898_1724984 3300037466 Bacteria 549
916 Ga0395905_0005716 3300037471 Bacteria 12642
917 Ga0395905_0027711 3300037471 Bacteria 5342
918 Ga0395905_0032667 3300037471 Bacteria 4894
919 Ga0395905_0033887 3300037471 Bacteria 4797
920 Ga0395905_0086722 3300037471 Bacteria 2934
921 Ga0395905_0217518 3300037471 Bacteria 1789
922 Ga0395905_0448182 3300037471 Bacteria 1188
923 Ga0395905_0486647 3300037471 Bacteria 1133
924 Ga0395905_0534424 3300037471 Bacteria 1073
925 Ga0395905_0648102 3300037471 Bacteria 958
926 Ga0395905_0740714 3300037471 Bacteria 885
927 Ga0395905_0941347 3300037471 Unclassified 767
928 Ga0436364_1131197 3300037853 Bacteria 1049
929 Ga0436364_1454008 3300037853 Bacteria 1932
930 Ga0395901_0001602 3300038443 Bacteria 23437
931 Ga0395901_0003765 3300038443 Bacteria 15289
932 Ga0395901_0008051 3300038443 Bacteria 10645
933 Ga0395901_0009363 3300038443 Bacteria 9934
934 Ga0395901_0016603 3300038443 Bacteria 7502
935 Ga0395901_0021820 3300038443 Bacteria 6564
936 Ga0395901_0034145 3300038443 Bacteria 5253
937 Ga0395901_0088000 3300038443 Bacteria 3248
938 Ga0395901_0105320 3300038443 Bacteria 2960
939 Ga0395901_0144006 3300038443 Bacteria 2505
940 Ga0395901_0294812 3300038443 Bacteria 1682
941 Ga0395901_0404626 3300038443 Bacteria 1402
942 Ga0395901_0438974 3300038443 Bacteria 1336
943 Ga0395901_0439358 3300038443 Bacteria 1336
944 Ga0395901_0458306 3300038443 Bacteria 1303
945 Ga0395901_0538128 3300038443 Unclassified 1185
946 Ga0395901_0587490 3300038443 Bacteria 1124
947 Ga0395901_0590979 3300038443 Bacteria 1120
948 Ga0395901_0677677 3300038443 Bacteria 1031
949 Ga0395901_0769673 3300038443 Bacteria 954
950 Ga0395901_0918550 3300038443 Bacteria 856
951 Ga0395901_1018917 3300038443 Bacteria 803
952 Ga0395901_1053280 3300038443 Bacteria 786
953 Ga0395901_1056529 3300038443 Bacteria 785
954 Ga0395901_1751176 3300038443 Bacteria 571
955 Ga0395901_1781261 3300038443 Bacteria 565
956 Ga0395901_1788133 3300038443 Unclassified 564
957 Ga0436365_0067507 3300039437 Bacteria 2008
958 Ga0436365_0599127 3300039437 Bacteria 901
959 Ga0436365_0750374 3300039437 Bacteria 597
960 Ga0436365_1780358 3300039437 Bacteria 3687
961 Ga0436360_0073679 3300039438 Bacteria 938
962 Ga0436360_1164661 3300039438 Bacteria 1407
963 Ga0436363_0447391 3300039450 Bacteria 1236
964 Ga0436363_0448316 3300039450 Bacteria 1564
965 Ga0436363_0547070 3300039450 Bacteria 1216
966 Ga0436363_0626821 3300039450 Bacteria 805
967 Ga0436363_1519970 3300039450 Bacteria 802
968 Ga0436363_1708364 3300039450 Bacteria 901
969 Ga0436362_1214113 3300039453 Bacteria 694
970 Ga0436362_1245687 3300039453 Bacteria 2039
971 Ga0451789_0482524 3300041443 Bacteria 627
972 Ga0451789_1028427 3300041443 Bacteria 631
973 Ga0451798_0502003 3300041458 Bacteria 591
974 Ga0451839_1239118 3300041496 Bacteria 624
975 Ga0451851_1270938 3300041507 Bacteria 509
976 Ga0451855_1786676 3300041511 Bacteria 506
977 Ga0451853_2053074 3300041512 Bacteria 605
978 Ga0451853_2822760 3300041512 Unclassified 813
979 Ga0451853_3501075 3300041512 Bacteria 679
980 Ga0451853_3804591 3300041512 Bacteria 698
981 Ga0439448_0188532 3300042005 Bacteria 721
982 Ga0450905_032091 3300042142 Unclassified 813
983 Ga0439458_0117295 3300042157 Unclassified 699
984 Ga0439435_0100097 3300042436 Bacteria 890
985 Ga0439440_0076101 3300042993 Bacteria 881
986 Ga0466969_0400100 3300044656 Bacteria 623
987 Ga0466965_0342316 3300044683 Bacteria 818
988 Ga0466965_0391041 3300044683 Bacteria 767
989 Ga0466966_0023576 3300044684 Bacteria 4028
990 Ga0466966_0039616 3300044684 Bacteria 3034
991 Ga0466966_0092676 3300044684 Bacteria 1874
992 Ga0466966_0108913 3300044684 Bacteria 1709
993 Ga0466966_0798311 3300044684 Bacteria 569
994 Ga0466961_0032934 3300044693 Bacteria 3330
995 Ga0466961_0036106 3300044693 Bacteria 3172
996 Ga0466961_0851472 3300044693 Bacteria 543
997 Ga0466963_0015589 3300044694 Bacteria 4710
998 Ga0466963_0026028 3300044694 Bacteria 3739
999 Ga0466963_0046586 3300044694 Bacteria 2859
1000 Ga0466963_0056010 3300044694 Bacteria 2623
1001 Ga0466963_0118327 3300044694 Bacteria 1822
1002 Ga0466963_0127612 3300044694 Bacteria 1754
1003 Ga0466963_0162405 3300044694 Bacteria 1555
1004 Ga0466963_0203528 3300044694 Bacteria 1385
1005 Ga0466963_0231198 3300044694 Bacteria 1296
1006 Ga0466963_0249955 3300044694 Bacteria 1244
1007 Ga0466963_0274003 3300044694 Bacteria 1186
1008 Ga0466963_0489257 3300044694 Bacteria 868
1009 Ga0466963_0526695 3300044694 Bacteria 834
1010 Ga0466963_0654817 3300044694 Bacteria 741
1011 Ga0466963_0836227 3300044694 Bacteria 649
1012 Ga0466963_1054582 3300044694 Bacteria 572
1013 Ga0466964_0005428 3300044706 Bacteria 4731
1014 Ga0466964_0128129 3300044706 Bacteria 1152
1015 Ga0466964_0209127 3300044706 Bacteria 941
1016 Ga0466971_0072817 3300044719 Bacteria 1561
1017 Ga0466971_0448265 3300044719 Bacteria 633
1018 Ga0466970_0083348 3300044765 Bacteria 1730
1019 Ga0466957_0069577 3300044842 Bacteria 2174
1020 Ga0466957_0074010 3300044842 Bacteria 2112
1021 Ga0466957_0363069 3300044842 Bacteria 984
1022 Ga0466957_0369621 3300044842 Bacteria 976
1023 Ga0466957_0424808 3300044842 Bacteria 912
1024 Ga0466957_0447947 3300044842 Bacteria 889
1025 Ga0466960_0213003 3300044901 Bacteria 1060
1026 Ga0466960_0325042 3300044901 Bacteria 872
1027 Ga0466959_0009367 3300045049 Bacteria 6961
1028 Ga0466959_0077533 3300045049 Bacteria 2398
1029 Ga0466959_0115486 3300045049 Bacteria 1912
1030 Ga0451576_0067477 3300045051 Bacteria 3724
1031 Ga0451576_0314601 3300045051 Bacteria 1638
1032 Ga0451576_0627749 3300045051 Bacteria 1129
1033 Ga0451576_1212771 3300045051 Unclassified 788
1034 Ga0451576_1432563 3300045051 Unclassified 718
1035 Ga0451576_2669723 3300045051 Bacteria 509
1036 Ga0466958_0007119 3300045836 Bacteria 6127
1037 Ga0466958_0149582 3300045836 Bacteria 1472
1038 Ga0466958_0373963 3300045836 Unclassified 918
1039 Ga0466967_0002999 3300045976 Bacteria 10818
1040 Ga0466967_0015237 3300045976 Bacteria 6022
1041 Ga0466967_0033741 3300045976 Bacteria 4336
1042 Ga0466967_0082194 3300045976 Bacteria 2910
1043 Ga0466967_0094907 3300045976 Bacteria 2717
1044 Ga0466967_0100594 3300045976 Bacteria 2641
1045 Ga0466967_0214709 3300045976 Bacteria 1826
1046 Ga0466967_0245844 3300045976 Bacteria 1707
1047 Ga0466967_0249885 3300045976 Bacteria 1694
1048 Ga0466967_0252482 3300045976 Bacteria 1685
1049 Ga0466967_0270342 3300045976 Bacteria 1629
1050 Ga0466967_0464003 3300045976 Bacteria 1239
1051 Ga0466967_0620458 3300045976 Bacteria 1068
1052 Ga0466967_0717845 3300045976 Bacteria 990
1053 Ga0466967_1014816 3300045976 Bacteria 826
1054 Ga0466967_1302180 3300045976 Bacteria 724
1055 Ga0466967_1331200 3300045976 Bacteria 715
1056 Ga0466967_1454907 3300045976 Bacteria 682
1057 Ga0466967_1531729 3300045976 Bacteria 664
1058 Ga0466967_1761242 3300045976 Bacteria 617
1059 Ga0466967_1993530 3300045976 Bacteria 577
1060 Ga0466967_2428123 3300045976 Bacteria 519
1061 Ga0495592_0083218 3300046454 Bacteria 2311
1062 Ga0495592_0098966 3300046454 Bacteria 2081
1063 Ga0495592_0145270 3300046454 Bacteria 1645
1064 Ga0495592_0295010 3300046454 Bacteria 1056
1065 Ga0495592_0821403 3300046454 Unclassified 551
1066 Ga0495603_0041158 3300046455 Bacteria 2764
1067 Ga0495603_0166592 3300046455 Bacteria 1277
1068 Ga0495603_0468236 3300046455 Bacteria 722
1069 Ga0495603_0535410 3300046455 Bacteria 671
1070 Ga0495629_0003081 3300046459 Bacteria 12650
1071 Ga0495629_0302462 3300046459 Bacteria 1095
1072 Ga0495629_0944248 3300046459 Bacteria 564
1073 Ga0495641_0000633 3300046461 Bacteria 29676
1074 Ga0495641_0036815 3300046461 Bacteria 2297
1075 Ga0495641_0116005 3300046461 Bacteria 1194
1076 Ga0495641_0485116 3300046461 Bacteria 563
1077 Ga0495641_0538529 3300046461 Bacteria 533
1078 Ga0495651_0037339 3300046462 Bacteria 3782
1079 Ga0495651_0115497 3300046462 Bacteria 1979
1080 Ga0495651_0189718 3300046462 Bacteria 1447
1081 Ga0495651_0199357 3300046462 Bacteria 1402
1082 Ga0495653_0038942 3300046463 Bacteria 3728
1083 Ga0495653_0047895 3300046463 Bacteria 3304
1084 Ga0495653_0075718 3300046463 Bacteria 2504
1085 Ga0495653_0203238 3300046463 Bacteria 1343
1086 Ga0495653_0207628 3300046463 Bacteria 1325
1087 Ga0495653_0337490 3300046463 Bacteria 972
1088 Ga0495653_0558759 3300046463 Unclassified 707
1089 Ga0495580_0462080 3300046472 Bacteria 851
1090 Ga0495582_0006691 3300046473 Bacteria 6402
1091 Ga0495582_0040170 3300046473 Bacteria 2576
1092 Ga0495582_0149757 3300046473 Unclassified 1324
1093 Ga0495582_0173535 3300046473 Bacteria 1228
1094 Ga0495582_0188318 3300046473 Unclassified 1177
1095 Ga0495582_0236691 3300046473 Bacteria 1046
1096 Ga0495582_0318876 3300046473 Bacteria 894
1097 Ga0495582_0455130 3300046473 Bacteria 739
1098 Ga0495582_0693094 3300046473 Bacteria 589
1099 Ga0495582_0782298 3300046473 Bacteria 552
1100 Ga0495605_0061224 3300046474 Bacteria 1802
1101 Ga0495639_0000351 3300046475 Bacteria 22247
1102 Ga0495639_0117194 3300046475 Bacteria 1268
1103 Ga0495662_0259121 3300046476 Bacteria 856
1104 Ga0495662_0354015 3300046476 Bacteria 722
1105 Ga0495662_0579057 3300046476 Unclassified 549
1106 Ga0495664_0198759 3300046477 Bacteria 1215
1107 Ga0495664_0337192 3300046477 Bacteria 909
1108 Ga0495664_0497468 3300046477 Bacteria 728
1109 Ga0495584_0100617 3300046491 Bacteria 1461
1110 Ga0495584_0535936 3300046491 Bacteria 597
1111 Ga0495607_0506108 3300046501 Bacteria 535
1112 Ga0495608_0043582 3300046511 Bacteria 2998
1113 Ga0495608_0223208 3300046511 Bacteria 1181
1114 Ga0495608_0460377 3300046511 Bacteria 773
1115 Ga0495618_0069406 3300046514 Bacteria 2241
1116 Ga0495618_0086481 3300046514 Bacteria 2004
1117 Ga0495618_0124447 3300046514 Bacteria 1651
1118 Ga0495618_0322057 3300046514 Bacteria 957
1119 Ga0495618_0658366 3300046514 Bacteria 619
1120 Ga0495628_0206062 3300046516 Bacteria 1480
1121 Ga0495628_0421922 3300046516 Bacteria 972
1122 Ga0495628_0427578 3300046516 Bacteria 964
1123 Ga0495628_0611683 3300046516 Bacteria 777
1124 Ga0495628_0687056 3300046516 Bacteria 724
1125 Ga0495630_0006233 3300046517 Bacteria 8463
1126 Ga0495630_0017976 3300046517 Bacteria 5188
1127 Ga0495630_0115386 3300046517 Bacteria 2035
1128 Ga0495630_0195661 3300046517 Bacteria 1542
1129 Ga0495630_0352818 3300046517 Bacteria 1126
1130 Ga0495630_0444676 3300046517 Bacteria 993
1131 Ga0495630_0497595 3300046517 Bacteria 935
1132 Ga0495630_1393677 3300046517 Bacteria 527
1133 Ga0495631_0177510 3300046518 Bacteria 913
1134 Ga0495666_0037233 3300046526 Bacteria 2367
1135 Ga0495642_0394500 3300046528 Unclassified 610
1136 Ga0495652_0020964 3300046529 Bacteria 5808
1137 Ga0495652_0153521 3300046529 Bacteria 1796
1138 Ga0495652_0201844 3300046529 Bacteria 1508
1139 Ga0495652_0597223 3300046529 Bacteria 753
1140 Ga0495652_0810157 3300046529 Unclassified 623
1141 Ga0495665_0000274 3300046531 Bacteria 26250
1142 Ga0495665_0091015 3300046531 Bacteria 1603
1143 Ga0495665_0184329 3300046531 Unclassified 1084
1144 Ga0495640_0027257 3300046533 Bacteria 4122
1145 Ga0495640_0045197 3300046533 Bacteria 3057
1146 Ga0495640_0450430 3300046533 Unclassified 786
1147 Ga0495640_0685054 3300046533 Bacteria 615
1148 Ga0495640_0890081 3300046533 Unclassified 528
1149 Ga0495586_0026693 3300046535 Bacteria 3091
1150 Ga0495586_0303698 3300046535 Bacteria 914
1151 Ga0495586_0593319 3300046535 Bacteria 640
1152 Ga0495587_0073386 3300046536 Bacteria 1988
1153 Ga0495587_0128420 3300046536 Bacteria 1449
1154 Ga0495587_0180984 3300046536 Bacteria 1195
1155 Ga0495587_0640534 3300046536 Bacteria 584
1156 Ga0495645_0101193 3300046543 Bacteria 2049
1157 Ga0495645_0110155 3300046543 Bacteria 1949
1158 Ga0495645_0300646 3300046543 Bacteria 1048
1159 Ga0495645_0470787 3300046543 Bacteria 790
1160 Ga0495645_0949740 3300046543 Bacteria 508
1161 Ga0495622_0385052 3300046557 Bacteria 605
1162 Ga0495667_0020239 3300046559 Bacteria 4489
1163 Ga0495667_0053339 3300046559 Bacteria 2663
1164 Ga0495667_0304481 3300046559 Bacteria 1009
1165 Ga0495667_0383897 3300046559 Bacteria 886
1166 Ga0495667_0494568 3300046559 Bacteria 766
1167 Ga0495634_0088789 3300046642 Bacteria 2010
1168 Ga0495634_0113596 3300046642 Bacteria 1739
1169 Ga0495634_0141945 3300046642 Bacteria 1524
1170 Ga0495634_0341170 3300046642 Bacteria 898
1171 Ga0495634_0507097 3300046642 Bacteria 707
1172 Ga0495635_0102266 3300046663 Bacteria 1958
1173 Ga0495635_0106274 3300046663 Bacteria 1917
1174 Ga0495635_0224466 3300046663 Bacteria 1270
1175 Ga0495635_0242699 3300046663 Bacteria 1215
1176 Ga0495588_0102948 3300046674 Bacteria 1501
1177 Ga0495588_0507924 3300046674 Bacteria 632
1178 Ga0495657_0074825 3300046675 Bacteria 2203
1179 Ga0495657_0154543 3300046675 Bacteria 1423
1180 Ga0495657_0201719 3300046675 Bacteria 1212
1181 Ga0495657_0343945 3300046675 Bacteria 884
1182 Ga0495599_0104639 3300046678 Bacteria 1763
1183 Ga0495599_0146385 3300046678 Bacteria 1464
1184 Ga0495623_0133486 3300046679 Bacteria 1484
1185 Ga0495623_0135084 3300046679 Bacteria 1473
1186 Ga0495623_0511546 3300046679 Bacteria 633
1187 Ga0495646_0174185 3300046680 Bacteria 1184
1188 Ga0495646_0235876 3300046680 Bacteria 984
1189 Ga0495646_0674835 3300046680 Bacteria 521
1190 Ga0495647_0002495 3300046681 Bacteria 5827
1191 Ga0495647_0058524 3300046681 Bacteria 1515
1192 Ga0495647_0096751 3300046681 Bacteria 1217
1193 Ga0495647_0287366 3300046681 Bacteria 739
1194 Ga0495658_0000218 3300046683 Bacteria 32890
1195 Ga0495658_0042449 3300046683 Bacteria 2539
1196 Ga0495613_0016463 3300046689 Bacteria 5506
1197 Ga0495613_0056887 3300046689 Bacteria 2872
1198 Ga0495613_0265974 3300046689 Bacteria 1193
1199 Ga0495613_0329175 3300046689 Bacteria 1053
1200 Ga0495613_0447706 3300046689 Bacteria 875
1201 Ga0495613_1012431 3300046689 Bacteria 533
1202 Ga0495624_0010999 3300046690 Bacteria 6231
1203 Ga0495624_0268913 3300046690 Bacteria 1030
1204 Ga0495624_0369826 3300046690 Bacteria 862
1205 Ga0495670_0756497 3300046691 Bacteria 530
1206 Ga0495589_0065619 3300046794 Bacteria 1779
1207 Ga0495589_0180368 3300046794 Bacteria 1002
1208 Ga0495600_0054345 3300046809 Bacteria 2616
1209 Ga0495600_0178112 3300046809 Bacteria 1370
1210 Ga0495600_0291851 3300046809 Bacteria 1030
1211 Ga0495600_0729014 3300046809 Bacteria 595
1212 Ga0495581_0000117 3300047315 Bacteria 33592
1213 Ga0495581_0030544 3300047315 Bacteria 3122
1214 Ga0495581_0100129 3300047315 Bacteria 1684
1215 Ga0495581_0519088 3300047315 Bacteria 692
1216 Ga0495581_0744055 3300047315 Bacteria 564
1217 Ga0495581_0823977 3300047315 Bacteria 532
1218 Ga0495604_0663409 3300047317 Bacteria 664
1219 Ga0495604_0964513 3300047317 Bacteria 529
1220 Ga0495674_0007348 3300047319 Bacteria 10535
1221 Ga0495674_0190071 3300047319 Bacteria 1707
1222 Ga0495674_0209566 3300047319 Bacteria 1615
1223 Ga0495674_0365006 3300047319 Bacteria 1170
1224 Ga0495674_1446885 3300047319 Bacteria 510
1225 Ga0495674_1457464 3300047319 Bacteria 508
1226 Ga0495672_0188038 3300047320 Bacteria 1041
1227 Ga0495676_0003989 3300047321 Bacteria 13436
1228 Ga0495676_0056283 3300047321 Bacteria 3111
1229 Ga0495676_0127302 3300047321 Bacteria 1844
1230 Ga0495676_0167665 3300047321 Bacteria 1548
1231 Ga0495676_0192230 3300047321 Bacteria 1423
1232 Ga0495676_0359006 3300047321 Bacteria 973
1233 Ga0495676_0373417 3300047321 Bacteria 950
1234 Ga0495676_0484537 3300047321 Bacteria 813
1235 Ga0495676_0728271 3300047321 Bacteria 641
1236 Ga0495680_0002114 3300047322 Bacteria 20624
1237 Ga0495680_0028928 3300047322 Bacteria 4541
1238 Ga0495680_0056597 3300047322 Bacteria 3035
1239 Ga0495680_0085540 3300047322 Bacteria 2374
1240 Ga0495680_0118901 3300047322 Bacteria 1952
1241 Ga0495680_0272660 3300047322 Bacteria 1194
1242 Ga0495680_0539555 3300047322 Bacteria 787
1243 Ga0495680_0578331 3300047322 Bacteria 754
1244 Ga0495680_0698435 3300047322 Unclassified 670
1245 Ga0495680_0733539 3300047322 Bacteria 650
1246 Ga0495680_0911574 3300047322 Bacteria 567
1247 Ga0495675_0299760 3300047444 Bacteria 955
1248 Ga0495677_0359463 3300047445 Bacteria 575
1249 Ga0495684_0002917 3300047471 Bacteria 13461
1250 Ga0495684_0187218 3300047471 Bacteria 1532
1251 Ga0495684_0308364 3300047471 Bacteria 1135
1252 Ga0495684_0568609 3300047471 Bacteria 769
1253 Ga0495684_0617130 3300047471 Bacteria 730
1254 Ga0495684_0927921 3300047471 Bacteria 559
1255 Ga0495593_0009832 3300047673 Bacteria 5550
1256 Ga0495593_0123789 3300047673 Bacteria 1315
1257 Ga0495602_0113346 3300048088 Bacteria 2198
1258 Ga0495602_0171938 3300048088 Bacteria 1681
1259 Ga0495602_0816617 3300048088 Bacteria 625
1260 Ga0495614_0003253 3300048089 Bacteria 7256
1261 Ga0495626_0390791 3300048091 Bacteria 539
1262 Ga0496100_0008861 3300048903 Bacteria 5627
1263 Ga0496100_0012414 3300048903 Bacteria 4883
1264 Ga0496100_0015206 3300048903 Bacteria 4490
1265 Ga0496100_0043630 3300048903 Bacteria 2869
1266 Ga0496100_0080043 3300048903 Bacteria 2203
1267 Ga0496100_0227111 3300048903 Bacteria 1372
1268 Ga0496100_0322121 3300048903 Bacteria 1161
1269 Ga0496100_0741269 3300048903 Bacteria 768
1270 Ga0496100_0801187 3300048903 Bacteria 738
1271 Ga0496100_0916810 3300048903 Bacteria 688
1272 Ga0496100_1636804 3300048903 Bacteria 509
1273 Ga0496101_0000774 3300048904 Bacteria 18911
1274 Ga0496101_0016448 3300048904 Bacteria 4997
1275 Ga0496101_0066829 3300048904 Bacteria 2624
1276 Ga0496101_0067743 3300048904 Bacteria 2607
1277 Ga0496101_0078525 3300048904 Bacteria 2435
1278 Ga0496101_0100095 3300048904 Bacteria 2168
1279 Ga0496101_0198960 3300048904 Bacteria 1548
1280 Ga0496101_0251338 3300048904 Bacteria 1377
1281 Ga0496101_0339014 3300048904 Bacteria 1180
1282 Ga0496101_0448764 3300048904 Bacteria 1017
1283 Ga0496101_0471988 3300048904 Bacteria 990
1284 Ga0496101_0504421 3300048904 Bacteria 956
1285 Ga0496101_0690809 3300048904 Bacteria 806
1286 Ga0496101_1109149 3300048904 Bacteria 621
1287 Ga0496101_1122420 3300048904 Bacteria 617
1288 Ga0496101_1321149 3300048904 Unclassified 563
1289 Ga0496101_1322007 3300048904 Bacteria 563
1290 Ga0496102_0005009 3300048905 Bacteria 11225
1291 Ga0496102_0005080 3300048905 Bacteria 11145
1292 Ga0496102_0013886 3300048905 Bacteria 6988
1293 Ga0496102_0016329 3300048905 Bacteria 6485
1294 Ga0496102_0229786 3300048905 Bacteria 1749
1295 Ga0496102_0322552 3300048905 Bacteria 1455
1296 Ga0496102_0370947 3300048905 Bacteria 1347
1297 Ga0496102_0392899 3300048905 Bacteria 1304
1298 Ga0496102_0423051 3300048905 Bacteria 1251
1299 Ga0496102_0448481 3300048905 Bacteria 1210
1300 Ga0496102_0554996 3300048905 Bacteria 1071
1301 Ga0496102_1074585 3300048905 Bacteria 725
1302 Ga0496102_1394655 3300048905 Bacteria 620
1303 Ga0496102_1477600 3300048905 Bacteria 598
1304 Ga0496102_1647773 3300048905 Bacteria 560
1305 Ga0496103_0019716 3300048906 Bacteria 4048
1306 Ga0496103_0024235 3300048906 Bacteria 3661
1307 Ga0496103_0080336 3300048906 Bacteria 2050
1308 Ga0496103_0160212 3300048906 Bacteria 1443
1309 Ga0496103_0296573 3300048906 Bacteria 1040
1310 Ga0496103_0381694 3300048906 Bacteria 905
1311 Ga0496103_0482060 3300048906 Bacteria 794
1312 Ga0496103_0579918 3300048906 Bacteria 715
1313 Ga0496103_0586930 3300048906 Unclassified 710
1314 Ga0496104_0000803 3300048907 Bacteria 27008
1315 Ga0496104_0000834 3300048907 Bacteria 26610
1316 Ga0496104_0009234 3300048907 Bacteria 8768
1317 Ga0496104_0037070 3300048907 Bacteria 4559
1318 Ga0496104_0050328 3300048907 Bacteria 3931
1319 Ga0496104_0056772 3300048907 Bacteria 3704
1320 Ga0496104_0073268 3300048907 Bacteria 3258
1321 Ga0496104_0093602 3300048907 Bacteria 2874
1322 Ga0496104_0121706 3300048907 Bacteria 2506
1323 Ga0496104_0158295 3300048907 Bacteria 2173
1324 Ga0496104_0196231 3300048907 Bacteria 1931
1325 Ga0496104_0210803 3300048907 Bacteria 1854
1326 Ga0496104_0934356 3300048907 Bacteria 772
1327 Ga0496104_1224720 3300048907 Bacteria 654
1328 Ga0496104_1638948 3300048907 Bacteria 546
1329 Ga0496104_1709398 3300048907 Bacteria 532
1330 Ga0496104_1779776 3300048907 Bacteria 518
1331 Ga0496104_1815606 3300048907 Unclassified 512
1332 Ga0496105_0001655 3300048908 Bacteria 15880
1333 Ga0496105_0003459 3300048908 Bacteria 11682
1334 Ga0496105_0008010 3300048908 Bacteria 8209
1335 Ga0496105_0008029 3300048908 Bacteria 8199
1336 Ga0496105_0056857 3300048908 Bacteria 3229
1337 Ga0496105_0097749 3300048908 Bacteria 2425
1338 Ga0496105_0190531 3300048908 Bacteria 1677
1339 Ga0496105_0837569 3300048908 Bacteria 697
1340 Ga0496106_0016392 3300048909 Bacteria 5482
1341 Ga0496106_0023552 3300048909 Bacteria 4573
1342 Ga0496106_0025035 3300048909 Bacteria 4440
1343 Ga0496106_0120202 3300048909 Bacteria 2053
1344 Ga0496106_0195849 3300048909 Bacteria 1607
1345 Ga0496106_0289690 3300048909 Bacteria 1313
1346 Ga0496106_0483978 3300048909 Unclassified 994
1347 Ga0496106_0632052 3300048909 Bacteria 856
1348 Ga0496106_0685953 3300048909 Bacteria 817
1349 Ga0496106_0932676 3300048909 Bacteria 684
1350 Ga0496106_1089877 3300048909 Unclassified 626
1351 Ga0496107_0005156 3300048910 Bacteria 8918
1352 Ga0496107_0026047 3300048910 Bacteria 4144
1353 Ga0496107_0050182 3300048910 Bacteria 3007
1354 Ga0496107_0060190 3300048910 Bacteria 2748
1355 Ga0496107_0106284 3300048910 Bacteria 2061
1356 Ga0496107_0145834 3300048910 Bacteria 1750
1357 Ga0496107_0256787 3300048910 Bacteria 1301
1358 Ga0496107_0293929 3300048910 Bacteria 1209
1359 Ga0496107_0578388 3300048910 Bacteria 831
1360 Ga0496107_0725150 3300048910 Bacteria 730
1361 Ga0496108_0008538 3300048911 Bacteria 8308
1362 Ga0496108_0028731 3300048911 Bacteria 4602
1363 Ga0496108_0156093 3300048911 Bacteria 1971
1364 Ga0496108_0232982 3300048911 Bacteria 1601
1365 Ga0496108_0266993 3300048911 Bacteria 1489
1366 Ga0496108_0386988 3300048911 Bacteria 1221
1367 Ga0496108_0404181 3300048911 Bacteria 1193
1368 Ga0496108_0421697 3300048911 Bacteria 1165
1369 Ga0496108_0488623 3300048911 Bacteria 1075
1370 Ga0496108_0568297 3300048911 Bacteria 989
1371 Ga0496108_1698506 3300048911 Bacteria 520
1372 Ga0496109_0000662 3300048912 Bacteria 28563
1373 Ga0496109_0017634 3300048912 Bacteria 6261
1374 Ga0496109_0018180 3300048912 Bacteria 6172
1375 Ga0496109_0044381 3300048912 Bacteria 4032
1376 Ga0496109_0083893 3300048912 Bacteria 2939
1377 Ga0496109_0085004 3300048912 Bacteria 2920
1378 Ga0496109_0161105 3300048912 Bacteria 2102
1379 Ga0496109_0260103 3300048912 Bacteria 1635
1380 Ga0496109_0266739 3300048912 Bacteria 1613
1381 Ga0496109_0368815 3300048912 Bacteria 1356
1382 Ga0496109_0437280 3300048912 Bacteria 1236
1383 Ga0496109_0495702 3300048912 Bacteria 1153
1384 Ga0496109_0846638 3300048912 Bacteria 852
1385 Ga0496109_0861504 3300048912 Bacteria 844
1386 Ga0496109_0872147 3300048912 Bacteria 838
1387 Ga0496109_0901169 3300048912 Bacteria 822
1388 Ga0496109_1151034 3300048912 Unclassified 713
1389 Ga0496109_1337083 3300048912 Bacteria 652
1390 Ga0496109_1498244 3300048912 Bacteria 609
1391 Ga0496110_0000069 3300048913 Bacteria 51597
1392 Ga0496110_0014207 3300048913 Bacteria 6606
1393 Ga0496110_0029772 3300048913 Bacteria 4703
1394 Ga0496110_0040288 3300048913 Bacteria 4071
1395 Ga0496110_0188614 3300048913 Bacteria 1872
1396 Ga0496110_0232339 3300048913 Bacteria 1677
1397 Ga0496110_0351936 3300048913 Unclassified 1342
1398 Ga0496110_0841688 3300048913 Unclassified 823
1399 Ga0496110_1132344 3300048913 Bacteria 691
1400 Ga0496110_1186462 3300048913 Unclassified 672
1401 Ga0496110_1246012 3300048913 Unclassified 653
1402 Ga0496110_1342106 3300048913 Unclassified 624
1403 Ga0496110_1360350 3300048913 Unclassified 619
1404 Ga0496110_1870770 3300048913 Bacteria 510
1405 Ga0496111_0001848 3300048914 Bacteria 12482
1406 Ga0496111_0017317 3300048914 Bacteria 4981
1407 Ga0496111_0038999 3300048914 Bacteria 3404
1408 Ga0496111_0161028 3300048914 Bacteria 1666
1409 Ga0496111_0168370 3300048914 Bacteria 1628
1410 Ga0496111_0313610 3300048914 Bacteria 1162
1411 Ga0496111_0317922 3300048914 Unclassified 1153
1412 Ga0496111_0329927 3300048914 Bacteria 1130
1413 Ga0496111_0335683 3300048914 Bacteria 1119
1414 Ga0496111_0506469 3300048914 Bacteria 888
1415 Ga0496111_1013883 3300048914 Bacteria 594
1416 Ga0496112_0017461 3300048915 Bacteria 6741
1417 Ga0496112_0021394 3300048915 Bacteria 6151
1418 Ga0496112_0038819 3300048915 Bacteria 4651
1419 Ga0496112_0052884 3300048915 Bacteria 3987
1420 Ga0496112_0104501 3300048915 Bacteria 2802
1421 Ga0496112_0189081 3300048915 Bacteria 2022
1422 Ga0496112_0214367 3300048915 Bacteria 1882
1423 Ga0496112_0319550 3300048915 Bacteria 1497
1424 Ga0496112_0430227 3300048915 Bacteria 1258
1425 Ga0496112_0440026 3300048915 Bacteria 1242
1426 Ga0496112_0554556 3300048915 Unclassified 1083
1427 Ga0496112_0746635 3300048915 Unclassified 905
1428 Ga0496112_0791987 3300048915 Bacteria 873
1429 Ga0496112_0909601 3300048915 Bacteria 802
1430 Ga0496112_1036516 3300048915 Bacteria 740
1431 Ga0496112_1102623 3300048915 Bacteria 712
1432 Ga0496112_1517643 3300048915 Bacteria 584
1433 Ga0496113_0009763 3300048916 Bacteria 6309
1434 Ga0496113_0034278 3300048916 Bacteria 3703
1435 Ga0496113_0363612 3300048916 Bacteria 1161
1436 Ga0496113_0440316 3300048916 Unclassified 1047
1437 Ga0496113_0444733 3300048916 Bacteria 1041
1438 Ga0496113_0760776 3300048916 Bacteria 771
1439 Ga0496113_0917667 3300048916 Bacteria 692
1440 Ga0496114_0000177 3300048917 Bacteria 45143
1441 Ga0496114_0003444 3300048917 Bacteria 12139
1442 Ga0496114_0006208 3300048917 Bacteria 9411
1443 Ga0496114_0007730 3300048917 Bacteria 8506
1444 Ga0496114_0022772 3300048917 Bacteria 5107
1445 Ga0496114_0025184 3300048917 Bacteria 4861
1446 Ga0496114_0039017 3300048917 Bacteria 3930
1447 Ga0496114_0084964 3300048917 Bacteria 2680
1448 Ga0496114_0183777 3300048917 Bacteria 1826
1449 Ga0496114_0323055 3300048917 Bacteria 1364
1450 Ga0496114_0533941 3300048917 Bacteria 1037
1451 Ga0496114_0539720 3300048917 Bacteria 1031
1452 Ga0496114_0667221 3300048917 Bacteria 914
1453 Ga0496114_1052828 3300048917 Bacteria 698
1454 Ga0496114_1313675 3300048917 Bacteria 610
1455 Ga0496114_1760090 3300048917 Bacteria 508
1456 Ga0496115_0004484 3300048918 Bacteria 10106
1457 Ga0496115_0021250 3300048918 Bacteria 5012
1458 Ga0496115_0034495 3300048918 Bacteria 3999
1459 Ga0496115_0041294 3300048918 Bacteria 3670
1460 Ga0496115_0206274 3300048918 Bacteria 1623
1461 Ga0496115_0217972 3300048918 Bacteria 1575
1462 Ga0496115_0323409 3300048918 Bacteria 1261
1463 Ga0496115_0392340 3300048918 Bacteria 1127
1464 Ga0496115_0406076 3300048918 Bacteria 1105
1465 Ga0496115_0440706 3300048918 Bacteria 1053
1466 Ga0496115_0698538 3300048918 Bacteria 798
1467 Ga0496126_0063511 3300048929 Bacteria 3310
1468 Ga0501031_0097225 3300049568 Bacteria 1921
1469 Ga0501031_0109728 3300049568 Bacteria 1802
1470 Ga0501032_0058429 3300049569 Bacteria 2589
1471 Ga0501033_0175177 3300049570 Bacteria 1539
1472 Ga0501034_0043367 3300049571 Bacteria 4553
1473 Ga0501034_0234567 3300049571 Bacteria 1783
1474 Ga0501034_0239056 3300049571 Bacteria 1763
1475 Ga0501034_0374545 3300049571 Bacteria 1349
1476 Ga0501034_1212782 3300049571 Bacteria 633
1477 Ga0501036_0046169 3300049572 Bacteria 3688
1478 Ga0501036_0397757 3300049572 Bacteria 1149
1479 Ga0501037_0002196 3300049573 Bacteria 14103
1480 Ga0501038_0004561 3300049574 Bacteria 12892
1481 Ga0501038_0702656 3300049574 Bacteria 757
1482 Ga0501039_0002890 3300049575 Bacteria 12850
1483 Ga0501039_0603900 3300049575 Bacteria 860
1484 Ga0501039_0645485 3300049575 Bacteria 829
1485 Ga0501039_1306563 3300049575 Bacteria 559
1486 Ga0501039_1559927 3300049575 Bacteria 507
1487 Ga0501040_0328055 3300049576 Bacteria 1095
1488 Ga0501040_0423831 3300049576 Bacteria 956
1489 Ga0501041_0009319 3300049577 Bacteria 5781
1490 Ga0501042_0003028 3300049578 Bacteria 10454
1491 Ga0501042_0029232 3300049578 Bacteria 3887
1492 Ga0501042_1119269 3300049578 Bacteria 574
1493 Ga0501043_0213925 3300049579 Bacteria 1493
1494 Ga0501046_0003989 3300049580 Bacteria 13478
1495 Ga0501046_0347856 3300049580 Bacteria 1077
1496 Ga0501047_0014902 3300049581 Bacteria 7400
1497 Ga0501047_0050531 3300049581 Bacteria 4016
1498 Ga0501047_0105147 3300049581 Bacteria 2703
1499 Ga0501047_0334077 3300049581 Bacteria 1354
1500 Ga0501047_0381418 3300049581 Bacteria 1244
1501 Ga0501048_0035439 3300049582 Bacteria 3592
1502 Ga0501048_0204753 3300049582 Bacteria 1399
1503 Ga0501048_0243506 3300049582 Bacteria 1276
1504 Ga0501048_0272308 3300049582 Bacteria 1203
1505 Ga0501048_0354646 3300049582 Bacteria 1046
1506 Ga0501048_0379767 3300049582 Bacteria 1009
1507 Ga0501067_0001112 3300049583 Bacteria 14540
1508 Ga0501067_0041559 3300049583 Bacteria 2553
1509 Ga0501067_0171670 3300049583 Bacteria 1208
1510 Ga0501067_0328719 3300049583 Bacteria 851
1511 Ga0501067_0346882 3300049583 Unclassified 827
1512 Ga0501067_0533957 3300049583 Bacteria 657
1513 Ga0501068_0096407 3300049584 Bacteria 1829
1514 Ga0501068_0107623 3300049584 Bacteria 1732
1515 Ga0501068_0151614 3300049584 Bacteria 1457
1516 Ga0501068_0203766 3300049584 Bacteria 1255
1517 Ga0501068_0863269 3300049584 Bacteria 595
1518 Ga0501069_0028629 3300049585 Bacteria 3056
1519 Ga0501069_0036011 3300049585 Bacteria 2727
1520 Ga0501069_0036300 3300049585 Bacteria 2718
1521 Ga0501069_0061247 3300049585 Bacteria 2101
1522 Ga0501069_0134625 3300049585 Bacteria 1416
1523 Ga0501069_0393449 3300049585 Bacteria 820
1524 Ga0501070_0001108 3300049586 Bacteria 24175
1525 Ga0501070_0047423 3300049586 Bacteria 3570
1526 Ga0501070_0089620 3300049586 Bacteria 2545
1527 Ga0501070_0337110 3300049586 Bacteria 1225
1528 Ga0501070_0355315 3300049586 Bacteria 1189
1529 Ga0501070_0587494 3300049586 Bacteria 889
1530 Ga0501070_0636711 3300049586 Bacteria 847
1531 Ga0501070_0707126 3300049586 Bacteria 796
1532 Ga0501070_0707206 3300049586 Bacteria 796
1533 Ga0501070_0768185 3300049586 Bacteria 758
1534 Ga0501070_0900128 3300049586 Bacteria 690
1535 Ga0501070_1489063 3300049586 Bacteria 512
1536 Ga0501071_0091668 3300049587 Bacteria 2233
1537 Ga0501071_0148685 3300049587 Bacteria 1746
1538 Ga0501071_0731814 3300049587 Bacteria 762
1539 Ga0501071_0798310 3300049587 Bacteria 728
1540 Ga0501071_1144821 3300049587 Bacteria 601
1541 Ga0501071_1441017 3300049587 Bacteria 532
1542 Ga0501072_0075260 3300049588 Bacteria 2670
1543 Ga0501072_0104145 3300049588 Bacteria 2256
1544 Ga0501072_0105922 3300049588 Bacteria 2236
1545 Ga0501072_0180135 3300049588 Bacteria 1685
1546 Ga0501072_0261592 3300049588 Bacteria 1377
1547 Ga0501072_0890446 3300049588 Bacteria 695
1548 Ga0501072_1438287 3300049588 Bacteria 533
1549 Ga0501073_0014387 3300049589 Bacteria 5750
1550 Ga0501073_0184925 3300049589 Bacteria 1442
1551 Ga0501074_0015093 3300049590 Bacteria 5618
1552 Ga0501074_0022353 3300049590 Bacteria 4593
1553 Ga0501074_0050711 3300049590 Bacteria 2996
1554 Ga0501074_0143876 3300049590 Bacteria 1705
1555 Ga0501074_0276547 3300049590 Bacteria 1194
1556 Ga0501074_0334296 3300049590 Bacteria 1075
1557 Ga0501074_0456000 3300049590 Unclassified 906
1558 Ga0501074_0709564 3300049590 Bacteria 710
1559 Ga0501074_1099317 3300049590 Bacteria 558
1560 Ga0501074_1317445 3300049590 Bacteria 506
1561 Ga0501075_0037857 3300049591 Bacteria 3605
1562 Ga0501075_0351437 3300049591 Bacteria 1123
1563 Ga0501076_0226794 3300049592 Bacteria 1527
1564 Ga0501076_0264852 3300049592 Bacteria 1407
1565 Ga0501076_0268964 3300049592 Bacteria 1396
1566 Ga0501076_0544980 3300049592 Bacteria 956
1567 Ga0501076_1350765 3300049592 Bacteria 586
1568 Ga0501077_0046450 3300049593 Bacteria 2758
1569 Ga0501077_0568727 3300049593 Bacteria 728
1570 Ga0501079_0085333 3300049741 Bacteria 2443
1571 Ga0501079_0434910 3300049741 Bacteria 1030
1572 Ga0501079_0522377 3300049741 Unclassified 933
1573 Ga0501079_0558213 3300049741 Bacteria 901
1574 Ga0501079_1180197 3300049741 Bacteria 603
1575 Ga0501079_1353953 3300049741 Bacteria 560
1576 Ga0501079_1443228 3300049741 Bacteria 541
1577 Ga0501080_0297462 3300049742 Unclassified 1464
1578 Ga0501080_0298842 3300049742 Bacteria 1460
1579 Ga0501080_0668608 3300049742 Bacteria 918
1580 Ga0501080_1203262 3300049742 Bacteria 651
1581 Ga0501081_0140264 3300049743 Bacteria 1732
1582 Ga0501081_0324205 3300049743 Bacteria 1132
1583 Ga0501081_0586203 3300049743 Bacteria 834
1584 Ga0501081_0813052 3300049743 Bacteria 704
1585 Ga0501083_0009596 3300049744 Bacteria 6837
1586 Ga0501083_0216274 3300049744 Bacteria 1249
1587 Ga0501035_0014222 3300049822 Bacteria 7344
1588 Ga0501035_0099622 3300049822 Bacteria 2551
1589 Ga0501035_0753811 3300049822 Bacteria 781
1590 Ga0501035_0781140 3300049822 Bacteria 764
1591 Ga0501035_0983084 3300049822 Unclassified 664
1592 Ga0501044_0150079 3300049823 Bacteria 2314
1593 Ga0501044_0257548 3300049823 Bacteria 1684
1594 Ga0501044_0298198 3300049823 Bacteria 1541
1595 Ga0501044_0699554 3300049823 Unclassified 899
1596 Ga0501045_0056450 3300049824 Bacteria 2872
1597 Ga0501045_0135811 3300049824 Bacteria 1828
1598 Ga0501045_0423268 3300049824 Bacteria 991
1599 Ga0501045_0606227 3300049824 Bacteria 811
1600 Ga0501045_0806712 3300049824 Bacteria 691
1601 nmdc:mga03n38_19541_c1 3300050490 Bacteria 2694
1602 nmdc:mga03n38_359862_c1 3300050490 Unclassified 793
1603 nmdc:mga03n38_660808_c1 3300050490 Bacteria 600
1604 nmdc:mga03n38_920297_c1 3300050490 Bacteria 515
1605 nmdc:mga00v17_104808_c1 3300050491 Bacteria 1788
1606 nmdc:mga00v17_175639_c1 3300050491 Bacteria 1381
1607 nmdc:mga00v17_512886_c1 3300050491 Bacteria 777
1608 nmdc:mga00v17_664403_c1 3300050491 Bacteria 670
1609 nmdc:mga0yw44_1082905_c1 3300050492 Bacteria 542
1610 nmdc:mga0yw44_181418_c1 3300050492 Bacteria 1386
1611 nmdc:mga0yw44_34341_c1 3300050492 Bacteria 2971
1612 nmdc:mga0yw44_374788_c2 3300050492 Bacteria 515
1613 nmdc:mga0yw44_44835_c1 3300050492 Bacteria 2647
1614 nmdc:mga0yw44_63638_c1 3300050492 Bacteria 2269
1615 nmdc:mga0yw44_68966_c1 3300050492 Bacteria 2189
1616 nmdc:mga06z11_411288_c1 3300050494 Bacteria 815
1617 nmdc:mga04h51_519406_c1 3300050495 Bacteria 510
1618 nmdc:mga05p37_105493_c1 3300050507 Bacteria 3467
1619 nmdc:mga05p37_111967_c1 3300050507 Bacteria 3356
1620 nmdc:mga05p37_1409376_c1 3300050507 Bacteria 701
1621 nmdc:mga05p37_14698_c1 3300050507 Bacteria 9405
1622 nmdc:mga05p37_2063916_c1 3300050507 Bacteria 536
1623 nmdc:mga05p37_362980_c1 3300050507 Bacteria 1702
1624 nmdc:mga05p37_442600_c1 3300050507 Bacteria 1507
1625 nmdc:mga05p37_588374_c1 3300050507 Bacteria 1259
1626 nmdc:mga05p37_929984_c1 3300050507 Bacteria 933
1627 nmdc:mga09592_146966_c1 3300050508 Bacteria 2032
1628 nmdc:mga09592_76757_c1 3300050508 Bacteria 2842
1629 nmdc:mga0qj67_186461_c1 3300050509 Bacteria 1685
1630 nmdc:mga0qj67_196817_c1 3300050509 Bacteria 1638
1631 nmdc:mga0qj67_38708_c1 3300050509 Bacteria 3742
1632 nmdc:mga0qj67_473644_c1 3300050509 Unclassified 1008
1633 nmdc:mga0qj67_856696_c1 3300050509 Bacteria 717
1634 nmdc:mga06r32_103701_c1 3300050510 Bacteria 2793
1635 nmdc:mga06r32_18667_c1 3300050510 Bacteria 6353
1636 nmdc:mga06r32_323513_c1 3300050510 Bacteria 1527
1637 nmdc:mga06r32_546407_c1 3300050510 Bacteria 1133
1638 nmdc:mga08y16_1030518_c1 3300050511 Bacteria 801
1639 nmdc:mga08y16_1428637_c1 3300050511 Bacteria 654
1640 nmdc:mga08y16_209939_c1 3300050511 Bacteria 2017
1641 nmdc:mga08y16_237134_c1 3300050511 Bacteria 1886
1642 nmdc:mga08y16_411885_c1 3300050511 Bacteria 1382
1643 nmdc:mga08y16_62297_c1 3300050511 Bacteria 3895
1644 nmdc:mga08y16_639110_c1 3300050511 Bacteria 1069
1645 nmdc:mga08y16_832893_c1 3300050511 Bacteria 913
1646 nmdc:mga08y16_8939_c1 3300050511 Bacteria 10518
1647 nmdc:mga0n895_18177_c1 3300050512 Bacteria 6499
1648 nmdc:mga0n895_2225569_c1 3300050512 Bacteria 503
1649 nmdc:mga0n895_414462_c1 3300050512 Bacteria 1362
1650 nmdc:mga0n895_81104_c1 3300050512 Bacteria 3233
1651 nmdc:mga0rr50_1442544_c1 3300050513 Bacteria 582
1652 nmdc:mga08x19_355533_c1 3300050514 Bacteria 1023
1653 nmdc:mga0a205_192468_c1 3300050515 Bacteria 1931
1654 nmdc:mga0a205_325223_c1 3300050515 Bacteria 1408
1655 nmdc:mga0a205_33197_c1 3300050515 Bacteria 4949
1656 nmdc:mga0a205_381758_c1 3300050515 Bacteria 1274
1657 Ga0495601_0023145 3300053077 Bacteria 3816
1658 Ga0495601_0116999 3300053077 Bacteria 1729
1659 Ga0495601_0175539 3300053077 Bacteria 1401
1660 Ga0495601_0396108 3300053077 Bacteria 895
1661 Ga0495601_0730073 3300053077 Bacteria 631
1662 Ga0495601_0802361 3300053077 Bacteria 597
1663 Ga0495612_0056999 3300053078 Bacteria 1613
1664 Ga0495612_0179807 3300053078 Bacteria 929
1665 Ga0495612_0476595 3300053078 Bacteria 571
1666 Ga0495655_0017809 3300053083 Bacteria 1553
1667 Ga0495595_0025212 3300053084 Bacteria 2633
1668 Ga0495595_0035718 3300053084 Bacteria 2252
1669 Ga0495595_0056014 3300053084 Bacteria 1836
1670 Ga0495595_0105302 3300053084 Bacteria 1364
1671 Ga0495595_0534190 3300053084 Bacteria 598
1672 Ga0495619_0026945 3300053085 Bacteria 3701
1673 Ga0495619_0110205 3300053085 Bacteria 1880
1674 Ga0495619_0272906 3300053085 Bacteria 1172
1675 Ga0495619_0931100 3300053085 Bacteria 583
1676 Ga0495619_0978284 3300053085 Bacteria 567
1677 Ga0501084_0046615 3300054114 Bacteria 3631
1678 Ga0501084_0313361 3300054114 Bacteria 1325
1679 Ga0501084_0494523 3300054114 Bacteria 1034
1680 Ga0501084_0593404 3300054114 Bacteria 936
1681 Ga0501084_0633608 3300054114 Bacteria 903
1682 Ga0587128_163635 3300059630 Unclassified 515
1683 Ga0501082_0082418 3300060353 Bacteria 2775
1684 Ga0501082_0512996 3300060353 Bacteria 1048
1685 Ga0501082_1100672 3300060353 Bacteria 694
1686 Ga0501082_1709425 3300060353 Bacteria 549
1687 Ga0466962_0672460 3300061719 Bacteria 530
1688 Ga0530510_0053366 3300061734 Bacteria 2921
1689 Ga0530510_0125374 3300061734 Bacteria 1887
1690 Ga0530510_0154575 3300061734 Bacteria 1695
1691 Ga0530510_0212758 3300061734 Bacteria 1436
1692 Ga0530510_0530328 3300061734 Unclassified 893
1693 Ga0530510_0818250 3300061734 Bacteria 711
1694 Ga0530510_1156555 3300061734 Bacteria 593

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006846 Ga0075430_100165699 Ga0075430_1001656991 90
2 3300009147 Ga0114129_10080885 Ga0114129_100808852 90
3 3300050507 nmdc:mga05p37_362980_c1 nmdc:mga05p37_362980_c1_315_623 90
4 3300050509 nmdc:mga0qj67_186461_c1 nmdc:mga0qj67_186461_c1_1269_1577 90
5 3300005435 Ga0070714_100499909 Ga0070714_1004999093 91
6 3300048913 Ga0496110_0232339 Ga0496110_0232339_1097_1417 91
7 3300048914 Ga0496111_0161028 Ga0496111_0161028_105_425 91
8 3300009094 Ga0111539_10259216 Ga0111539_102592162 94
9 3300050511 nmdc:mga08y16_1428637_c1 nmdc:mga08y16_1428637_c1_299_607 94
10 3300025919 Ga0207657_11237043 Ga0207657_112370432 95
11 3300002077 JGI24744J21845_10012986 JGI24744J21845_100129862 99
12 3300003203 JGI25406J46586_10240879 JGI25406J46586_102408791 99
13 3300003373 JGI25407J50210_10003996 JGI25407J50210_100039962 99
14 3300003373 JGI25407J50210_10020636 JGI25407J50210_100206362 99
15 3300003373 JGI25407J50210_10109576 JGI25407J50210_101095762 99
16 3300005327 Ga0070658_10009094 Ga0070658_100090946 99
17 3300005327 Ga0070658_10239181 Ga0070658_102391812 99
18 3300005327 Ga0070658_11996711 Ga0070658_119967111 99
19 3300005328 Ga0070676_11146248 Ga0070676_111462482 99
20 3300005329 Ga0070683_100001123 Ga0070683_10000112317 99
21 3300005329 Ga0070683_100004023 Ga0070683_1000040235 99
22 3300005329 Ga0070683_100034459 Ga0070683_1000344593 99
23 3300005329 Ga0070683_100062160 Ga0070683_1000621602 99
24 3300005329 Ga0070683_100067109 Ga0070683_1000671094 99
25 3300005329 Ga0070683_100280663 Ga0070683_1002806632 99
26 3300005329 Ga0070683_100355630 Ga0070683_1003556302 99
27 3300005329 Ga0070683_100589516 Ga0070683_1005895162 99
28 3300005329 Ga0070683_100730677 Ga0070683_1007306772 99
29 3300005329 Ga0070683_101012100 Ga0070683_1010121002 99
30 3300005329 Ga0070683_101716411 Ga0070683_1017164112 99
31 3300005330 Ga0070690_100827125 Ga0070690_1008271252 99
32 3300005331 Ga0070670_101899389 Ga0070670_1018993892 99
33 3300005334 Ga0068869_101009118 Ga0068869_1010091182 99
34 3300005335 Ga0070666_10333780 Ga0070666_103337802 99
35 3300005336 Ga0070680_100018539 Ga0070680_1000185392 99
36 3300005336 Ga0070680_100021389 Ga0070680_1000213895 99
37 3300005336 Ga0070680_100024599 Ga0070680_1000245993 99
38 3300005336 Ga0070680_100311515 Ga0070680_1003115151 99
39 3300005337 Ga0070682_100001630 Ga0070682_1000016304 99
40 3300005337 Ga0070682_100052036 Ga0070682_1000520363 99
41 3300005337 Ga0070682_100091678 Ga0070682_1000916782 99
42 3300005337 Ga0070682_100147296 Ga0070682_1001472962 99
43 3300005337 Ga0070682_100286129 Ga0070682_1002861292 99
44 3300005338 Ga0068868_100053023 Ga0068868_1000530234 99
45 3300005338 Ga0068868_100757353 Ga0068868_1007573532 99
46 3300005338 Ga0068868_101973475 Ga0068868_1019734752 99
47 3300005339 Ga0070660_100003199 Ga0070660_1000031997 99
48 3300005339 Ga0070660_100005098 Ga0070660_1000050986 99
49 3300005339 Ga0070660_100008711 Ga0070660_1000087118 99
50 3300005339 Ga0070660_100079462 Ga0070660_1000794622 99
51 3300005339 Ga0070660_100618145 Ga0070660_1006181452 99
52 3300005339 Ga0070660_100651525 Ga0070660_1006515252 99
53 3300005340 Ga0070689_100028033 Ga0070689_1000280333 99
54 3300005341 Ga0070691_10211013 Ga0070691_102110132 99
55 3300005341 Ga0070691_10323587 Ga0070691_103235872 99
56 3300005341 Ga0070691_10352361 Ga0070691_103523611 99
57 3300005341 Ga0070691_10461164 Ga0070691_104611642 99
58 3300005341 Ga0070691_10488012 Ga0070691_104880122 99
59 3300005343 Ga0070687_100211876 Ga0070687_1002118762 99
60 3300005343 Ga0070687_100318406 Ga0070687_1003184062 99
61 3300005343 Ga0070687_100634872 Ga0070687_1006348722 99
62 3300005344 Ga0070661_100046429 Ga0070661_1000464292 99
63 3300005344 Ga0070661_100282549 Ga0070661_1002825492 99
64 3300005344 Ga0070661_100307664 Ga0070661_1003076642 99
65 3300005344 Ga0070661_100415510 Ga0070661_1004155101 99
66 3300005345 Ga0070692_10002322 Ga0070692_100023224 99
67 3300005345 Ga0070692_11382849 Ga0070692_113828491 99
68 3300005347 Ga0070668_101300407 Ga0070668_1013004071 99
69 3300005354 Ga0070675_100074000 Ga0070675_1000740003 99
70 3300005354 Ga0070675_100329239 Ga0070675_1003292392 99
71 3300005355 Ga0070671_100765365 Ga0070671_1007653652 99
72 3300005355 Ga0070671_100955729 Ga0070671_1009557292 99
73 3300005356 Ga0070674_100008484 Ga0070674_1000084845 99
74 3300005356 Ga0070674_100010597 Ga0070674_1000105973 99
75 3300005356 Ga0070674_100089321 Ga0070674_1000893212 99
76 3300005356 Ga0070674_100856364 Ga0070674_1008563642 99
77 3300005364 Ga0070673_100306823 Ga0070673_1003068232 99
78 3300005366 Ga0070659_100001554 Ga0070659_1000015549 99
79 3300005366 Ga0070659_100223056 Ga0070659_1002230562 99
80 3300005366 Ga0070659_100272729 Ga0070659_1002727292 99
81 3300005367 Ga0070667_100083412 Ga0070667_1000834122 99
82 3300005367 Ga0070667_101486210 Ga0070667_1014862101 99
83 3300005367 Ga0070667_102155342 Ga0070667_1021553422 99
84 3300005406 Ga0070703_10119468 Ga0070703_101194681 99
85 3300005406 Ga0070703_10300918 Ga0070703_103009181 99
86 3300005434 Ga0070709_10418516 Ga0070709_104185162 99
87 3300005435 Ga0070714_100224091 Ga0070714_1002240912 99
88 3300005435 Ga0070714_100532839 Ga0070714_1005328392 99
89 3300005435 Ga0070714_101026149 Ga0070714_1010261492 99
90 3300005436 Ga0070713_100704677 Ga0070713_1007046772 99
91 3300005436 Ga0070713_100955176 Ga0070713_1009551762 99
92 3300005436 Ga0070713_100969256 Ga0070713_1009692562 99
93 3300005437 Ga0070710_10738938 Ga0070710_107389382 99
94 3300005438 Ga0070701_10109397 Ga0070701_101093973 99
95 3300005438 Ga0070701_10110334 Ga0070701_101103342 99
96 3300005438 Ga0070701_10944963 Ga0070701_109449632 99
97 3300005439 Ga0070711_100511211 Ga0070711_1005112112 99
98 3300005439 Ga0070711_100851347 Ga0070711_1008513472 99
99 3300005439 Ga0070711_100908937 Ga0070711_1009089371 99
100 3300005439 Ga0070711_101331340 Ga0070711_1013313401 99
101 3300005440 Ga0070705_100211179 Ga0070705_1002111792 99
102 3300005440 Ga0070705_100392813 Ga0070705_1003928131 99
103 3300005440 Ga0070705_100753766 Ga0070705_1007537661 99
104 3300005441 Ga0070700_100005091 Ga0070700_1000050911 99
105 3300005441 Ga0070700_100020662 Ga0070700_1000206624 99
106 3300005441 Ga0070700_101530976 Ga0070700_1015309762 99
107 3300005444 Ga0070694_100696481 Ga0070694_1006964812 99
108 3300005445 Ga0070708_100061357 Ga0070708_1000613573 99
109 3300005445 Ga0070708_100235216 Ga0070708_1002352162 99
110 3300005445 Ga0070708_101470847 Ga0070708_1014708472 99
111 3300005455 Ga0070663_100021275 Ga0070663_1000212754 99
112 3300005455 Ga0070663_100437344 Ga0070663_1004373441 99
113 3300005456 Ga0070678_100000052 Ga0070678_10000005232 99
114 3300005456 Ga0070678_100347097 Ga0070678_1003470972 99
115 3300005456 Ga0070678_100412423 Ga0070678_1004124231 99
116 3300005456 Ga0070678_100535698 Ga0070678_1005356982 99
117 3300005456 Ga0070678_100656989 Ga0070678_1006569892 99
118 3300005456 Ga0070678_101361204 Ga0070678_1013612042 99
119 3300005457 Ga0070662_100006746 Ga0070662_1000067462 99
120 3300005458 Ga0070681_10001855 Ga0070681_100018552 99
121 3300005458 Ga0070681_10008368 Ga0070681_100083685 99
122 3300005458 Ga0070681_10028294 Ga0070681_100282944 99
123 3300005458 Ga0070681_10312547 Ga0070681_103125472 99
124 3300005458 Ga0070681_10315939 Ga0070681_103159392 99
125 3300005458 Ga0070681_11003181 Ga0070681_110031812 99
126 3300005458 Ga0070681_11540456 Ga0070681_115404562 99
127 3300005459 Ga0068867_100094284 Ga0068867_1000942842 99
128 3300005459 Ga0068867_100694923 Ga0068867_1006949232 99
129 3300005459 Ga0068867_101765543 Ga0068867_1017655431 99
130 3300005466 Ga0070685_10041321 Ga0070685_100413213 99
131 3300005467 Ga0070706_100003217 Ga0070706_1000032174 99
132 3300005467 Ga0070706_101537085 Ga0070706_1015370851 99
133 3300005468 Ga0070707_100001362 Ga0070707_10000136215 99
134 3300005468 Ga0070707_100781199 Ga0070707_1007811992 99
135 3300005468 Ga0070707_101718555 Ga0070707_1017185551 99
136 3300005471 Ga0070698_100224931 Ga0070698_1002249313 99
137 3300005471 Ga0070698_100638457 Ga0070698_1006384572 99
138 3300005471 Ga0070698_101930119 Ga0070698_1019301192 99
139 3300005518 Ga0070699_100029009 Ga0070699_1000290093 99
140 3300005518 Ga0070699_100277486 Ga0070699_1002774862 99
141 3300005518 Ga0070699_100683765 Ga0070699_1006837652 99
142 3300005530 Ga0070679_100006177 Ga0070679_1000061776 99
143 3300005530 Ga0070679_100025932 Ga0070679_1000259325 99
144 3300005530 Ga0070679_100113608 Ga0070679_1001136082 99
145 3300005530 Ga0070679_100118938 Ga0070679_1001189383 99
146 3300005530 Ga0070679_100234873 Ga0070679_1002348732 99
147 3300005530 Ga0070679_100284838 Ga0070679_1002848382 99
148 3300005530 Ga0070679_100974573 Ga0070679_1009745732 99
149 3300005530 Ga0070679_101501296 Ga0070679_1015012962 99
150 3300005535 Ga0070684_100000234 Ga0070684_10000023427 99
151 3300005535 Ga0070684_100003158 Ga0070684_10000315812 99
152 3300005535 Ga0070684_100043403 Ga0070684_1000434032 99
153 3300005535 Ga0070684_100062867 Ga0070684_1000628672 99
154 3300005535 Ga0070684_100108132 Ga0070684_1001081322 99
155 3300005535 Ga0070684_100154937 Ga0070684_1001549372 99
156 3300005535 Ga0070684_100205471 Ga0070684_1002054712 99
157 3300005535 Ga0070684_100417282 Ga0070684_1004172822 99
158 3300005535 Ga0070684_100772131 Ga0070684_1007721312 99
159 3300005535 Ga0070684_101245053 Ga0070684_1012450532 99
160 3300005535 Ga0070684_102050607 Ga0070684_1020506072 99
161 3300005536 Ga0070697_100197924 Ga0070697_1001979242 99
162 3300005536 Ga0070697_100752641 Ga0070697_1007526412 99
163 3300005536 Ga0070697_100788371 Ga0070697_1007883712 99
164 3300005536 Ga0070697_101093138 Ga0070697_1010931381 99
165 3300005539 Ga0068853_100091196 Ga0068853_1000911962 99
166 3300005539 Ga0068853_100291773 Ga0068853_1002917733 99
167 3300005539 Ga0068853_100361686 Ga0068853_1003616862 99
168 3300005539 Ga0068853_101888694 Ga0068853_1018886941 99
169 3300005543 Ga0070672_100019540 Ga0070672_1000195405 99
170 3300005543 Ga0070672_100549313 Ga0070672_1005493133 99
171 3300005543 Ga0070672_100554554 Ga0070672_1005545542 99
172 3300005543 Ga0070672_100644360 Ga0070672_1006443602 99
173 3300005543 Ga0070672_100680390 Ga0070672_1006803902 99
174 3300005543 Ga0070672_100874892 Ga0070672_1008748922 99
175 3300005544 Ga0070686_100001674 Ga0070686_1000016743 99
176 3300005544 Ga0070686_100014826 Ga0070686_1000148263 99
177 3300005545 Ga0070695_101236595 Ga0070695_1012365951 99
178 3300005545 Ga0070695_101499534 Ga0070695_1014995341 99
179 3300005546 Ga0070696_100110976 Ga0070696_1001109762 99
180 3300005546 Ga0070696_100291027 Ga0070696_1002910272 99
181 3300005546 Ga0070696_100537387 Ga0070696_1005373871 99
182 3300005546 Ga0070696_100808673 Ga0070696_1008086732 99
183 3300005546 Ga0070696_100839321 Ga0070696_1008393212 99
184 3300005546 Ga0070696_101662701 Ga0070696_1016627012 99
185 3300005547 Ga0070693_100025410 Ga0070693_1000254102 99
186 3300005547 Ga0070693_100431365 Ga0070693_1004313652 99
187 3300005547 Ga0070693_100445105 Ga0070693_1004451052 99
188 3300005548 Ga0070665_100065988 Ga0070665_1000659883 99
189 3300005548 Ga0070665_100143055 Ga0070665_1001430552 99
190 3300005548 Ga0070665_100392291 Ga0070665_1003922912 99
191 3300005549 Ga0070704_100106392 Ga0070704_1001063922 99
192 3300005549 Ga0070704_100456275 Ga0070704_1004562752 99
193 3300005549 Ga0070704_100457132 Ga0070704_1004571322 99
194 3300005549 Ga0070704_102285321 Ga0070704_1022853212 99
195 3300005563 Ga0068855_100006224 Ga0068855_10000622416 99
196 3300005563 Ga0068855_100018402 Ga0068855_1000184022 99
197 3300005563 Ga0068855_100224479 Ga0068855_1002244792 99
198 3300005563 Ga0068855_100695267 Ga0068855_1006952672 99
199 3300005563 Ga0068855_100942815 Ga0068855_1009428152 99
200 3300005563 Ga0068855_101502034 Ga0068855_1015020342 99
201 3300005564 Ga0070664_100019861 Ga0070664_1000198612 99
202 3300005564 Ga0070664_100372160 Ga0070664_1003721603 99
203 3300005564 Ga0070664_100524529 Ga0070664_1005245291 99
204 3300005564 Ga0070664_100722486 Ga0070664_1007224862 99
205 3300005577 Ga0068857_100006298 Ga0068857_10000629810 99
206 3300005577 Ga0068857_100060416 Ga0068857_1000604163 99
207 3300005577 Ga0068857_100135663 Ga0068857_1001356632 99
208 3300005577 Ga0068857_100538374 Ga0068857_1005383742 99
209 3300005577 Ga0068857_101149901 Ga0068857_1011499011 99
210 3300005577 Ga0068857_102427685 Ga0068857_1024276852 99
211 3300005578 Ga0068854_100214575 Ga0068854_1002145752 99
212 3300005614 Ga0068856_100107787 Ga0068856_1001077872 99
213 3300005614 Ga0068856_100151809 Ga0068856_1001518092 99
214 3300005614 Ga0068856_100153092 Ga0068856_1001530922 99
215 3300005614 Ga0068856_100345847 Ga0068856_1003458472 99
216 3300005614 Ga0068856_101599419 Ga0068856_1015994191 99
217 3300005615 Ga0070702_100005952 Ga0070702_1000059522 99
218 3300005615 Ga0070702_100091055 Ga0070702_1000910554 99
219 3300005615 Ga0070702_100150150 Ga0070702_1001501502 99
220 3300005615 Ga0070702_100352716 Ga0070702_1003527162 99
221 3300005615 Ga0070702_100994014 Ga0070702_1009940142 99
222 3300005615 Ga0070702_101053063 Ga0070702_1010530632 99
223 3300005616 Ga0068852_100027363 Ga0068852_1000273633 99
224 3300005616 Ga0068852_100517944 Ga0068852_1005179443 99
225 3300005616 Ga0068852_100875428 Ga0068852_1008754282 99
226 3300005617 Ga0068859_100118937 Ga0068859_1001189372 99
227 3300005617 Ga0068859_100744780 Ga0068859_1007447802 99
228 3300005617 Ga0068859_102164307 Ga0068859_1021643071 99
229 3300005618 Ga0068864_100356093 Ga0068864_1003560932 99
230 3300005618 Ga0068864_100874320 Ga0068864_1008743202 99
231 3300005618 Ga0068864_101226657 Ga0068864_1012266572 99
232 3300005718 Ga0068866_10192921 Ga0068866_101929212 99
233 3300005719 Ga0068861_100145187 Ga0068861_1001451873 99
234 3300005834 Ga0068851_10054376 Ga0068851_100543762 99
235 3300005834 Ga0068851_10807788 Ga0068851_108077882 99
236 3300005840 Ga0068870_10280026 Ga0068870_102800261 99
237 3300005840 Ga0068870_10577571 Ga0068870_105775712 99
238 3300005841 Ga0068863_101525123 Ga0068863_1015251232 99
239 3300005841 Ga0068863_101777743 Ga0068863_1017777432 99
240 3300005841 Ga0068863_102517094 Ga0068863_1025170942 99
241 3300005842 Ga0068858_100088628 Ga0068858_1000886281 99
242 3300005842 Ga0068858_100352375 Ga0068858_1003523752 99
243 3300005842 Ga0068858_100750272 Ga0068858_1007502722 99
244 3300005842 Ga0068858_101545095 Ga0068858_1015450951 99
245 3300005843 Ga0068860_100061414 Ga0068860_1000614143 99
246 3300005843 Ga0068860_100542250 Ga0068860_1005422502 99
247 3300005844 Ga0068862_100081916 Ga0068862_1000819163 99
248 3300005844 Ga0068862_102057354 Ga0068862_1020573542 99
249 3300005937 Ga0081455_10007161 Ga0081455_100071615 99
250 3300005937 Ga0081455_10010378 Ga0081455_100103785 99
251 3300005937 Ga0081455_10011940 Ga0081455_100119407 99
252 3300005937 Ga0081455_10021800 Ga0081455_100218004 99
253 3300005937 Ga0081455_10022266 Ga0081455_100222662 99
254 3300005937 Ga0081455_10130858 Ga0081455_101308582 99
255 3300005937 Ga0081455_10505796 Ga0081455_105057962 99
256 3300005937 Ga0081455_10798679 Ga0081455_107986792 99
257 3300005937 Ga0081455_10907186 Ga0081455_109071862 99
258 3300005981 Ga0081538_10000094 Ga0081538_1000009482 99
259 3300005981 Ga0081538_10000407 Ga0081538_1000040724 99
260 3300005981 Ga0081538_10003829 Ga0081538_1000382913 99
261 3300005981 Ga0081538_10004943 Ga0081538_100049435 99
262 3300005981 Ga0081538_10009890 Ga0081538_100098907 99
263 3300005981 Ga0081538_10028915 Ga0081538_100289153 99
264 3300005981 Ga0081538_10049856 Ga0081538_100498565 99
265 3300005985 Ga0081539_10000867 Ga0081539_1000086741 99
266 3300005985 Ga0081539_10001480 Ga0081539_1000148021 99
267 3300005985 Ga0081539_10025681 Ga0081539_100256813 99
268 3300005985 Ga0081539_10038792 Ga0081539_100387924 99
269 3300005985 Ga0081539_10145691 Ga0081539_101456911 99
270 3300006028 Ga0070717_10352195 Ga0070717_103521952 99
271 3300006028 Ga0070717_10449134 Ga0070717_104491342 99
272 3300006028 Ga0070717_11265950 Ga0070717_112659502 99
273 3300006038 Ga0075365_10020258 Ga0075365_100202582 99
274 3300006038 Ga0075365_10053748 Ga0075365_100537484 99
275 3300006038 Ga0075365_10082605 Ga0075365_100826052 99
276 3300006038 Ga0075365_10237831 Ga0075365_102378312 99
277 3300006038 Ga0075365_10977703 Ga0075365_109777031 99
278 3300006048 Ga0075363_100019619 Ga0075363_1000196192 99
279 3300006048 Ga0075363_100123013 Ga0075363_1001230132 99
280 3300006048 Ga0075363_100196456 Ga0075363_1001964562 99
281 3300006048 Ga0075363_100203691 Ga0075363_1002036913 99
282 3300006048 Ga0075363_100227136 Ga0075363_1002271362 99
283 3300006048 Ga0075363_100850359 Ga0075363_1008503592 99
284 3300006051 Ga0075364_10013092 Ga0075364_100130923 99
285 3300006051 Ga0075364_10108894 Ga0075364_101088942 99
286 3300006051 Ga0075364_10134696 Ga0075364_101346963 99
287 3300006051 Ga0075364_10185762 Ga0075364_101857622 99
288 3300006051 Ga0075364_11023004 Ga0075364_110230041 99
289 3300006051 Ga0075364_11036244 Ga0075364_110362442 99
290 3300006058 Ga0075432_10317997 Ga0075432_103179972 99
291 3300006163 Ga0070715_10002428 Ga0070715_100024286 99
292 3300006163 Ga0070715_10324728 Ga0070715_103247282 99
293 3300006173 Ga0070716_100481107 Ga0070716_1004811071 99
294 3300006173 Ga0070716_100775318 Ga0070716_1007753182 99
295 3300006173 Ga0070716_100787548 Ga0070716_1007875482 99
296 3300006175 Ga0070712_100524226 Ga0070712_1005242262 99
297 3300006175 Ga0070712_101236028 Ga0070712_1012360281 99
298 3300006175 Ga0070712_101311534 Ga0070712_1013115342 99
299 3300006177 Ga0075362_10141509 Ga0075362_101415092 99
300 3300006178 Ga0075367_10120362 Ga0075367_101203622 99
301 3300006237 Ga0097621_100670431 Ga0097621_1006704312 99
302 3300006358 Ga0068871_100089567 Ga0068871_1000895672 99
303 3300006358 Ga0068871_100300370 Ga0068871_1003003702 99
304 3300006358 Ga0068871_100425879 Ga0068871_1004258792 99
305 3300006358 Ga0068871_101544795 Ga0068871_1015447952 99
306 3300006844 Ga0075428_100047766 Ga0075428_1000477662 99
307 3300006844 Ga0075428_100075537 Ga0075428_1000755373 99
308 3300006844 Ga0075428_101911630 Ga0075428_1019116302 99
309 3300006846 Ga0075430_100003824 Ga0075430_10000382413 99
310 3300006846 Ga0075430_100313724 Ga0075430_1003137242 99
311 3300006846 Ga0075430_101209425 Ga0075430_1012094252 99
312 3300006847 Ga0075431_100035956 Ga0075431_1000359563 99
313 3300006847 Ga0075431_100071900 Ga0075431_1000719004 99
314 3300006847 Ga0075431_100405111 Ga0075431_1004051113 99
315 3300006852 Ga0075433_10000542 Ga0075433_1000054211 99
316 3300006852 Ga0075433_10341885 Ga0075433_103418852 99
317 3300006852 Ga0075433_10939474 Ga0075433_109394742 99
318 3300006852 Ga0075433_11803164 Ga0075433_118031642 99
319 3300006871 Ga0075434_100000720 Ga0075434_10000072012 99
320 3300006871 Ga0075434_100006458 Ga0075434_10000645813 99
321 3300006871 Ga0075434_100573396 Ga0075434_1005733962 99
322 3300006871 Ga0075434_100645721 Ga0075434_1006457212 99
323 3300006871 Ga0075434_100862498 Ga0075434_1008624982 99
324 3300006871 Ga0075434_101032332 Ga0075434_1010323322 99
325 3300006871 Ga0075434_101344650 Ga0075434_1013446502 99
326 3300006880 Ga0075429_100000966 Ga0075429_1000009662 99
327 3300006880 Ga0075429_100224743 Ga0075429_1002247433 99
328 3300006880 Ga0075429_100793103 Ga0075429_1007931032 99
329 3300006881 Ga0068865_100003300 Ga0068865_1000033003 99
330 3300006881 Ga0068865_100068695 Ga0068865_1000686952 99
331 3300006881 Ga0068865_100457997 Ga0068865_1004579972 99
332 3300006881 Ga0068865_100709956 Ga0068865_1007099562 99
333 3300006914 Ga0075436_100606161 Ga0075436_1006061612 99
334 3300006931 Ga0097620_100118936 Ga0097620_1001189363 99
335 3300006931 Ga0097620_100744710 Ga0097620_1007447102 99
336 3300006931 Ga0097620_102163827 Ga0097620_1021638271 99
337 3300007076 Ga0075435_100011415 Ga0075435_1000114155 99
338 3300007076 Ga0075435_100012427 Ga0075435_1000124276 99
339 3300007076 Ga0075435_100295491 Ga0075435_1002954912 99
340 3300007076 Ga0075435_101242634 Ga0075435_1012426342 99
341 3300009093 Ga0105240_10181136 Ga0105240_101811362 99
342 3300009093 Ga0105240_10290275 Ga0105240_102902754 99
343 3300009093 Ga0105240_10331603 Ga0105240_103316033 99
344 3300009093 Ga0105240_10433406 Ga0105240_104334062 99
345 3300009093 Ga0105240_10577057 Ga0105240_105770572 99
346 3300009093 Ga0105240_10633229 Ga0105240_106332292 99
347 3300009093 Ga0105240_10887151 Ga0105240_108871512 99
348 3300009094 Ga0111539_10021970 Ga0111539_100219706 99
349 3300009094 Ga0111539_10213196 Ga0111539_102131963 99
350 3300009094 Ga0111539_10295723 Ga0111539_102957233 99
351 3300009094 Ga0111539_10434689 Ga0111539_104346892 99
352 3300009094 Ga0111539_10653181 Ga0111539_106531813 99
353 3300009094 Ga0111539_10777895 Ga0111539_107778952 99
354 3300009094 Ga0111539_11281468 Ga0111539_112814682 99
355 3300009098 Ga0105245_10005436 Ga0105245_100054368 99
356 3300009098 Ga0105245_10010135 Ga0105245_100101356 99
357 3300009098 Ga0105245_10067164 Ga0105245_100671645 99
358 3300009098 Ga0105245_10090095 Ga0105245_100900953 99
359 3300009098 Ga0105245_10246339 Ga0105245_102463392 99
360 3300009098 Ga0105245_10454261 Ga0105245_104542612 99
361 3300009098 Ga0105245_11005153 Ga0105245_110051532 99
362 3300009098 Ga0105245_11454327 Ga0105245_114543272 99
363 3300009098 Ga0105245_11556137 Ga0105245_115561372 99
364 3300009101 Ga0105247_10002937 Ga0105247_100029374 99
365 3300009101 Ga0105247_10175357 Ga0105247_101753572 99
366 3300009101 Ga0105247_10881877 Ga0105247_108818772 99
367 3300009101 Ga0105247_11204467 Ga0105247_112044672 99
368 3300009147 Ga0114129_10018938 Ga0114129_100189389 99
369 3300009147 Ga0114129_10059963 Ga0114129_100599633 99
370 3300009147 Ga0114129_10096674 Ga0114129_100966745 99
371 3300009147 Ga0114129_10317988 Ga0114129_103179883 99
372 3300009147 Ga0114129_10372747 Ga0114129_103727473 99
373 3300009147 Ga0114129_10692343 Ga0114129_106923432 99
374 3300009147 Ga0114129_10875603 Ga0114129_108756032 99
375 3300009147 Ga0114129_11289208 Ga0114129_112892081 99
376 3300009147 Ga0114129_11691094 Ga0114129_116910942 99
377 3300009147 Ga0114129_12666049 Ga0114129_126660492 99
378 3300009148 Ga0105243_10004146 Ga0105243_100041466 99
379 3300009148 Ga0105243_10007909 Ga0105243_100079093 99
380 3300009148 Ga0105243_10144929 Ga0105243_101449292 99
381 3300009148 Ga0105243_10302150 Ga0105243_103021502 99
382 3300009148 Ga0105243_10350871 Ga0105243_103508712 99
383 3300009148 Ga0105243_10453542 Ga0105243_104535422 99
384 3300009148 Ga0105243_11181549 Ga0105243_111815492 99
385 3300009148 Ga0105243_11502967 Ga0105243_115029672 99
386 3300009148 Ga0105243_11831570 Ga0105243_118315702 99
387 3300009148 Ga0105243_12195083 Ga0105243_121950832 99
388 3300009174 Ga0105241_10010179 Ga0105241_100101793 99
389 3300009174 Ga0105241_10590005 Ga0105241_105900052 99
390 3300009174 Ga0105241_12321299 Ga0105241_123212991 99
391 3300009176 Ga0105242_10009065 Ga0105242_100090656 99
392 3300009176 Ga0105242_10029156 Ga0105242_100291564 99
393 3300009176 Ga0105242_10303695 Ga0105242_103036952 99
394 3300009176 Ga0105242_10475719 Ga0105242_104757193 99
395 3300009176 Ga0105242_11219430 Ga0105242_112194301 99
396 3300009176 Ga0105242_11417516 Ga0105242_114175162 99
397 3300009176 Ga0105242_11675390 Ga0105242_116753902 99
398 3300009176 Ga0105242_12112363 Ga0105242_121123632 99
399 3300009177 Ga0105248_10448913 Ga0105248_104489132 99
400 3300009177 Ga0105248_10966365 Ga0105248_109663651 99
401 3300009177 Ga0105248_11981432 Ga0105248_119814322 99
402 3300009177 Ga0105248_12113713 Ga0105248_121137132 99
403 3300009177 Ga0105248_12715578 Ga0105248_127155782 99
404 3300009551 Ga0105238_10215607 Ga0105238_102156072 99
405 3300009551 Ga0105238_10853559 Ga0105238_108535592 99
406 3300009551 Ga0105238_11628684 Ga0105238_116286841 99
407 3300009551 Ga0105238_11665163 Ga0105238_116651631 99
408 3300009551 Ga0105238_12793541 Ga0105238_127935412 99
409 3300009553 Ga0105249_10130687 Ga0105249_101306872 99
410 3300009553 Ga0105249_10211921 Ga0105249_102119213 99
411 3300009553 Ga0105249_10353100 Ga0105249_103531002 99
412 3300009553 Ga0105249_11438737 Ga0105249_114387372 99
413 3300009553 Ga0105249_11471461 Ga0105249_114714612 99
414 3300009553 Ga0105249_12006691 Ga0105249_120066912 99
415 3300010375 Ga0105239_10102746 Ga0105239_101027462 99
416 3300010375 Ga0105239_10427124 Ga0105239_104271242 99
417 3300010375 Ga0105239_11072175 Ga0105239_110721752 99
418 3300010375 Ga0105239_11636749 Ga0105239_116367492 99
419 3300010375 Ga0105239_12499159 Ga0105239_124991591 99
420 3300011119 Ga0105246_10004352 Ga0105246_100043527 99
421 3300011119 Ga0105246_10059612 Ga0105246_100596124 99
422 3300011119 Ga0105246_10063578 Ga0105246_100635784 99
423 3300012480 Ga0157346_1011378 Ga0157346_10113782 99
424 3300012481 Ga0157320_1011444 Ga0157320_10114442 99
425 3300012488 Ga0157343_1040723 Ga0157343_10407232 99
426 3300012490 Ga0157322_1035040 Ga0157322_10350402 99
427 3300012494 Ga0157341_1005923 Ga0157341_10059232 99
428 3300012494 Ga0157341_1045672 Ga0157341_10456722 99
429 3300012506 Ga0157324_1022420 Ga0157324_10224202 99
430 3300013059 Ga0154012_114477 Ga0154012_1144772 99
431 3300013100 Ga0157373_10128005 Ga0157373_101280052 99
432 3300013100 Ga0157373_10872566 Ga0157373_108725662 99
433 3300013100 Ga0157373_11505059 Ga0157373_115050592 99
434 3300013102 Ga0157371_10580358 Ga0157371_105803582 99
435 3300013102 Ga0157371_11479657 Ga0157371_114796571 99
436 3300013104 Ga0157370_10074739 Ga0157370_100747394 99
437 3300013104 Ga0157370_10093060 Ga0157370_100930602 99
438 3300013104 Ga0157370_10127274 Ga0157370_101272744 99
439 3300013104 Ga0157370_10287106 Ga0157370_102871062 99
440 3300013105 Ga0157369_10013890 Ga0157369_100138904 99
441 3300013105 Ga0157369_10067662 Ga0157369_100676623 99
442 3300013105 Ga0157369_10075281 Ga0157369_100752812 99
443 3300013105 Ga0157369_10155465 Ga0157369_101554652 99
444 3300013105 Ga0157369_10188962 Ga0157369_101889622 99
445 3300013105 Ga0157369_10302916 Ga0157369_103029163 99
446 3300013105 Ga0157369_10421271 Ga0157369_104212712 99
447 3300013105 Ga0157369_10473054 Ga0157369_104730542 99
448 3300013105 Ga0157369_10778016 Ga0157369_107780161 99
449 3300013105 Ga0157369_11043524 Ga0157369_110435242 99
450 3300013105 Ga0157369_11783475 Ga0157369_117834752 99
451 3300013105 Ga0157369_12011747 Ga0157369_120117472 99
452 3300013296 Ga0157374_10151821 Ga0157374_101518212 99
453 3300013296 Ga0157374_10315835 Ga0157374_103158353 99
454 3300013296 Ga0157374_10563033 Ga0157374_105630333 99
455 3300013296 Ga0157374_10889216 Ga0157374_108892162 99
456 3300013296 Ga0157374_11063804 Ga0157374_110638042 99
457 3300013296 Ga0157374_11315398 Ga0157374_113153982 99
458 3300013297 Ga0157378_10001752 Ga0157378_1000175211 99
459 3300013297 Ga0157378_10929023 Ga0157378_109290232 99
460 3300013306 Ga0163162_10760787 Ga0163162_107607872 99
461 3300013306 Ga0163162_11416628 Ga0163162_114166282 99
462 3300013307 Ga0157372_10117694 Ga0157372_101176943 99
463 3300013307 Ga0157372_10191691 Ga0157372_101916913 99
464 3300013307 Ga0157372_12137328 Ga0157372_121373282 99
465 3300013307 Ga0157372_12177824 Ga0157372_121778241 99
466 3300013307 Ga0157372_12477855 Ga0157372_124778552 99
467 3300013308 Ga0157375_10105006 Ga0157375_101050065 99
468 3300013308 Ga0157375_10118416 Ga0157375_101184162 99
469 3300013308 Ga0157375_10123928 Ga0157375_101239283 99
470 3300013308 Ga0157375_10709544 Ga0157375_107095442 99
471 3300013308 Ga0157375_10893814 Ga0157375_108938142 99
472 3300013308 Ga0157375_10909858 Ga0157375_109098582 99
473 3300013308 Ga0157375_11162491 Ga0157375_111624912 99
474 3300013308 Ga0157375_11993456 Ga0157375_119934562 99
475 3300013308 Ga0157375_12075412 Ga0157375_120754122 99
476 3300014325 Ga0163163_10336506 Ga0163163_103365062 99
477 3300014325 Ga0163163_10480721 Ga0163163_104807212 99
478 3300014325 Ga0163163_12527685 Ga0163163_125276852 99
479 3300014325 Ga0163163_12672807 Ga0163163_126728072 99
480 3300014325 Ga0163163_13058453 Ga0163163_130584531 99
481 3300014326 Ga0157380_10025502 Ga0157380_100255023 99
482 3300014326 Ga0157380_12961544 Ga0157380_129615442 99
483 3300014497 Ga0182008_10303194 Ga0182008_103031942 99
484 3300014745 Ga0157377_10006373 Ga0157377_100063733 99
485 3300014968 Ga0157379_10009631 Ga0157379_100096316 99
486 3300014968 Ga0157379_10817801 Ga0157379_108178012 99
487 3300014968 Ga0157379_12008854 Ga0157379_120088541 99
488 3300014969 Ga0157376_10265054 Ga0157376_102650542 99
489 3300014969 Ga0157376_11628394 Ga0157376_116283942 99
490 3300020069 Ga0197907_10441792 Ga0197907_104417922 99
491 3300020069 Ga0197907_10469260 Ga0197907_104692602 99
492 3300020070 Ga0206356_10070943 Ga0206356_100709431 99
493 3300020070 Ga0206356_10643260 Ga0206356_106432602 99
494 3300020070 Ga0206356_11413429 Ga0206356_114134292 99
495 3300020081 Ga0206354_10107059 Ga0206354_101070593 99
496 3300020081 Ga0206354_11636799 Ga0206354_116367992 99
497 3300020082 Ga0206353_10321845 Ga0206353_103218452 99
498 3300020082 Ga0206353_10410348 Ga0206353_104103482 99
499 3300020082 Ga0206353_10608362 Ga0206353_106083622 99
500 3300020082 Ga0206353_11189367 Ga0206353_111893674 99
501 3300021384 Ga0213876_10018808 Ga0213876_100188083 99
502 3300021388 Ga0213875_10210278 Ga0213875_102102782 99
503 3300021441 Ga0213871_10029909 Ga0213871_100299092 99
504 3300022467 Ga0224712_10046446 Ga0224712_100464462 99
505 3300025321 Ga0207656_10012992 Ga0207656_100129923 99
506 3300025885 Ga0207653_10082902 Ga0207653_100829022 99
507 3300025885 Ga0207653_10119334 Ga0207653_101193342 99
508 3300025898 Ga0207692_10153238 Ga0207692_101532382 99
509 3300025898 Ga0207692_10982290 Ga0207692_109822902 99
510 3300025900 Ga0207710_10008578 Ga0207710_100085783 99
511 3300025901 Ga0207688_10012501 Ga0207688_100125013 99
512 3300025901 Ga0207688_10116407 Ga0207688_101164072 99
513 3300025901 Ga0207688_10600600 Ga0207688_106006002 99
514 3300025903 Ga0207680_10366302 Ga0207680_103663021 99
515 3300025905 Ga0207685_10101825 Ga0207685_101018252 99
516 3300025905 Ga0207685_10121099 Ga0207685_101210991 99
517 3300025906 Ga0207699_10450299 Ga0207699_104502992 99
518 3300025906 Ga0207699_10618101 Ga0207699_106181012 99
519 3300025907 Ga0207645_10485313 Ga0207645_104853132 99
520 3300025907 Ga0207645_10562592 Ga0207645_105625922 99
521 3300025908 Ga0207643_10144344 Ga0207643_101443442 99
522 3300025908 Ga0207643_10410917 Ga0207643_104109171 99
523 3300025909 Ga0207705_10006903 Ga0207705_100069032 99
524 3300025909 Ga0207705_10013505 Ga0207705_100135053 99
525 3300025909 Ga0207705_10013940 Ga0207705_100139405 99
526 3300025909 Ga0207705_10101931 Ga0207705_101019314 99
527 3300025910 Ga0207684_10807562 Ga0207684_108075622 99
528 3300025911 Ga0207654_10029494 Ga0207654_100294945 99
529 3300025911 Ga0207654_10295441 Ga0207654_102954412 99
530 3300025911 Ga0207654_10324514 Ga0207654_103245142 99
531 3300025912 Ga0207707_10002919 Ga0207707_1000291915 99
532 3300025912 Ga0207707_10007563 Ga0207707_100075632 99
533 3300025912 Ga0207707_10062016 Ga0207707_100620162 99
534 3300025912 Ga0207707_10145570 Ga0207707_101455703 99
535 3300025912 Ga0207707_11048178 Ga0207707_110481782 99
536 3300025912 Ga0207707_11229859 Ga0207707_112298592 99
537 3300025913 Ga0207695_10524065 Ga0207695_105240652 99
538 3300025913 Ga0207695_10563794 Ga0207695_105637942 99
539 3300025913 Ga0207695_11025731 Ga0207695_110257312 99
540 3300025913 Ga0207695_11086277 Ga0207695_110862772 99
541 3300025913 Ga0207695_11134703 Ga0207695_111347032 99
542 3300025914 Ga0207671_10388865 Ga0207671_103888651 99
543 3300025915 Ga0207693_10137749 Ga0207693_101377494 99
544 3300025915 Ga0207693_10336845 Ga0207693_103368451 99
545 3300025915 Ga0207693_10744930 Ga0207693_107449302 99
546 3300025915 Ga0207693_10878991 Ga0207693_108789912 99
547 3300025915 Ga0207693_10922670 Ga0207693_109226702 99
548 3300025915 Ga0207693_10950915 Ga0207693_109509152 99
549 3300025916 Ga0207663_10344035 Ga0207663_103440352 99
550 3300025916 Ga0207663_10616125 Ga0207663_106161252 99
551 3300025916 Ga0207663_10660680 Ga0207663_106606801 99
552 3300025917 Ga0207660_10003668 Ga0207660_100036683 99
553 3300025917 Ga0207660_10072439 Ga0207660_100724392 99
554 3300025917 Ga0207660_10088968 Ga0207660_100889682 99
555 3300025917 Ga0207660_10127156 Ga0207660_101271563 99
556 3300025917 Ga0207660_10226093 Ga0207660_102260932 99
557 3300025917 Ga0207660_10279320 Ga0207660_102793202 99
558 3300025917 Ga0207660_10460010 Ga0207660_104600102 99
559 3300025918 Ga0207662_10151348 Ga0207662_101513483 99
560 3300025918 Ga0207662_10158739 Ga0207662_101587391 99
561 3300025918 Ga0207662_10500324 Ga0207662_105003242 99
562 3300025919 Ga0207657_10000166 Ga0207657_100001663 99
563 3300025919 Ga0207657_10001699 Ga0207657_1000169913 99
564 3300025919 Ga0207657_10005205 Ga0207657_100052053 99
565 3300025919 Ga0207657_10005284 Ga0207657_1000528411 99
566 3300025919 Ga0207657_10019418 Ga0207657_100194184 99
567 3300025919 Ga0207657_10175202 Ga0207657_101752023 99
568 3300025919 Ga0207657_10592712 Ga0207657_105927122 99
569 3300025919 Ga0207657_10780014 Ga0207657_107800142 99
570 3300025920 Ga0207649_10009752 Ga0207649_100097524 99
571 3300025920 Ga0207649_10073463 Ga0207649_100734632 99
572 3300025920 Ga0207649_10112373 Ga0207649_101123732 99
573 3300025920 Ga0207649_10359181 Ga0207649_103591813 99
574 3300025920 Ga0207649_10997853 Ga0207649_109978532 99
575 3300025920 Ga0207649_11033954 Ga0207649_110339541 99
576 3300025921 Ga0207652_10019956 Ga0207652_100199564 99
577 3300025921 Ga0207652_10022272 Ga0207652_100222724 99
578 3300025921 Ga0207652_10064550 Ga0207652_100645502 99
579 3300025921 Ga0207652_10349207 Ga0207652_103492072 99
580 3300025921 Ga0207652_10368668 Ga0207652_103686683 99
581 3300025921 Ga0207652_10546332 Ga0207652_105463322 99
582 3300025921 Ga0207652_10581209 Ga0207652_105812092 99
583 3300025921 Ga0207652_10881615 Ga0207652_108816152 99
584 3300025921 Ga0207652_10929227 Ga0207652_109292272 99
585 3300025921 Ga0207652_11024682 Ga0207652_110246822 99
586 3300025922 Ga0207646_10001072 Ga0207646_1000107213 99
587 3300025922 Ga0207646_10564029 Ga0207646_105640292 99
588 3300025924 Ga0207694_10044430 Ga0207694_100444304 99
589 3300025924 Ga0207694_10049470 Ga0207694_100494703 99
590 3300025925 Ga0207650_11453427 Ga0207650_114534271 99
591 3300025926 Ga0207659_10115634 Ga0207659_101156341 99
592 3300025926 Ga0207659_10360942 Ga0207659_103609422 99
593 3300025926 Ga0207659_11737710 Ga0207659_117377101 99
594 3300025927 Ga0207687_10029907 Ga0207687_100299074 99
595 3300025927 Ga0207687_10196115 Ga0207687_101961152 99
596 3300025927 Ga0207687_10301265 Ga0207687_103012652 99
597 3300025927 Ga0207687_10628047 Ga0207687_106280472 99
598 3300025927 Ga0207687_10629289 Ga0207687_106292892 99
599 3300025927 Ga0207687_10772692 Ga0207687_107726922 99
600 3300025927 Ga0207687_10864157 Ga0207687_108641572 99
601 3300025927 Ga0207687_10929605 Ga0207687_109296052 99
602 3300025928 Ga0207700_10263860 Ga0207700_102638602 99
603 3300025928 Ga0207700_10600549 Ga0207700_106005492 99
604 3300025928 Ga0207700_10670640 Ga0207700_106706402 99
605 3300025929 Ga0207664_10114382 Ga0207664_101143822 99
606 3300025929 Ga0207664_10115436 Ga0207664_101154362 99
607 3300025929 Ga0207664_10271156 Ga0207664_102711562 99
608 3300025929 Ga0207664_11296515 Ga0207664_112965152 99
609 3300025929 Ga0207664_11412679 Ga0207664_114126792 99
610 3300025931 Ga0207644_10419859 Ga0207644_104198593 99
611 3300025931 Ga0207644_10553413 Ga0207644_105534132 99
612 3300025931 Ga0207644_11396133 Ga0207644_113961332 99
613 3300025932 Ga0207690_10026366 Ga0207690_100263662 99
614 3300025932 Ga0207690_10087116 Ga0207690_100871163 99
615 3300025932 Ga0207690_10544441 Ga0207690_105444412 99
616 3300025932 Ga0207690_11744506 Ga0207690_117445062 99
617 3300025933 Ga0207706_10019164 Ga0207706_100191643 99
618 3300025933 Ga0207706_11045816 Ga0207706_110458162 99
619 3300025934 Ga0207686_10018351 Ga0207686_100183513 99
620 3300025934 Ga0207686_10239463 Ga0207686_102394631 99
621 3300025934 Ga0207686_10458471 Ga0207686_104584712 99
622 3300025934 Ga0207686_11028492 Ga0207686_110284921 99
623 3300025935 Ga0207709_10043978 Ga0207709_100439783 99
624 3300025935 Ga0207709_10081205 Ga0207709_100812051 99
625 3300025935 Ga0207709_10113079 Ga0207709_101130792 99
626 3300025935 Ga0207709_10130734 Ga0207709_101307342 99
627 3300025935 Ga0207709_10179927 Ga0207709_101799272 99
628 3300025935 Ga0207709_10317519 Ga0207709_103175192 99
629 3300025935 Ga0207709_10456672 Ga0207709_104566722 99
630 3300025935 Ga0207709_11821006 Ga0207709_118210061 99
631 3300025936 Ga0207670_10012786 Ga0207670_100127864 99
632 3300025937 Ga0207669_10012793 Ga0207669_100127934 99
633 3300025937 Ga0207669_10543226 Ga0207669_105432261 99
634 3300025937 Ga0207669_10572078 Ga0207669_105720782 99
635 3300025937 Ga0207669_11057249 Ga0207669_110572491 99
636 3300025938 Ga0207704_10080689 Ga0207704_100806892 99
637 3300025938 Ga0207704_10198411 Ga0207704_101984112 99
638 3300025938 Ga0207704_10331670 Ga0207704_103316702 99
639 3300025938 Ga0207704_10335989 Ga0207704_103359892 99
640 3300025938 Ga0207704_10525775 Ga0207704_105257752 99
641 3300025939 Ga0207665_10198419 Ga0207665_101984192 99
642 3300025939 Ga0207665_10251520 Ga0207665_102515202 99
643 3300025939 Ga0207665_10661794 Ga0207665_106617942 99
644 3300025939 Ga0207665_10683200 Ga0207665_106832002 99
645 3300025939 Ga0207665_11413021 Ga0207665_114130211 99
646 3300025940 Ga0207691_10003565 Ga0207691_1000356510 99
647 3300025940 Ga0207691_10548400 Ga0207691_105484002 99
648 3300025941 Ga0207711_11177126 Ga0207711_111771262 99
649 3300025944 Ga0207661_10005687 Ga0207661_100056878 99
650 3300025944 Ga0207661_10010549 Ga0207661_100105495 99
651 3300025944 Ga0207661_10052680 Ga0207661_100526802 99
652 3300025944 Ga0207661_10092301 Ga0207661_100923012 99
653 3300025944 Ga0207661_10129140 Ga0207661_101291403 99
654 3300025944 Ga0207661_10155136 Ga0207661_101551362 99
655 3300025944 Ga0207661_10316755 Ga0207661_103167552 99
656 3300025944 Ga0207661_10358227 Ga0207661_103582273 99
657 3300025944 Ga0207661_10443721 Ga0207661_104437213 99
658 3300025944 Ga0207661_11052841 Ga0207661_110528412 99
659 3300025944 Ga0207661_11255078 Ga0207661_112550782 99
660 3300025944 Ga0207661_11318222 Ga0207661_113182222 99
661 3300025945 Ga0207679_10030325 Ga0207679_100303255 99
662 3300025945 Ga0207679_10411063 Ga0207679_104110632 99
663 3300025945 Ga0207679_10454339 Ga0207679_104543393 99
664 3300025945 Ga0207679_10786104 Ga0207679_107861042 99
665 3300025949 Ga0207667_10115455 Ga0207667_101154552 99
666 3300025949 Ga0207667_10159143 Ga0207667_101591434 99
667 3300025949 Ga0207667_10288094 Ga0207667_102880942 99
668 3300025949 Ga0207667_10379077 Ga0207667_103790773 99
669 3300025949 Ga0207667_10437807 Ga0207667_104378071 99
670 3300025949 Ga0207667_10484249 Ga0207667_104842493 99
671 3300025949 Ga0207667_10695792 Ga0207667_106957922 99
672 3300025949 Ga0207667_11068061 Ga0207667_110680612 99
673 3300025949 Ga0207667_11203872 Ga0207667_112038722 99
674 3300025960 Ga0207651_10137641 Ga0207651_101376412 99
675 3300025960 Ga0207651_11736848 Ga0207651_117368482 99
676 3300025960 Ga0207651_12089382 Ga0207651_120893821 99
677 3300025961 Ga0207712_10110345 Ga0207712_101103452 99
678 3300025961 Ga0207712_10231008 Ga0207712_102310082 99
679 3300025961 Ga0207712_10322820 Ga0207712_103228203 99
680 3300025972 Ga0207668_10014721 Ga0207668_100147212 99
681 3300025972 Ga0207668_10222088 Ga0207668_102220882 99
682 3300025981 Ga0207640_10343704 Ga0207640_103437042 99
683 3300025981 Ga0207640_10849837 Ga0207640_108498372 99
684 3300025981 Ga0207640_11022224 Ga0207640_110222242 99
685 3300025986 Ga0207658_10064115 Ga0207658_100641153 99
686 3300025986 Ga0207658_11988017 Ga0207658_119880172 99
687 3300026023 Ga0207677_10009947 Ga0207677_100099476 99
688 3300026023 Ga0207677_10647002 Ga0207677_106470022 99
689 3300026023 Ga0207677_11726557 Ga0207677_117265572 99
690 3300026035 Ga0207703_10206718 Ga0207703_102067183 99
691 3300026035 Ga0207703_10634225 Ga0207703_106342252 99
692 3300026041 Ga0207639_10020961 Ga0207639_100209612 99
693 3300026041 Ga0207639_10042523 Ga0207639_100425232 99
694 3300026041 Ga0207639_10351459 Ga0207639_103514593 99
695 3300026041 Ga0207639_10665921 Ga0207639_106659212 99
696 3300026041 Ga0207639_11490187 Ga0207639_114901872 99
697 3300026067 Ga0207678_10007283 Ga0207678_100072832 99
698 3300026067 Ga0207678_10197991 Ga0207678_101979912 99
699 3300026067 Ga0207678_10622228 Ga0207678_106222282 99
700 3300026067 Ga0207678_10773164 Ga0207678_107731642 99
701 3300026075 Ga0207708_10002241 Ga0207708_100022419 99
702 3300026075 Ga0207708_10004129 Ga0207708_100041293 99
703 3300026075 Ga0207708_10471137 Ga0207708_104711372 99
704 3300026075 Ga0207708_10616268 Ga0207708_106162682 99
705 3300026075 Ga0207708_11386301 Ga0207708_113863012 99
706 3300026075 Ga0207708_11389010 Ga0207708_113890102 99
707 3300026075 Ga0207708_11478966 Ga0207708_114789662 99
708 3300026075 Ga0207708_11488483 Ga0207708_114884832 99
709 3300026078 Ga0207702_10020789 Ga0207702_100207895 99
710 3300026078 Ga0207702_10149129 Ga0207702_101491292 99
711 3300026078 Ga0207702_10335743 Ga0207702_103357432 99
712 3300026078 Ga0207702_10757490 Ga0207702_107574902 99
713 3300026078 Ga0207702_11366791 Ga0207702_113667912 99
714 3300026078 Ga0207702_11772217 Ga0207702_117722172 99
715 3300026088 Ga0207641_10970009 Ga0207641_109700092 99
716 3300026088 Ga0207641_11032592 Ga0207641_110325922 99
717 3300026089 Ga0207648_10055146 Ga0207648_100551462 99
718 3300026089 Ga0207648_10799901 Ga0207648_107999012 99
719 3300026089 Ga0207648_11039098 Ga0207648_110390982 99
720 3300026089 Ga0207648_11276249 Ga0207648_112762491 99
721 3300026095 Ga0207676_10802807 Ga0207676_108028072 99
722 3300026116 Ga0207674_10038314 Ga0207674_100383143 99
723 3300026116 Ga0207674_10049297 Ga0207674_100492973 99
724 3300026116 Ga0207674_10124545 Ga0207674_101245453 99
725 3300026116 Ga0207674_10128699 Ga0207674_101286992 99
726 3300026116 Ga0207674_10529873 Ga0207674_105298732 99
727 3300026116 Ga0207674_10756955 Ga0207674_107569552 99
728 3300026116 Ga0207674_11441773 Ga0207674_114417732 99
729 3300026118 Ga0207675_100033537 Ga0207675_1000335373 99
730 3300026118 Ga0207675_102220104 Ga0207675_1022201042 99
731 3300026121 Ga0207683_10000088 Ga0207683_1000008834 99
732 3300026121 Ga0207683_10176396 Ga0207683_101763962 99
733 3300026121 Ga0207683_10177128 Ga0207683_101771282 99
734 3300026121 Ga0207683_10229294 Ga0207683_102292942 99
735 3300026121 Ga0207683_10305271 Ga0207683_103052712 99
736 3300026121 Ga0207683_11269017 Ga0207683_112690172 99
737 3300026142 Ga0207698_10123877 Ga0207698_101238773 99
738 3300026142 Ga0207698_11049820 Ga0207698_110498202 99
739 3300027907 Ga0207428_10031186 Ga0207428_100311865 99
740 3300027907 Ga0207428_10165577 Ga0207428_101655772 99
741 3300027907 Ga0207428_10380004 Ga0207428_103800042 99
742 3300027907 Ga0207428_10414372 Ga0207428_104143722 99
743 3300027907 Ga0207428_10971048 Ga0207428_109710481 99
744 3300028379 Ga0268266_10236460 Ga0268266_102364603 99
745 3300028379 Ga0268266_10403557 Ga0268266_104035572 99
746 3300028379 Ga0268266_10612116 Ga0268266_106121163 99
747 3300028380 Ga0268265_11177395 Ga0268265_111773952 99
748 3300028380 Ga0268265_11202900 Ga0268265_112029002 99
749 3300028380 Ga0268265_12357735 Ga0268265_123577351 99
750 3300028380 Ga0268265_12434016 Ga0268265_124340162 99
751 3300028381 Ga0268264_10232267 Ga0268264_102322672 99
752 3300028381 Ga0268264_10288560 Ga0268264_102885602 99
753 3300028381 Ga0268264_11704436 Ga0268264_117044362 99
754 3300028558 Ga0265326_10067007 Ga0265326_100670072 99
755 3300028563 Ga0265319_1013301 Ga0265319_10133012 99
756 3300028563 Ga0265319_1042289 Ga0265319_10422891 99
757 3300028563 Ga0265319_1077469 Ga0265319_10774692 99
758 3300028563 Ga0265319_1086625 Ga0265319_10866252 99
759 3300028563 Ga0265319_1110413 Ga0265319_11104132 99
760 3300028563 Ga0265319_1118058 Ga0265319_11180581 99
761 3300028573 Ga0265334_10130101 Ga0265334_101301012 99
762 3300028573 Ga0265334_10135689 Ga0265334_101356892 99
763 3300028577 Ga0265318_10014422 Ga0265318_100144223 99
764 3300028577 Ga0265318_10071286 Ga0265318_100712862 99
765 3300028577 Ga0265318_10116422 Ga0265318_101164221 99
766 3300028577 Ga0265318_10343207 Ga0265318_103432071 99
767 3300028577 Ga0265318_10355892 Ga0265318_103558921 99
768 3300028654 Ga0265322_10012886 Ga0265322_100128862 99
769 3300028654 Ga0265322_10027569 Ga0265322_100275692 99
770 3300028800 Ga0265338_10009062 Ga0265338_100090625 99
771 3300028800 Ga0265338_10102308 Ga0265338_101023082 99
772 3300028800 Ga0265338_10225576 Ga0265338_102255762 99
773 3300028800 Ga0265338_10313886 Ga0265338_103138862 99
774 3300028800 Ga0265338_10551573 Ga0265338_105515732 99
775 3300028800 Ga0265338_10574946 Ga0265338_105749462 99
776 3300028800 Ga0265338_11033740 Ga0265338_110337402 99
777 3300029957 Ga0265324_10040619 Ga0265324_100406192 99
778 3300029957 Ga0265324_10175032 Ga0265324_101750322 99
779 3300031235 Ga0265330_10072031 Ga0265330_100720312 99
780 3300031238 Ga0265332_10118222 Ga0265332_101182222 99
781 3300031239 Ga0265328_10103313 Ga0265328_101033132 99
782 3300031240 Ga0265320_10022089 Ga0265320_100220895 99
783 3300031240 Ga0265320_10091477 Ga0265320_100914773 99
784 3300031240 Ga0265320_10114728 Ga0265320_101147282 99
785 3300031240 Ga0265320_10162658 Ga0265320_101626582 99
786 3300031241 Ga0265325_10056453 Ga0265325_100564531 99
787 3300031242 Ga0265329_10065226 Ga0265329_100652262 99
788 3300031247 Ga0265340_10008080 Ga0265340_100080804 99
789 3300031247 Ga0265340_10314514 Ga0265340_103145142 99
790 3300031249 Ga0265339_10094960 Ga0265339_100949603 99
791 3300031249 Ga0265339_10398264 Ga0265339_103982642 99
792 3300031250 Ga0265331_10145984 Ga0265331_101459842 99
793 3300031251 Ga0265327_10051663 Ga0265327_100516632 99
794 3300031251 Ga0265327_10151399 Ga0265327_101513992 99
795 3300031344 Ga0265316_10385660 Ga0265316_103856602 99
796 3300031344 Ga0265316_10784097 Ga0265316_107840972 99
797 3300031344 Ga0265316_11054972 Ga0265316_110549722 99
798 3300031548 Ga0307408_100428254 Ga0307408_1004282543 99
799 3300031548 Ga0307408_100773170 Ga0307408_1007731702 99
800 3300031595 Ga0265313_10007477 Ga0265313_100074774 99
801 3300031595 Ga0265313_10088275 Ga0265313_100882752 99
802 3300031691 Ga0316579_10114280 Ga0316579_101142802 99
803 3300031711 Ga0265314_10099409 Ga0265314_100994091 99
804 3300031711 Ga0265314_10296344 Ga0265314_102963442 99
805 3300031711 Ga0265314_10302221 Ga0265314_103022212 99
806 3300031711 Ga0265314_10704023 Ga0265314_107040232 99
807 3300031712 Ga0265342_10052692 Ga0265342_100526923 99
808 3300031727 Ga0316576_11222284 Ga0316576_112222841 99
809 3300031731 Ga0307405_10288754 Ga0307405_102887543 99
810 3300031731 Ga0307405_11224521 Ga0307405_112245212 99
811 3300031733 Ga0316577_10457990 Ga0316577_104579902 99
812 3300031824 Ga0307413_11362963 Ga0307413_113629632 99
813 3300031901 Ga0307406_10035647 Ga0307406_100356474 99
814 3300031903 Ga0307407_10402904 Ga0307407_104029042 99
815 3300031911 Ga0307412_10062425 Ga0307412_100624252 99
816 3300031911 Ga0307412_10596258 Ga0307412_105962582 99
817 3300031911 Ga0307412_10727214 Ga0307412_107272142 99
818 3300031995 Ga0307409_100527310 Ga0307409_1005273102 99
819 3300031995 Ga0307409_100745159 Ga0307409_1007451591 99
820 3300031995 Ga0307409_101425560 Ga0307409_1014255602 99
821 3300032002 Ga0307416_100199710 Ga0307416_1001997103 99
822 3300032002 Ga0307416_100625672 Ga0307416_1006256721 99
823 3300032002 Ga0307416_100772995 Ga0307416_1007729952 99
824 3300032002 Ga0307416_100897204 Ga0307416_1008972042 99
825 3300032002 Ga0307416_101235113 Ga0307416_1012351132 99
826 3300032126 Ga0307415_100060203 Ga0307415_1000602033 99
827 3300032126 Ga0307415_101412609 Ga0307415_1014126091 99
828 3300035083 Ga0373926_0109212 Ga0373926_0109212_527_835 99
829 3300035089 Ga0373944_0025012 Ga0373944_0025012_250_558 99
830 3300035089 Ga0373944_0179167 Ga0373944_0179167_371_679 99
831 3300035113 Ga0373936_0014471 Ga0373936_0014471_591_899 99
832 3300035113 Ga0373936_0094536 Ga0373936_0094536_656_964 99
833 3300035116 Ga0373945_0002030 Ga0373945_0002030_557_865 99
834 3300035116 Ga0373945_0034277 Ga0373945_0034277_669_977 99
835 3300035116 Ga0373945_0418549 Ga0373945_0418549_210_518 99
836 3300035117 Ga0373953_0178426 Ga0373953_0178426_540_848 99
837 3300035118 Ga0373954_0092224 Ga0373954_0092224_378_683 99
838 3300035170 Ga0373943_0000350 Ga0373943_0000350_17705_18013 99
839 3300035170 Ga0373943_0008333 Ga0373943_0008333_1411_1719 99
840 3300035170 Ga0373943_0229729 Ga0373943_0229729_557_862 99
841 3300035170 Ga0373943_0611213 Ga0373943_0611213_286_594 99
842 3300035171 Ga0373946_0019246 Ga0373946_0019246_693_1001 99
843 3300035171 Ga0373946_0598463 Ga0373946_0598463_108_416 99
844 3300035172 Ga0373955_0513601 Ga0373955_0513601_156_464 99
845 3300035242 Ga0373962_0019918 Ga0373962_0019918_211_519 99
846 3300035398 Ga0316574_0128761 Ga0316574_0128761_945_1244 99
847 3300035398 Ga0316574_0160863 Ga0316574_0160863_117_416 99
848 3300035410 Ga0373924_0495914 Ga0373924_0495914_205_513 99
849 3300035692 Ga0373935_0018135 Ga0373935_0018135_746_1054 99
850 3300035692 Ga0373935_0209100 Ga0373935_0209100_351_659 99
851 3300035695 Ga0373927_0005037 Ga0373927_0005037_5632_5940 99
852 3300035695 Ga0373927_0009585 Ga0373927_0009585_1583_1891 99
853 3300035695 Ga0373927_0708055 Ga0373927_0708055_67_372 99
854 3300035724 Ga0373933_1068345 Ga0373933_1068345_120_425 99
855 3300035725 Ga0373947_0000185 Ga0373947_0000185_19073_19381 99
856 3300035725 Ga0373947_0002783 Ga0373947_0002783_2998_3306 99
857 3300035725 Ga0373947_0009967 Ga0373947_0009967_1994_2302 99
858 3300035725 Ga0373947_0203978 Ga0373947_0203978_169_477 99
859 3300035725 Ga0373947_0304183 Ga0373947_0304183_484_801 99
860 3300036401 Ga0373937_0213267 Ga0373937_0213267_1108_1416 99
861 3300036401 Ga0373937_0253233 Ga0373937_0253233_139_447 99
862 3300036401 Ga0373937_0351396 Ga0373937_0351396_164_472 99
863 3300036647 Ga0316582_0334561 Ga0316582_0334561_504_803 99
864 3300037068 Ga0373925_0006480 Ga0373925_0006480_8143_8451 99
865 3300037068 Ga0373925_0009540 Ga0373925_0009540_1954_2262 99
866 3300037068 Ga0373925_0009968 Ga0373925_0009968_3731_4039 99
867 3300037068 Ga0373925_1550746 Ga0373925_1550746_138_446 99
868 3300037312 Ga0395899_0001247 Ga0395899_0001247_4766_5074 99
869 3300037312 Ga0395899_0012226 Ga0395899_0012226_2359_2667 99
870 3300037312 Ga0395899_0022398 Ga0395899_0022398_400_705 99
871 3300037312 Ga0395899_0055815 Ga0395899_0055815_550_855 99
872 3300037312 Ga0395899_0096302 Ga0395899_0096302_700_1008 99
873 3300037312 Ga0395899_0135140 Ga0395899_0135140_459_767 99
874 3300037312 Ga0395899_0151750 Ga0395899_0151750_447_755 99
875 3300037312 Ga0395899_0367536 Ga0395899_0367536_178_486 99
876 3300037312 Ga0395899_0403293 Ga0395899_0403293_409_717 99
877 3300037312 Ga0395899_0441999 Ga0395899_0441999_294_602 99
878 3300037312 Ga0395899_0467454 Ga0395899_0467454_442_750 99
879 3300037312 Ga0395899_0596717 Ga0395899_0596717_121_429 99
880 3300037312 Ga0395899_0782858 Ga0395899_0782858_98_406 99
881 3300037418 Ga0395900_0000929 Ga0395900_0000929_18127_18435 99
882 3300037418 Ga0395900_0012327 Ga0395900_0012327_2771_3076 99
883 3300037418 Ga0395900_0020618 Ga0395900_0020618_1219_1524 99
884 3300037418 Ga0395900_0035190 Ga0395900_0035190_2412_2720 99
885 3300037418 Ga0395900_0061443 Ga0395900_0061443_2743_3051 99
886 3300037418 Ga0395900_0079018 Ga0395900_0079018_801_1109 99
887 3300037418 Ga0395900_0107562 Ga0395900_0107562_683_991 99
888 3300037418 Ga0395900_0112994 Ga0395900_0112994_1162_1470 99
889 3300037418 Ga0395900_0121200 Ga0395900_0121200_1126_1434 99
890 3300037418 Ga0395900_0182550 Ga0395900_0182550_1495_1803 99
891 3300037418 Ga0395900_0261674 Ga0395900_0261674_331_639 99
892 3300037418 Ga0395900_0299173 Ga0395900_0299173_1192_1500 99
893 3300037418 Ga0395900_0314797 Ga0395900_0314797_682_990 99
894 3300037418 Ga0395900_0377006 Ga0395900_0377006_750_1058 99
895 3300037418 Ga0395900_0798003 Ga0395900_0798003_140_448 99
896 3300037418 Ga0395900_0916604 Ga0395900_0916604_293_592 99
897 3300037418 Ga0395900_0970130 Ga0395900_0970130_82_390 99
898 3300037418 Ga0395900_1036771 Ga0395900_1036771_328_636 99
899 3300037418 Ga0395900_1085930 Ga0395900_1085930_78_377 99
900 3300037466 Ga0395898_0003495 Ga0395898_0003495_260_568 99
901 3300037466 Ga0395898_0007203 Ga0395898_0007203_9404_9712 99
902 3300037466 Ga0395898_0008588 Ga0395898_0008588_9421_9726 99
903 3300037466 Ga0395898_0009600 Ga0395898_0009600_6960_7265 99
904 3300037466 Ga0395898_0017551 Ga0395898_0017551_6056_6364 99
905 3300037466 Ga0395898_0033238 Ga0395898_0033238_4173_4481 99
906 3300037466 Ga0395898_0034664 Ga0395898_0034664_3907_4215 99
907 3300037466 Ga0395898_0044823 Ga0395898_0044823_432_740 99
908 3300037466 Ga0395898_0074768 Ga0395898_0074768_528_836 99
909 3300037466 Ga0395898_0376200 Ga0395898_0376200_228_536 99
910 3300037466 Ga0395898_0388005 Ga0395898_0388005_325_633 99
911 3300037466 Ga0395898_0425892 Ga0395898_0425892_672_980 99
912 3300037466 Ga0395898_0576835 Ga0395898_0576835_213_521 99
913 3300037466 Ga0395898_0703654 Ga0395898_0703654_185_493 99
914 3300037466 Ga0395898_0705008 Ga0395898_0705008_56_364 99
915 3300037466 Ga0395898_0876072 Ga0395898_0876072_509_817 99
916 3300037466 Ga0395898_0940049 Ga0395898_0940049_143_451 99
917 3300037466 Ga0395898_0972850 Ga0395898_0972850_94_402 99
918 3300037466 Ga0395898_1035529 Ga0395898_1035529_74_373 99
919 3300037466 Ga0395898_1713893 Ga0395898_1713893_20_328 99
920 3300037466 Ga0395898_1724984 Ga0395898_1724984_39_347 99
921 3300037471 Ga0395905_0005716 Ga0395905_0005716_4949_5254 99
922 3300037471 Ga0395905_0027711 Ga0395905_0027711_4611_4919 99
923 3300037471 Ga0395905_0032667 Ga0395905_0032667_2285_2593 99
924 3300037471 Ga0395905_0033887 Ga0395905_0033887_541_846 99
925 3300037471 Ga0395905_0086722 Ga0395905_0086722_977_1285 99
926 3300037471 Ga0395905_0217518 Ga0395905_0217518_1352_1660 99
927 3300037471 Ga0395905_0448182 Ga0395905_0448182_188_496 99
928 3300037471 Ga0395905_0486647 Ga0395905_0486647_24_332 99
929 3300037471 Ga0395905_0534424 Ga0395905_0534424_346_654 99
930 3300037471 Ga0395905_0648102 Ga0395905_0648102_444_752 99
931 3300037471 Ga0395905_0740714 Ga0395905_0740714_282_590 99
932 3300037471 Ga0395905_0941347 Ga0395905_0941347_421_729 99
933 3300037853 Ga0436364_1131197 Ga0436364_1131197_12_320 99
934 3300037853 Ga0436364_1454008 Ga0436364_1454008_1598_1906 99
935 3300038443 Ga0395901_0001602 Ga0395901_0001602_19603_19908 99
936 3300038443 Ga0395901_0003765 Ga0395901_0003765_9512_9817 99
937 3300038443 Ga0395901_0008051 Ga0395901_0008051_9443_9751 99
938 3300038443 Ga0395901_0009363 Ga0395901_0009363_6727_7035 99
939 3300038443 Ga0395901_0016603 Ga0395901_0016603_812_1120 99
940 3300038443 Ga0395901_0021820 Ga0395901_0021820_4062_4370 99
941 3300038443 Ga0395901_0034145 Ga0395901_0034145_4115_4423 99
942 3300038443 Ga0395901_0088000 Ga0395901_0088000_2052_2360 99
943 3300038443 Ga0395901_0105320 Ga0395901_0105320_2260_2568 99
944 3300038443 Ga0395901_0144006 Ga0395901_0144006_1915_2223 99
945 3300038443 Ga0395901_0294812 Ga0395901_0294812_1142_1450 99
946 3300038443 Ga0395901_0404626 Ga0395901_0404626_738_1046 99
947 3300038443 Ga0395901_0438974 Ga0395901_0438974_183_491 99
948 3300038443 Ga0395901_0439358 Ga0395901_0439358_22_330 99
949 3300038443 Ga0395901_0458306 Ga0395901_0458306_769_1077 99
950 3300038443 Ga0395901_0538128 Ga0395901_0538128_610_933 99
951 3300038443 Ga0395901_0587490 Ga0395901_0587490_397_705 99
952 3300038443 Ga0395901_0590979 Ga0395901_0590979_203_511 99
953 3300038443 Ga0395901_0677677 Ga0395901_0677677_393_701 99
954 3300038443 Ga0395901_0769673 Ga0395901_0769673_171_479 99
955 3300038443 Ga0395901_0918550 Ga0395901_0918550_101_409 99
956 3300038443 Ga0395901_1018917 Ga0395901_1018917_97_405 99
957 3300038443 Ga0395901_1053280 Ga0395901_1053280_377_685 99
958 3300038443 Ga0395901_1056529 Ga0395901_1056529_82_387 99
959 3300038443 Ga0395901_1751176 Ga0395901_1751176_142_450 99
960 3300038443 Ga0395901_1781261 Ga0395901_1781261_247_555 99
961 3300038443 Ga0395901_1788133 Ga0395901_1788133_22_330 99
962 3300039437 Ga0436365_0067507 Ga0436365_0067507_1083_1391 99
963 3300039437 Ga0436365_0599127 Ga0436365_0599127_159_467 99
964 3300039437 Ga0436365_0750374 Ga0436365_0750374_285_584 99
965 3300039437 Ga0436365_1780358 Ga0436365_1780358_2736_3044 99
966 3300039438 Ga0436360_0073679 Ga0436360_0073679_325_633 99
967 3300039438 Ga0436360_1164661 Ga0436360_1164661_837_1145 99
968 3300039450 Ga0436363_0447391 Ga0436363_0447391_444_752 99
969 3300039450 Ga0436363_0448316 Ga0436363_0448316_888_1196 99
970 3300039450 Ga0436363_0547070 Ga0436363_0547070_233_541 99
971 3300039450 Ga0436363_0626821 Ga0436363_0626821_24_332 99
972 3300039450 Ga0436363_1519970 Ga0436363_1519970_340_648 99
973 3300039450 Ga0436363_1708364 Ga0436363_1708364_277_585 99
974 3300039453 Ga0436362_1214113 Ga0436362_1214113_59_367 99
975 3300039453 Ga0436362_1245687 Ga0436362_1245687_946_1254 99
976 3300041443 Ga0451789_0482524 Ga0451789_0482524_301_600 99
977 3300041443 Ga0451789_1028427 Ga0451789_1028427_173_472 99
978 3300041458 Ga0451798_0502003 Ga0451798_0502003_90_398 99
979 3300041496 Ga0451839_1239118 Ga0451839_1239118_145_543 99
980 3300041507 Ga0451851_1270938 Ga0451851_1270938_129_437 99
981 3300041511 Ga0451855_1786676 Ga0451855_1786676_42_371 99
982 3300041512 Ga0451853_2053074 Ga0451853_2053074_210_518 99
983 3300041512 Ga0451853_2822760 Ga0451853_2822760_30_335 99
984 3300041512 Ga0451853_3501075 Ga0451853_3501075_23_340 99
985 3300041512 Ga0451853_3804591 Ga0451853_3804591_134_442 99
986 3300042005 Ga0439448_0188532 Ga0439448_0188532_11_319 99
987 3300042142 Ga0450905_032091 Ga0450905_032091_308_622 99
988 3300042157 Ga0439458_0117295 Ga0439458_0117295_195_503 99
989 3300042436 Ga0439435_0100097 Ga0439435_0100097_501_809 99
990 3300042993 Ga0439440_0076101 Ga0439440_0076101_516_815 99
991 3300044656 Ga0466969_0400100 Ga0466969_0400100_82_390 99
992 3300044683 Ga0466965_0342316 Ga0466965_0342316_378_686 99
993 3300044683 Ga0466965_0391041 Ga0466965_0391041_96_404 99
994 3300044684 Ga0466966_0023576 Ga0466966_0023576_1761_2069 99
995 3300044684 Ga0466966_0039616 Ga0466966_0039616_1398_1706 99
996 3300044684 Ga0466966_0092676 Ga0466966_0092676_1178_1486 99
997 3300044684 Ga0466966_0108913 Ga0466966_0108913_368_676 99
998 3300044684 Ga0466966_0798311 Ga0466966_0798311_187_495 99
999 3300044693 Ga0466961_0032934 Ga0466961_0032934_2081_2389 99
1000 3300044693 Ga0466961_0036106 Ga0466961_0036106_1138_1446 99
1001 3300044693 Ga0466961_0851472 Ga0466961_0851472_205_513 99
1002 3300044694 Ga0466963_0015589 Ga0466963_0015589_4274_4582 99
1003 3300044694 Ga0466963_0026028 Ga0466963_0026028_2952_3260 99
1004 3300044694 Ga0466963_0046586 Ga0466963_0046586_677_985 99
1005 3300044694 Ga0466963_0056010 Ga0466963_0056010_1975_2283 99
1006 3300044694 Ga0466963_0118327 Ga0466963_0118327_471_791 99
1007 3300044694 Ga0466963_0127612 Ga0466963_0127612_426_734 99
1008 3300044694 Ga0466963_0162405 Ga0466963_0162405_208_516 99
1009 3300044694 Ga0466963_0203528 Ga0466963_0203528_887_1195 99
1010 3300044694 Ga0466963_0231198 Ga0466963_0231198_582_890 99
1011 3300044694 Ga0466963_0249955 Ga0466963_0249955_405_713 99
1012 3300044694 Ga0466963_0274003 Ga0466963_0274003_149_457 99
1013 3300044694 Ga0466963_0489257 Ga0466963_0489257_258_566 99
1014 3300044694 Ga0466963_0526695 Ga0466963_0526695_498_806 99
1015 3300044694 Ga0466963_0654817 Ga0466963_0654817_354_662 99
1016 3300044694 Ga0466963_0836227 Ga0466963_0836227_283_591 99
1017 3300044694 Ga0466963_1054582 Ga0466963_1054582_40_348 99
1018 3300044706 Ga0466964_0005428 Ga0466964_0005428_3426_3734 99
1019 3300044706 Ga0466964_0128129 Ga0466964_0128129_145_453 99
1020 3300044706 Ga0466964_0209127 Ga0466964_0209127_184_492 99
1021 3300044719 Ga0466971_0072817 Ga0466971_0072817_455_763 99
1022 3300044719 Ga0466971_0448265 Ga0466971_0448265_235_543 99
1023 3300044765 Ga0466970_0083348 Ga0466970_0083348_1095_1403 99
1024 3300044842 Ga0466957_0069577 Ga0466957_0069577_1711_2019 99
1025 3300044842 Ga0466957_0074010 Ga0466957_0074010_1080_1388 99
1026 3300044842 Ga0466957_0363069 Ga0466957_0363069_194_502 99
1027 3300044842 Ga0466957_0369621 Ga0466957_0369621_210_518 99
1028 3300044842 Ga0466957_0424808 Ga0466957_0424808_154_462 99
1029 3300044842 Ga0466957_0447947 Ga0466957_0447947_186_494 99
1030 3300044901 Ga0466960_0213003 Ga0466960_0213003_350_658 99
1031 3300044901 Ga0466960_0325042 Ga0466960_0325042_266_565 99
1032 3300045049 Ga0466959_0009367 Ga0466959_0009367_5085_5393 99
1033 3300045049 Ga0466959_0077533 Ga0466959_0077533_1114_1422 99
1034 3300045049 Ga0466959_0115486 Ga0466959_0115486_835_1143 99
1035 3300045051 Ga0451576_0067477 Ga0451576_0067477_818_1126 99
1036 3300045051 Ga0451576_0314601 Ga0451576_0314601_312_620 99
1037 3300045051 Ga0451576_0627749 Ga0451576_0627749_24_332 99
1038 3300045051 Ga0451576_1212771 Ga0451576_1212771_189_497 99
1039 3300045051 Ga0451576_1432563 Ga0451576_1432563_364_672 99
1040 3300045051 Ga0451576_2669723 Ga0451576_2669723_85_393 99
1041 3300045836 Ga0466958_0007119 Ga0466958_0007119_5220_5528 99
1042 3300045836 Ga0466958_0149582 Ga0466958_0149582_1086_1394 99
1043 3300045836 Ga0466958_0373963 Ga0466958_0373963_525_833 99
1044 3300045976 Ga0466967_0002999 Ga0466967_0002999_5502_5810 99
1045 3300045976 Ga0466967_0015237 Ga0466967_0015237_3982_4290 99
1046 3300045976 Ga0466967_0033741 Ga0466967_0033741_3121_3429 99
1047 3300045976 Ga0466967_0082194 Ga0466967_0082194_1559_1867 99
1048 3300045976 Ga0466967_0094907 Ga0466967_0094907_2095_2403 99
1049 3300045976 Ga0466967_0100594 Ga0466967_0100594_1066_1374 99
1050 3300045976 Ga0466967_0214709 Ga0466967_0214709_670_978 99
1051 3300045976 Ga0466967_0245844 Ga0466967_0245844_163_471 99
1052 3300045976 Ga0466967_0249885 Ga0466967_0249885_611_919 99
1053 3300045976 Ga0466967_0252482 Ga0466967_0252482_377_685 99
1054 3300045976 Ga0466967_0270342 Ga0466967_0270342_727_1035 99
1055 3300045976 Ga0466967_0464003 Ga0466967_0464003_10_318 99
1056 3300045976 Ga0466967_0620458 Ga0466967_0620458_386_694 99
1057 3300045976 Ga0466967_0717845 Ga0466967_0717845_226_534 99
1058 3300045976 Ga0466967_1014816 Ga0466967_1014816_490_798 99
1059 3300045976 Ga0466967_1302180 Ga0466967_1302180_203_508 99
1060 3300045976 Ga0466967_1331200 Ga0466967_1331200_257_565 99
1061 3300045976 Ga0466967_1454907 Ga0466967_1454907_239_547 99
1062 3300045976 Ga0466967_1531729 Ga0466967_1531729_130_450 99
1063 3300045976 Ga0466967_1761242 Ga0466967_1761242_161_469 99
1064 3300045976 Ga0466967_1993530 Ga0466967_1993530_108_416 99
1065 3300045976 Ga0466967_2428123 Ga0466967_2428123_120_428 99
1066 3300046454 Ga0495592_0083218 Ga0495592_0083218_923_1231 99
1067 3300046454 Ga0495592_0098966 Ga0495592_0098966_478_786 99
1068 3300046454 Ga0495592_0145270 Ga0495592_0145270_373_681 99
1069 3300046454 Ga0495592_0295010 Ga0495592_0295010_719_1027 99
1070 3300046454 Ga0495592_0821403 Ga0495592_0821403_130_438 99
1071 3300046455 Ga0495603_0041158 Ga0495603_0041158_1831_2136 99
1072 3300046455 Ga0495603_0166592 Ga0495603_0166592_471_779 99
1073 3300046455 Ga0495603_0468236 Ga0495603_0468236_45_353 99
1074 3300046455 Ga0495603_0535410 Ga0495603_0535410_190_498 99
1075 3300046459 Ga0495629_0003081 Ga0495629_0003081_11266_11574 99
1076 3300046459 Ga0495629_0302462 Ga0495629_0302462_392_700 99
1077 3300046459 Ga0495629_0944248 Ga0495629_0944248_10_318 99
1078 3300046461 Ga0495641_0000633 Ga0495641_0000633_28093_28401 99
1079 3300046461 Ga0495641_0036815 Ga0495641_0036815_594_902 99
1080 3300046461 Ga0495641_0116005 Ga0495641_0116005_140_448 99
1081 3300046461 Ga0495641_0485116 Ga0495641_0485116_65_373 99
1082 3300046461 Ga0495641_0538529 Ga0495641_0538529_26_334 99
1083 3300046462 Ga0495651_0037339 Ga0495651_0037339_2207_2515 99
1084 3300046462 Ga0495651_0115497 Ga0495651_0115497_926_1234 99
1085 3300046462 Ga0495651_0189718 Ga0495651_0189718_437_745 99
1086 3300046462 Ga0495651_0199357 Ga0495651_0199357_943_1251 99
1087 3300046463 Ga0495653_0038942 Ga0495653_0038942_2548_2856 99
1088 3300046463 Ga0495653_0047895 Ga0495653_0047895_590_898 99
1089 3300046463 Ga0495653_0075718 Ga0495653_0075718_1701_2009 99
1090 3300046463 Ga0495653_0203238 Ga0495653_0203238_74_382 99
1091 3300046463 Ga0495653_0207628 Ga0495653_0207628_552_860 99
1092 3300046463 Ga0495653_0337490 Ga0495653_0337490_552_860 99
1093 3300046463 Ga0495653_0558759 Ga0495653_0558759_154_462 99
1094 3300046472 Ga0495580_0462080 Ga0495580_0462080_266_574 99
1095 3300046473 Ga0495582_0006691 Ga0495582_0006691_1160_1468 99
1096 3300046473 Ga0495582_0040170 Ga0495582_0040170_2162_2470 99
1097 3300046473 Ga0495582_0149757 Ga0495582_0149757_381_689 99
1098 3300046473 Ga0495582_0173535 Ga0495582_0173535_132_440 99
1099 3300046473 Ga0495582_0188318 Ga0495582_0188318_101_409 99
1100 3300046473 Ga0495582_0236691 Ga0495582_0236691_193_501 99
1101 3300046473 Ga0495582_0318876 Ga0495582_0318876_386_694 99
1102 3300046473 Ga0495582_0455130 Ga0495582_0455130_283_591 99
1103 3300046473 Ga0495582_0693094 Ga0495582_0693094_103_408 99
1104 3300046473 Ga0495582_0782298 Ga0495582_0782298_73_381 99
1105 3300046474 Ga0495605_0061224 Ga0495605_0061224_445_753 99
1106 3300046475 Ga0495639_0000351 Ga0495639_0000351_1148_1456 99
1107 3300046475 Ga0495639_0117194 Ga0495639_0117194_413_721 99
1108 3300046476 Ga0495662_0259121 Ga0495662_0259121_88_396 99
1109 3300046476 Ga0495662_0354015 Ga0495662_0354015_256_561 99
1110 3300046476 Ga0495662_0579057 Ga0495662_0579057_24_332 99
1111 3300046477 Ga0495664_0198759 Ga0495664_0198759_732_1040 99
1112 3300046477 Ga0495664_0337192 Ga0495664_0337192_434_742 99
1113 3300046477 Ga0495664_0497468 Ga0495664_0497468_249_557 99
1114 3300046491 Ga0495584_0100617 Ga0495584_0100617_711_1016 99
1115 3300046491 Ga0495584_0535936 Ga0495584_0535936_103_408 99
1116 3300046501 Ga0495607_0506108 Ga0495607_0506108_169_477 99
1117 3300046511 Ga0495608_0043582 Ga0495608_0043582_614_922 99
1118 3300046511 Ga0495608_0223208 Ga0495608_0223208_98_406 99
1119 3300046511 Ga0495608_0460377 Ga0495608_0460377_82_390 99
1120 3300046514 Ga0495618_0069406 Ga0495618_0069406_993_1301 99
1121 3300046514 Ga0495618_0086481 Ga0495618_0086481_565_873 99
1122 3300046514 Ga0495618_0124447 Ga0495618_0124447_951_1259 99
1123 3300046514 Ga0495618_0322057 Ga0495618_0322057_485_793 99
1124 3300046514 Ga0495618_0658366 Ga0495618_0658366_50_358 99
1125 3300046516 Ga0495628_0206062 Ga0495628_0206062_696_1004 99
1126 3300046516 Ga0495628_0421922 Ga0495628_0421922_66_374 99
1127 3300046516 Ga0495628_0427578 Ga0495628_0427578_246_554 99
1128 3300046516 Ga0495628_0611683 Ga0495628_0611683_311_619 99
1129 3300046516 Ga0495628_0687056 Ga0495628_0687056_35_343 99
1130 3300046517 Ga0495630_0006233 Ga0495630_0006233_2992_3300 99
1131 3300046517 Ga0495630_0017976 Ga0495630_0017976_3689_3997 99
1132 3300046517 Ga0495630_0115386 Ga0495630_0115386_724_1032 99
1133 3300046517 Ga0495630_0195661 Ga0495630_0195661_1002_1310 99
1134 3300046517 Ga0495630_0352818 Ga0495630_0352818_362_670 99
1135 3300046517 Ga0495630_0444676 Ga0495630_0444676_493_801 99
1136 3300046517 Ga0495630_0497595 Ga0495630_0497595_565_873 99
1137 3300046517 Ga0495630_1393677 Ga0495630_1393677_59_367 99
1138 3300046518 Ga0495631_0177510 Ga0495631_0177510_584_892 99
1139 3300046526 Ga0495666_0037233 Ga0495666_0037233_738_1046 99
1140 3300046528 Ga0495642_0394500 Ga0495642_0394500_33_338 99
1141 3300046529 Ga0495652_0020964 Ga0495652_0020964_486_794 99
1142 3300046529 Ga0495652_0153521 Ga0495652_0153521_568_873 99
1143 3300046529 Ga0495652_0201844 Ga0495652_0201844_1015_1323 99
1144 3300046529 Ga0495652_0597223 Ga0495652_0597223_143_451 99
1145 3300046529 Ga0495652_0810157 Ga0495652_0810157_67_375 99
1146 3300046531 Ga0495665_0000274 Ga0495665_0000274_17590_17898 99
1147 3300046531 Ga0495665_0091015 Ga0495665_0091015_774_1082 99
1148 3300046531 Ga0495665_0184329 Ga0495665_0184329_560_868 99
1149 3300046533 Ga0495640_0027257 Ga0495640_0027257_131_439 99
1150 3300046533 Ga0495640_0045197 Ga0495640_0045197_755_1063 99
1151 3300046533 Ga0495640_0450430 Ga0495640_0450430_56_364 99
1152 3300046533 Ga0495640_0685054 Ga0495640_0685054_170_478 99
1153 3300046533 Ga0495640_0890081 Ga0495640_0890081_76_384 99
1154 3300046535 Ga0495586_0026693 Ga0495586_0026693_2072_2380 99
1155 3300046535 Ga0495586_0303698 Ga0495586_0303698_400_708 99
1156 3300046535 Ga0495586_0593319 Ga0495586_0593319_186_494 99
1157 3300046536 Ga0495587_0073386 Ga0495587_0073386_1172_1480 99
1158 3300046536 Ga0495587_0128420 Ga0495587_0128420_398_706 99
1159 3300046536 Ga0495587_0180984 Ga0495587_0180984_268_576 99
1160 3300046536 Ga0495587_0640534 Ga0495587_0640534_147_452 99
1161 3300046543 Ga0495645_0101193 Ga0495645_0101193_564_872 99
1162 3300046543 Ga0495645_0110155 Ga0495645_0110155_1013_1321 99
1163 3300046543 Ga0495645_0300646 Ga0495645_0300646_375_683 99
1164 3300046543 Ga0495645_0470787 Ga0495645_0470787_79_387 99
1165 3300046543 Ga0495645_0949740 Ga0495645_0949740_125_433 99
1166 3300046557 Ga0495622_0385052 Ga0495622_0385052_12_320 99
1167 3300046559 Ga0495667_0020239 Ga0495667_0020239_3482_3790 99
1168 3300046559 Ga0495667_0053339 Ga0495667_0053339_2076_2384 99
1169 3300046559 Ga0495667_0304481 Ga0495667_0304481_631_939 99
1170 3300046559 Ga0495667_0383897 Ga0495667_0383897_107_415 99
1171 3300046559 Ga0495667_0494568 Ga0495667_0494568_215_523 99
1172 3300046642 Ga0495634_0088789 Ga0495634_0088789_875_1183 99
1173 3300046642 Ga0495634_0113596 Ga0495634_0113596_1218_1526 99
1174 3300046642 Ga0495634_0141945 Ga0495634_0141945_1017_1325 99
1175 3300046642 Ga0495634_0341170 Ga0495634_0341170_456_764 99
1176 3300046642 Ga0495634_0507097 Ga0495634_0507097_387_695 99
1177 3300046663 Ga0495635_0102266 Ga0495635_0102266_956_1264 99
1178 3300046663 Ga0495635_0106274 Ga0495635_0106274_1588_1896 99
1179 3300046663 Ga0495635_0224466 Ga0495635_0224466_435_743 99
1180 3300046663 Ga0495635_0242699 Ga0495635_0242699_115_423 99
1181 3300046674 Ga0495588_0102948 Ga0495588_0102948_174_482 99
1182 3300046674 Ga0495588_0507924 Ga0495588_0507924_30_335 99
1183 3300046675 Ga0495657_0074825 Ga0495657_0074825_858_1166 99
1184 3300046675 Ga0495657_0154543 Ga0495657_0154543_396_704 99
1185 3300046675 Ga0495657_0201719 Ga0495657_0201719_203_511 99
1186 3300046675 Ga0495657_0343945 Ga0495657_0343945_503_811 99
1187 3300046678 Ga0495599_0104639 Ga0495599_0104639_1273_1581 99
1188 3300046678 Ga0495599_0146385 Ga0495599_0146385_761_1069 99
1189 3300046679 Ga0495623_0133486 Ga0495623_0133486_1142_1450 99
1190 3300046679 Ga0495623_0135084 Ga0495623_0135084_209_517 99
1191 3300046679 Ga0495623_0511546 Ga0495623_0511546_88_396 99
1192 3300046680 Ga0495646_0174185 Ga0495646_0174185_856_1164 99
1193 3300046680 Ga0495646_0235876 Ga0495646_0235876_52_360 99
1194 3300046680 Ga0495646_0674835 Ga0495646_0674835_93_401 99
1195 3300046681 Ga0495647_0002495 Ga0495647_0002495_3820_4128 99
1196 3300046681 Ga0495647_0058524 Ga0495647_0058524_81_389 99
1197 3300046681 Ga0495647_0096751 Ga0495647_0096751_198_503 99
1198 3300046681 Ga0495647_0287366 Ga0495647_0287366_168_473 99
1199 3300046683 Ga0495658_0000218 Ga0495658_0000218_1191_1499 99
1200 3300046683 Ga0495658_0042449 Ga0495658_0042449_1661_1969 99
1201 3300046689 Ga0495613_0016463 Ga0495613_0016463_3992_4300 99
1202 3300046689 Ga0495613_0056887 Ga0495613_0056887_688_996 99
1203 3300046689 Ga0495613_0265974 Ga0495613_0265974_557_865 99
1204 3300046689 Ga0495613_0329175 Ga0495613_0329175_193_501 99
1205 3300046689 Ga0495613_0447706 Ga0495613_0447706_488_796 99
1206 3300046689 Ga0495613_1012431 Ga0495613_1012431_93_401 99
1207 3300046690 Ga0495624_0010999 Ga0495624_0010999_4591_4899 99
1208 3300046690 Ga0495624_0268913 Ga0495624_0268913_293_601 99
1209 3300046690 Ga0495624_0369826 Ga0495624_0369826_108_425 99
1210 3300046691 Ga0495670_0756497 Ga0495670_0756497_86_394 99
1211 3300046794 Ga0495589_0065619 Ga0495589_0065619_1157_1462 99
1212 3300046794 Ga0495589_0180368 Ga0495589_0180368_408_716 99
1213 3300046809 Ga0495600_0054345 Ga0495600_0054345_701_1009 99
1214 3300046809 Ga0495600_0178112 Ga0495600_0178112_362_670 99
1215 3300046809 Ga0495600_0291851 Ga0495600_0291851_540_848 99
1216 3300046809 Ga0495600_0729014 Ga0495600_0729014_174_482 99
1217 3300047315 Ga0495581_0000117 Ga0495581_0000117_21629_21937 99
1218 3300047315 Ga0495581_0030544 Ga0495581_0030544_1859_2167 99
1219 3300047315 Ga0495581_0100129 Ga0495581_0100129_988_1296 99
1220 3300047315 Ga0495581_0519088 Ga0495581_0519088_44_352 99
1221 3300047315 Ga0495581_0744055 Ga0495581_0744055_88_396 99
1222 3300047315 Ga0495581_0823977 Ga0495581_0823977_146_454 99
1223 3300047317 Ga0495604_0663409 Ga0495604_0663409_214_522 99
1224 3300047317 Ga0495604_0964513 Ga0495604_0964513_171_479 99
1225 3300047319 Ga0495674_0007348 Ga0495674_0007348_9836_10144 99
1226 3300047319 Ga0495674_0190071 Ga0495674_0190071_1197_1505 99
1227 3300047319 Ga0495674_0209566 Ga0495674_0209566_1013_1321 99
1228 3300047319 Ga0495674_0365006 Ga0495674_0365006_764_1072 99
1229 3300047319 Ga0495674_1446885 Ga0495674_1446885_162_470 99
1230 3300047319 Ga0495674_1457464 Ga0495674_1457464_43_351 99
1231 3300047320 Ga0495672_0188038 Ga0495672_0188038_462_767 99
1232 3300047321 Ga0495676_0003989 Ga0495676_0003989_5689_5997 99
1233 3300047321 Ga0495676_0056283 Ga0495676_0056283_239_547 99
1234 3300047321 Ga0495676_0127302 Ga0495676_0127302_1131_1439 99
1235 3300047321 Ga0495676_0167665 Ga0495676_0167665_486_794 99
1236 3300047321 Ga0495676_0192230 Ga0495676_0192230_287_595 99
1237 3300047321 Ga0495676_0359006 Ga0495676_0359006_429_737 99
1238 3300047321 Ga0495676_0373417 Ga0495676_0373417_624_932 99
1239 3300047321 Ga0495676_0484537 Ga0495676_0484537_346_651 99
1240 3300047321 Ga0495676_0728271 Ga0495676_0728271_312_620 99
1241 3300047322 Ga0495680_0002114 Ga0495680_0002114_4180_4488 99
1242 3300047322 Ga0495680_0028928 Ga0495680_0028928_1016_1324 99
1243 3300047322 Ga0495680_0056597 Ga0495680_0056597_1898_2206 99
1244 3300047322 Ga0495680_0085540 Ga0495680_0085540_389_697 99
1245 3300047322 Ga0495680_0118901 Ga0495680_0118901_49_357 99
1246 3300047322 Ga0495680_0272660 Ga0495680_0272660_451_759 99
1247 3300047322 Ga0495680_0539555 Ga0495680_0539555_450_758 99
1248 3300047322 Ga0495680_0578331 Ga0495680_0578331_312_620 99
1249 3300047322 Ga0495680_0698435 Ga0495680_0698435_177_482 99
1250 3300047322 Ga0495680_0733539 Ga0495680_0733539_318_626 99
1251 3300047322 Ga0495680_0911574 Ga0495680_0911574_14_322 99
1252 3300047444 Ga0495675_0299760 Ga0495675_0299760_182_490 99
1253 3300047445 Ga0495677_0359463 Ga0495677_0359463_37_342 99
1254 3300047471 Ga0495684_0002917 Ga0495684_0002917_12213_12521 99
1255 3300047471 Ga0495684_0187218 Ga0495684_0187218_758_1066 99
1256 3300047471 Ga0495684_0308364 Ga0495684_0308364_793_1101 99
1257 3300047471 Ga0495684_0568609 Ga0495684_0568609_141_449 99
1258 3300047471 Ga0495684_0617130 Ga0495684_0617130_266_574 99
1259 3300047471 Ga0495684_0927921 Ga0495684_0927921_44_352 99
1260 3300047673 Ga0495593_0009832 Ga0495593_0009832_4204_4512 99
1261 3300047673 Ga0495593_0123789 Ga0495593_0123789_653_961 99
1262 3300048088 Ga0495602_0113346 Ga0495602_0113346_1416_1724 99
1263 3300048088 Ga0495602_0171938 Ga0495602_0171938_1017_1325 99
1264 3300048088 Ga0495602_0816617 Ga0495602_0816617_129_437 99
1265 3300048089 Ga0495614_0003253 Ga0495614_0003253_4629_4937 99
1266 3300048091 Ga0495626_0390791 Ga0495626_0390791_142_450 99
1267 3300048903 Ga0496100_0008861 Ga0496100_0008861_1210_1515 99
1268 3300048903 Ga0496100_0012414 Ga0496100_0012414_500_808 99
1269 3300048903 Ga0496100_0015206 Ga0496100_0015206_886_1191 99
1270 3300048903 Ga0496100_0043630 Ga0496100_0043630_569_877 99
1271 3300048903 Ga0496100_0080043 Ga0496100_0080043_494_802 99
1272 3300048903 Ga0496100_0227111 Ga0496100_0227111_522_827 99
1273 3300048903 Ga0496100_0322121 Ga0496100_0322121_316_624 99
1274 3300048903 Ga0496100_0741269 Ga0496100_0741269_385_693 99
1275 3300048903 Ga0496100_0801187 Ga0496100_0801187_142_450 99
1276 3300048903 Ga0496100_0916810 Ga0496100_0916810_122_430 99
1277 3300048903 Ga0496100_1636804 Ga0496100_1636804_37_345 99
1278 3300048904 Ga0496101_0000774 Ga0496101_0000774_10338_10646 99
1279 3300048904 Ga0496101_0016448 Ga0496101_0016448_3230_3535 99
1280 3300048904 Ga0496101_0066829 Ga0496101_0066829_1410_1718 99
1281 3300048904 Ga0496101_0067743 Ga0496101_0067743_2184_2489 99
1282 3300048904 Ga0496101_0078525 Ga0496101_0078525_1928_2236 99
1283 3300048904 Ga0496101_0100095 Ga0496101_0100095_1404_1703 99
1284 3300048904 Ga0496101_0198960 Ga0496101_0198960_885_1193 99
1285 3300048904 Ga0496101_0251338 Ga0496101_0251338_958_1266 99
1286 3300048904 Ga0496101_0339014 Ga0496101_0339014_372_680 99
1287 3300048904 Ga0496101_0448764 Ga0496101_0448764_516_821 99
1288 3300048904 Ga0496101_0471988 Ga0496101_0471988_415_720 99
1289 3300048904 Ga0496101_0504421 Ga0496101_0504421_436_744 99
1290 3300048904 Ga0496101_0690809 Ga0496101_0690809_338_646 99
1291 3300048904 Ga0496101_1109149 Ga0496101_1109149_165_473 99
1292 3300048904 Ga0496101_1122420 Ga0496101_1122420_127_435 99
1293 3300048904 Ga0496101_1321149 Ga0496101_1321149_137_445 99
1294 3300048904 Ga0496101_1322007 Ga0496101_1322007_120_428 99
1295 3300048905 Ga0496102_0005009 Ga0496102_0005009_7262_7567 99
1296 3300048905 Ga0496102_0005080 Ga0496102_0005080_10557_10865 99
1297 3300048905 Ga0496102_0013886 Ga0496102_0013886_393_701 99
1298 3300048905 Ga0496102_0016329 Ga0496102_0016329_6046_6354 99
1299 3300048905 Ga0496102_0229786 Ga0496102_0229786_547_855 99
1300 3300048905 Ga0496102_0322552 Ga0496102_0322552_282_590 99
1301 3300048905 Ga0496102_0370947 Ga0496102_0370947_733_1038 99
1302 3300048905 Ga0496102_0392899 Ga0496102_0392899_775_1080 99
1303 3300048905 Ga0496102_0423051 Ga0496102_0423051_596_904 99
1304 3300048905 Ga0496102_0448481 Ga0496102_0448481_350_658 99
1305 3300048905 Ga0496102_0554996 Ga0496102_0554996_143_448 99
1306 3300048905 Ga0496102_1074585 Ga0496102_1074585_199_507 99
1307 3300048905 Ga0496102_1394655 Ga0496102_1394655_284_592 99
1308 3300048905 Ga0496102_1477600 Ga0496102_1477600_98_406 99
1309 3300048905 Ga0496102_1647773 Ga0496102_1647773_75_383 99
1310 3300048906 Ga0496103_0019716 Ga0496103_0019716_1830_2135 99
1311 3300048906 Ga0496103_0024235 Ga0496103_0024235_1554_1859 99
1312 3300048906 Ga0496103_0080336 Ga0496103_0080336_1222_1530 99
1313 3300048906 Ga0496103_0160212 Ga0496103_0160212_83_388 99
1314 3300048906 Ga0496103_0296573 Ga0496103_0296573_60_368 99
1315 3300048906 Ga0496103_0381694 Ga0496103_0381694_214_519 99
1316 3300048906 Ga0496103_0482060 Ga0496103_0482060_132_440 99
1317 3300048906 Ga0496103_0579918 Ga0496103_0579918_260_565 99
1318 3300048906 Ga0496103_0586930 Ga0496103_0586930_370_678 99
1319 3300048907 Ga0496104_0000803 Ga0496104_0000803_23730_24038 99
1320 3300048907 Ga0496104_0000834 Ga0496104_0000834_19592_19900 99
1321 3300048907 Ga0496104_0009234 Ga0496104_0009234_6971_7276 99
1322 3300048907 Ga0496104_0037070 Ga0496104_0037070_3709_4017 99
1323 3300048907 Ga0496104_0050328 Ga0496104_0050328_1609_1917 99
1324 3300048907 Ga0496104_0056772 Ga0496104_0056772_2349_2657 99
1325 3300048907 Ga0496104_0073268 Ga0496104_0073268_158_463 99
1326 3300048907 Ga0496104_0093602 Ga0496104_0093602_2320_2625 99
1327 3300048907 Ga0496104_0121706 Ga0496104_0121706_1857_2165 99
1328 3300048907 Ga0496104_0158295 Ga0496104_0158295_1438_1746 99
1329 3300048907 Ga0496104_0196231 Ga0496104_0196231_1244_1552 99
1330 3300048907 Ga0496104_0210803 Ga0496104_0210803_377_685 99
1331 3300048907 Ga0496104_0934356 Ga0496104_0934356_218_526 99
1332 3300048907 Ga0496104_1224720 Ga0496104_1224720_263_571 99
1333 3300048907 Ga0496104_1638948 Ga0496104_1638948_228_536 99
1334 3300048907 Ga0496104_1709398 Ga0496104_1709398_32_340 99
1335 3300048907 Ga0496104_1779776 Ga0496104_1779776_50_358 99
1336 3300048907 Ga0496104_1815606 Ga0496104_1815606_141_449 99
1337 3300048908 Ga0496105_0001655 Ga0496105_0001655_13134_13439 99
1338 3300048908 Ga0496105_0003459 Ga0496105_0003459_10171_10479 99
1339 3300048908 Ga0496105_0008010 Ga0496105_0008010_1242_1550 99
1340 3300048908 Ga0496105_0008029 Ga0496105_0008029_4369_4677 99
1341 3300048908 Ga0496105_0056857 Ga0496105_0056857_2759_3067 99
1342 3300048908 Ga0496105_0097749 Ga0496105_0097749_119_427 99
1343 3300048908 Ga0496105_0190531 Ga0496105_0190531_824_1132 99
1344 3300048908 Ga0496105_0837569 Ga0496105_0837569_57_365 99
1345 3300048909 Ga0496106_0016392 Ga0496106_0016392_2851_3156 99
1346 3300048909 Ga0496106_0023552 Ga0496106_0023552_1735_2043 99
1347 3300048909 Ga0496106_0025035 Ga0496106_0025035_2631_2939 99
1348 3300048909 Ga0496106_0120202 Ga0496106_0120202_1401_1709 99
1349 3300048909 Ga0496106_0195849 Ga0496106_0195849_34_333 99
1350 3300048909 Ga0496106_0289690 Ga0496106_0289690_542_847 99
1351 3300048909 Ga0496106_0483978 Ga0496106_0483978_528_836 99
1352 3300048909 Ga0496106_0632052 Ga0496106_0632052_507_815 99
1353 3300048909 Ga0496106_0685953 Ga0496106_0685953_74_382 99
1354 3300048909 Ga0496106_0932676 Ga0496106_0932676_356_661 99
1355 3300048909 Ga0496106_1089877 Ga0496106_1089877_15_323 99
1356 3300048910 Ga0496107_0005156 Ga0496107_0005156_3504_3812 99
1357 3300048910 Ga0496107_0026047 Ga0496107_0026047_2744_3043 99
1358 3300048910 Ga0496107_0050182 Ga0496107_0050182_2672_2977 99
1359 3300048910 Ga0496107_0060190 Ga0496107_0060190_1013_1318 99
1360 3300048910 Ga0496107_0106284 Ga0496107_0106284_537_845 99
1361 3300048910 Ga0496107_0145834 Ga0496107_0145834_1065_1373 99
1362 3300048910 Ga0496107_0256787 Ga0496107_0256787_208_513 99
1363 3300048910 Ga0496107_0293929 Ga0496107_0293929_499_807 99
1364 3300048910 Ga0496107_0578388 Ga0496107_0578388_30_335 99
1365 3300048910 Ga0496107_0725150 Ga0496107_0725150_234_539 99
1366 3300048911 Ga0496108_0008538 Ga0496108_0008538_4522_4821 99
1367 3300048911 Ga0496108_0028731 Ga0496108_0028731_2839_3147 99
1368 3300048911 Ga0496108_0156093 Ga0496108_0156093_1197_1502 99
1369 3300048911 Ga0496108_0232982 Ga0496108_0232982_510_818 99
1370 3300048911 Ga0496108_0266993 Ga0496108_0266993_252_560 99
1371 3300048911 Ga0496108_0386988 Ga0496108_0386988_722_1030 99
1372 3300048911 Ga0496108_0404181 Ga0496108_0404181_147_452 99
1373 3300048911 Ga0496108_0421697 Ga0496108_0421697_634_939 99
1374 3300048911 Ga0496108_0488623 Ga0496108_0488623_370_678 99
1375 3300048911 Ga0496108_0568297 Ga0496108_0568297_443_751 99
1376 3300048911 Ga0496108_1698506 Ga0496108_1698506_101_409 99
1377 3300048912 Ga0496109_0000662 Ga0496109_0000662_4654_4962 99
1378 3300048912 Ga0496109_0017634 Ga0496109_0017634_4898_5206 99
1379 3300048912 Ga0496109_0018180 Ga0496109_0018180_3458_3763 99
1380 3300048912 Ga0496109_0044381 Ga0496109_0044381_1125_1430 99
1381 3300048912 Ga0496109_0083893 Ga0496109_0083893_640_939 99
1382 3300048912 Ga0496109_0085004 Ga0496109_0085004_960_1265 99
1383 3300048912 Ga0496109_0161105 Ga0496109_0161105_785_1090 99
1384 3300048912 Ga0496109_0260103 Ga0496109_0260103_1170_1478 99
1385 3300048912 Ga0496109_0266739 Ga0496109_0266739_1260_1568 99
1386 3300048912 Ga0496109_0368815 Ga0496109_0368815_483_791 99
1387 3300048912 Ga0496109_0437280 Ga0496109_0437280_537_845 99
1388 3300048912 Ga0496109_0495702 Ga0496109_0495702_813_1121 99
1389 3300048912 Ga0496109_0846638 Ga0496109_0846638_426_734 99
1390 3300048912 Ga0496109_0861504 Ga0496109_0861504_440_745 99
1391 3300048912 Ga0496109_0872147 Ga0496109_0872147_10_318 99
1392 3300048912 Ga0496109_0901169 Ga0496109_0901169_475_780 99
1393 3300048912 Ga0496109_1151034 Ga0496109_1151034_381_689 99
1394 3300048912 Ga0496109_1337083 Ga0496109_1337083_231_539 99
1395 3300048912 Ga0496109_1498244 Ga0496109_1498244_18_323 99
1396 3300048913 Ga0496110_0000069 Ga0496110_0000069_38994_39302 99
1397 3300048913 Ga0496110_0014207 Ga0496110_0014207_98_403 99
1398 3300048913 Ga0496110_0029772 Ga0496110_0029772_1774_2073 99
1399 3300048913 Ga0496110_0040288 Ga0496110_0040288_2405_2710 99
1400 3300048913 Ga0496110_0188614 Ga0496110_0188614_510_818 99
1401 3300048913 Ga0496110_0351936 Ga0496110_0351936_379_687 99
1402 3300048913 Ga0496110_0841688 Ga0496110_0841688_461_769 99
1403 3300048913 Ga0496110_1132344 Ga0496110_1132344_306_611 99
1404 3300048913 Ga0496110_1186462 Ga0496110_1186462_328_636 99
1405 3300048913 Ga0496110_1246012 Ga0496110_1246012_189_494 99
1406 3300048913 Ga0496110_1342106 Ga0496110_1342106_207_512 99
1407 3300048913 Ga0496110_1360350 Ga0496110_1360350_40_348 99
1408 3300048913 Ga0496110_1870770 Ga0496110_1870770_138_443 99
1409 3300048914 Ga0496111_0001848 Ga0496111_0001848_7291_7596 99
1410 3300048914 Ga0496111_0017317 Ga0496111_0017317_4301_4609 99
1411 3300048914 Ga0496111_0038999 Ga0496111_0038999_703_1011 99
1412 3300048914 Ga0496111_0168370 Ga0496111_0168370_480_788 99
1413 3300048914 Ga0496111_0313610 Ga0496111_0313610_226_534 99
1414 3300048914 Ga0496111_0317922 Ga0496111_0317922_449_757 99
1415 3300048914 Ga0496111_0329927 Ga0496111_0329927_734_1042 99
1416 3300048914 Ga0496111_0335683 Ga0496111_0335683_587_895 99
1417 3300048914 Ga0496111_0506469 Ga0496111_0506469_570_878 99
1418 3300048914 Ga0496111_1013883 Ga0496111_1013883_279_578 99
1419 3300048915 Ga0496112_0017461 Ga0496112_0017461_204_512 99
1420 3300048915 Ga0496112_0021394 Ga0496112_0021394_4631_4939 99
1421 3300048915 Ga0496112_0038819 Ga0496112_0038819_180_488 99
1422 3300048915 Ga0496112_0052884 Ga0496112_0052884_1016_1324 99
1423 3300048915 Ga0496112_0104501 Ga0496112_0104501_1266_1574 99
1424 3300048915 Ga0496112_0189081 Ga0496112_0189081_1403_1708 99
1425 3300048915 Ga0496112_0214367 Ga0496112_0214367_494_802 99
1426 3300048915 Ga0496112_0319550 Ga0496112_0319550_1072_1380 99
1427 3300048915 Ga0496112_0430227 Ga0496112_0430227_684_989 99
1428 3300048915 Ga0496112_0440026 Ga0496112_0440026_438_743 99
1429 3300048915 Ga0496112_0554556 Ga0496112_0554556_429_737 99
1430 3300048915 Ga0496112_0746635 Ga0496112_0746635_17_325 99
1431 3300048915 Ga0496112_0791987 Ga0496112_0791987_338_637 99
1432 3300048915 Ga0496112_0909601 Ga0496112_0909601_87_395 99
1433 3300048915 Ga0496112_1036516 Ga0496112_1036516_265_570 99
1434 3300048915 Ga0496112_1102623 Ga0496112_1102623_153_461 99
1435 3300048915 Ga0496112_1517643 Ga0496112_1517643_154_459 99
1436 3300048916 Ga0496113_0009763 Ga0496113_0009763_5910_6218 99
1437 3300048916 Ga0496113_0034278 Ga0496113_0034278_1159_1458 99
1438 3300048916 Ga0496113_0363612 Ga0496113_0363612_66_374 99
1439 3300048916 Ga0496113_0440316 Ga0496113_0440316_17_325 99
1440 3300048916 Ga0496113_0444733 Ga0496113_0444733_625_930 99
1441 3300048916 Ga0496113_0760776 Ga0496113_0760776_117_425 99
1442 3300048916 Ga0496113_0917667 Ga0496113_0917667_210_515 99
1443 3300048917 Ga0496114_0000177 Ga0496114_0000177_38415_38723 99
1444 3300048917 Ga0496114_0003444 Ga0496114_0003444_1849_2157 99
1445 3300048917 Ga0496114_0006208 Ga0496114_0006208_31_339 99
1446 3300048917 Ga0496114_0007730 Ga0496114_0007730_4318_4626 99
1447 3300048917 Ga0496114_0022772 Ga0496114_0022772_439_747 99
1448 3300048917 Ga0496114_0025184 Ga0496114_0025184_2863_3168 99
1449 3300048917 Ga0496114_0039017 Ga0496114_0039017_166_471 99
1450 3300048917 Ga0496114_0084964 Ga0496114_0084964_2288_2596 99
1451 3300048917 Ga0496114_0183777 Ga0496114_0183777_781_1089 99
1452 3300048917 Ga0496114_0323055 Ga0496114_0323055_906_1214 99
1453 3300048917 Ga0496114_0533941 Ga0496114_0533941_695_1000 99
1454 3300048917 Ga0496114_0539720 Ga0496114_0539720_441_746 99
1455 3300048917 Ga0496114_0667221 Ga0496114_0667221_553_858 99
1456 3300048917 Ga0496114_1052828 Ga0496114_1052828_131_439 99
1457 3300048917 Ga0496114_1313675 Ga0496114_1313675_273_581 99
1458 3300048917 Ga0496114_1760090 Ga0496114_1760090_85_393 99
1459 3300048918 Ga0496115_0004484 Ga0496115_0004484_4468_4776 99
1460 3300048918 Ga0496115_0021250 Ga0496115_0021250_1253_1561 99
1461 3300048918 Ga0496115_0034495 Ga0496115_0034495_1448_1753 99
1462 3300048918 Ga0496115_0041294 Ga0496115_0041294_138_446 99
1463 3300048918 Ga0496115_0206274 Ga0496115_0206274_911_1216 99
1464 3300048918 Ga0496115_0217972 Ga0496115_0217972_344_652 99
1465 3300048918 Ga0496115_0323409 Ga0496115_0323409_262_567 99
1466 3300048918 Ga0496115_0392340 Ga0496115_0392340_221_529 99
1467 3300048918 Ga0496115_0406076 Ga0496115_0406076_346_654 99
1468 3300048918 Ga0496115_0440706 Ga0496115_0440706_244_552 99
1469 3300048918 Ga0496115_0698538 Ga0496115_0698538_197_505 99
1470 3300048929 Ga0496126_0063511 Ga0496126_0063511_2726_3031 99
1471 3300049568 Ga0501031_0097225 Ga0501031_0097225_736_1041 99
1472 3300049568 Ga0501031_0109728 Ga0501031_0109728_709_1017 99
1473 3300049569 Ga0501032_0058429 Ga0501032_0058429_902_1207 99
1474 3300049570 Ga0501033_0175177 Ga0501033_0175177_1165_1470 99
1475 3300049571 Ga0501034_0043367 Ga0501034_0043367_3143_3442 99
1476 3300049571 Ga0501034_0234567 Ga0501034_0234567_634_942 99
1477 3300049571 Ga0501034_0239056 Ga0501034_0239056_1171_1470 99
1478 3300049571 Ga0501034_0374545 Ga0501034_0374545_578_877 99
1479 3300049571 Ga0501034_1212782 Ga0501034_1212782_193_492 99
1480 3300049572 Ga0501036_0046169 Ga0501036_0046169_633_938 99
1481 3300049572 Ga0501036_0397757 Ga0501036_0397757_597_896 99
1482 3300049573 Ga0501037_0002196 Ga0501037_0002196_5249_5554 99
1483 3300049574 Ga0501038_0004561 Ga0501038_0004561_1012_1317 99
1484 3300049574 Ga0501038_0702656 Ga0501038_0702656_180_488 99
1485 3300049575 Ga0501039_0002890 Ga0501039_0002890_9764_10069 99
1486 3300049575 Ga0501039_0603900 Ga0501039_0603900_307_606 99
1487 3300049575 Ga0501039_0645485 Ga0501039_0645485_68_367 99
1488 3300049575 Ga0501039_1306563 Ga0501039_1306563_174_482 99
1489 3300049575 Ga0501039_1559927 Ga0501039_1559927_80_379 99
1490 3300049576 Ga0501040_0328055 Ga0501040_0328055_281_589 99
1491 3300049576 Ga0501040_0423831 Ga0501040_0423831_582_887 99
1492 3300049577 Ga0501041_0009319 Ga0501041_0009319_5203_5508 99
1493 3300049578 Ga0501042_0003028 Ga0501042_0003028_8900_9205 99
1494 3300049578 Ga0501042_0029232 Ga0501042_0029232_3242_3541 99
1495 3300049578 Ga0501042_1119269 Ga0501042_1119269_134_433 99
1496 3300049579 Ga0501043_0213925 Ga0501043_0213925_992_1297 99
1497 3300049580 Ga0501046_0003989 Ga0501046_0003989_7773_8078 99
1498 3300049580 Ga0501046_0347856 Ga0501046_0347856_765_1064 99
1499 3300049581 Ga0501047_0014902 Ga0501047_0014902_6268_6576 99
1500 3300049581 Ga0501047_0050531 Ga0501047_0050531_470_769 99
1501 3300049581 Ga0501047_0105147 Ga0501047_0105147_364_672 99
1502 3300049581 Ga0501047_0334077 Ga0501047_0334077_990_1289 99
1503 3300049581 Ga0501047_0381418 Ga0501047_0381418_908_1213 99
1504 3300049582 Ga0501048_0035439 Ga0501048_0035439_2547_2852 99
1505 3300049582 Ga0501048_0204753 Ga0501048_0204753_750_1049 99
1506 3300049582 Ga0501048_0243506 Ga0501048_0243506_346_645 99
1507 3300049582 Ga0501048_0272308 Ga0501048_0272308_642_941 99
1508 3300049582 Ga0501048_0354646 Ga0501048_0354646_29_337 99
1509 3300049582 Ga0501048_0379767 Ga0501048_0379767_333_641 99
1510 3300049583 Ga0501067_0001112 Ga0501067_0001112_12492_12800 99
1511 3300049583 Ga0501067_0041559 Ga0501067_0041559_1636_1944 99
1512 3300049583 Ga0501067_0171670 Ga0501067_0171670_779_1087 99
1513 3300049583 Ga0501067_0328719 Ga0501067_0328719_59_358 99
1514 3300049583 Ga0501067_0346882 Ga0501067_0346882_335_643 99
1515 3300049583 Ga0501067_0533957 Ga0501067_0533957_275_583 99
1516 3300049584 Ga0501068_0096407 Ga0501068_0096407_1446_1751 99
1517 3300049584 Ga0501068_0107623 Ga0501068_0107623_135_440 99
1518 3300049584 Ga0501068_0151614 Ga0501068_0151614_430_729 99
1519 3300049584 Ga0501068_0203766 Ga0501068_0203766_738_1046 99
1520 3300049584 Ga0501068_0863269 Ga0501068_0863269_174_482 99
1521 3300049585 Ga0501069_0028629 Ga0501069_0028629_2379_2687 99
1522 3300049585 Ga0501069_0036011 Ga0501069_0036011_1553_1858 99
1523 3300049585 Ga0501069_0036300 Ga0501069_0036300_1838_2146 99
1524 3300049585 Ga0501069_0061247 Ga0501069_0061247_900_1208 99
1525 3300049585 Ga0501069_0134625 Ga0501069_0134625_318_626 99
1526 3300049585 Ga0501069_0393449 Ga0501069_0393449_121_429 99
1527 3300049586 Ga0501070_0001108 Ga0501070_0001108_6169_6477 99
1528 3300049586 Ga0501070_0047423 Ga0501070_0047423_1560_1865 99
1529 3300049586 Ga0501070_0089620 Ga0501070_0089620_466_765 99
1530 3300049586 Ga0501070_0337110 Ga0501070_0337110_855_1154 99
1531 3300049586 Ga0501070_0355315 Ga0501070_0355315_586_894 99
1532 3300049586 Ga0501070_0587494 Ga0501070_0587494_227_535 99
1533 3300049586 Ga0501070_0636711 Ga0501070_0636711_35_334 99
1534 3300049586 Ga0501070_0707126 Ga0501070_0707126_124_432 99
1535 3300049586 Ga0501070_0707206 Ga0501070_0707206_304_612 99
1536 3300049586 Ga0501070_0768185 Ga0501070_0768185_411_719 99
1537 3300049586 Ga0501070_0900128 Ga0501070_0900128_217_516 99
1538 3300049586 Ga0501070_1489063 Ga0501070_1489063_126_434 99
1539 3300049587 Ga0501071_0091668 Ga0501071_0091668_325_633 99
1540 3300049587 Ga0501071_0148685 Ga0501071_0148685_1168_1473 99
1541 3300049587 Ga0501071_0731814 Ga0501071_0731814_328_636 99
1542 3300049587 Ga0501071_0798310 Ga0501071_0798310_46_354 99
1543 3300049587 Ga0501071_1144821 Ga0501071_1144821_266_565 99
1544 3300049587 Ga0501071_1441017 Ga0501071_1441017_81_380 99
1545 3300049588 Ga0501072_0075260 Ga0501072_0075260_866_1165 99
1546 3300049588 Ga0501072_0104145 Ga0501072_0104145_365_664 99
1547 3300049588 Ga0501072_0105922 Ga0501072_0105922_250_558 99
1548 3300049588 Ga0501072_0180135 Ga0501072_0180135_131_436 99
1549 3300049588 Ga0501072_0261592 Ga0501072_0261592_472_771 99
1550 3300049588 Ga0501072_0890446 Ga0501072_0890446_142_450 99
1551 3300049588 Ga0501072_1438287 Ga0501072_1438287_141_440 99
1552 3300049589 Ga0501073_0014387 Ga0501073_0014387_273_578 99
1553 3300049589 Ga0501073_0184925 Ga0501073_0184925_460_768 99
1554 3300049590 Ga0501074_0015093 Ga0501074_0015093_4868_5176 99
1555 3300049590 Ga0501074_0022353 Ga0501074_0022353_582_887 99
1556 3300049590 Ga0501074_0050711 Ga0501074_0050711_402_701 99
1557 3300049590 Ga0501074_0143876 Ga0501074_0143876_405_704 99
1558 3300049590 Ga0501074_0276547 Ga0501074_0276547_726_1034 99
1559 3300049590 Ga0501074_0334296 Ga0501074_0334296_193_492 99
1560 3300049590 Ga0501074_0456000 Ga0501074_0456000_109_417 99
1561 3300049590 Ga0501074_0709564 Ga0501074_0709564_372_680 99
1562 3300049590 Ga0501074_1099317 Ga0501074_1099317_207_515 99
1563 3300049590 Ga0501074_1317445 Ga0501074_1317445_36_344 99
1564 3300049591 Ga0501075_0037857 Ga0501075_0037857_2719_3024 99
1565 3300049591 Ga0501075_0351437 Ga0501075_0351437_604_903 99
1566 3300049592 Ga0501076_0226794 Ga0501076_0226794_1008_1307 99
1567 3300049592 Ga0501076_0264852 Ga0501076_0264852_549_848 99
1568 3300049592 Ga0501076_0268964 Ga0501076_0268964_130_438 99
1569 3300049592 Ga0501076_0544980 Ga0501076_0544980_70_375 99
1570 3300049592 Ga0501076_1350765 Ga0501076_1350765_21_320 99
1571 3300049593 Ga0501077_0046450 Ga0501077_0046450_1605_1910 99
1572 3300049593 Ga0501077_0568727 Ga0501077_0568727_180_479 99
1573 3300049741 Ga0501079_0085333 Ga0501079_0085333_1135_1440 99
1574 3300049741 Ga0501079_0434910 Ga0501079_0434910_20_334 99
1575 3300049741 Ga0501079_0522377 Ga0501079_0522377_572_880 99
1576 3300049741 Ga0501079_0558213 Ga0501079_0558213_211_510 99
1577 3300049741 Ga0501079_1180197 Ga0501079_1180197_76_375 99
1578 3300049741 Ga0501079_1353953 Ga0501079_1353953_124_432 99
1579 3300049741 Ga0501079_1443228 Ga0501079_1443228_210_509 99
1580 3300049742 Ga0501080_0297462 Ga0501080_0297462_548_856 99
1581 3300049742 Ga0501080_0298842 Ga0501080_0298842_1030_1335 99
1582 3300049742 Ga0501080_0668608 Ga0501080_0668608_174_482 99
1583 3300049742 Ga0501080_1203262 Ga0501080_1203262_92_400 99
1584 3300049743 Ga0501081_0140264 Ga0501081_0140264_1254_1562 99
1585 3300049743 Ga0501081_0324205 Ga0501081_0324205_118_423 99
1586 3300049743 Ga0501081_0586203 Ga0501081_0586203_423_737 99
1587 3300049743 Ga0501081_0813052 Ga0501081_0813052_164_463 99
1588 3300049744 Ga0501083_0009596 Ga0501083_0009596_2631_2936 99
1589 3300049744 Ga0501083_0216274 Ga0501083_0216274_260_559 99
1590 3300049822 Ga0501035_0014222 Ga0501035_0014222_6194_6499 99
1591 3300049822 Ga0501035_0099622 Ga0501035_0099622_1183_1491 99
1592 3300049822 Ga0501035_0753811 Ga0501035_0753811_124_432 99
1593 3300049822 Ga0501035_0781140 Ga0501035_0781140_346_654 99
1594 3300049822 Ga0501035_0983084 Ga0501035_0983084_264_563 99
1595 3300049823 Ga0501044_0150079 Ga0501044_0150079_746_1054 99
1596 3300049823 Ga0501044_0257548 Ga0501044_0257548_496_804 99
1597 3300049823 Ga0501044_0298198 Ga0501044_0298198_1031_1336 99
1598 3300049823 Ga0501044_0699554 Ga0501044_0699554_327_626 99
1599 3300049824 Ga0501045_0056450 Ga0501045_0056450_685_993 99
1600 3300049824 Ga0501045_0135811 Ga0501045_0135811_1250_1555 99
1601 3300049824 Ga0501045_0423268 Ga0501045_0423268_568_876 99
1602 3300049824 Ga0501045_0606227 Ga0501045_0606227_154_453 99
1603 3300049824 Ga0501045_0806712 Ga0501045_0806712_105_404 99
1604 3300050490 nmdc:mga03n38_19541_c1 nmdc:mga03n38_19541_c1_592_891 99
1605 3300050490 nmdc:mga03n38_359862_c1 nmdc:mga03n38_359862_c1_234_539 99
1606 3300050490 nmdc:mga03n38_660808_c1 nmdc:mga03n38_660808_c1_246_545 99
1607 3300050490 nmdc:mga03n38_920297_c1 nmdc:mga03n38_920297_c1_46_354 99
1608 3300050491 nmdc:mga00v17_104808_c1 nmdc:mga00v17_104808_c1_1130_1429 99
1609 3300050491 nmdc:mga00v17_175639_c1 nmdc:mga00v17_175639_c1_177_476 99
1610 3300050491 nmdc:mga00v17_512886_c1 nmdc:mga00v17_512886_c1_384_683 99
1611 3300050491 nmdc:mga00v17_664403_c1 nmdc:mga00v17_664403_c1_44_343 99
1612 3300050492 nmdc:mga0yw44_1082905_c1 nmdc:mga0yw44_1082905_c1_182_481 99
1613 3300050492 nmdc:mga0yw44_181418_c1 nmdc:mga0yw44_181418_c1_38_337 99
1614 3300050492 nmdc:mga0yw44_34341_c1 nmdc:mga0yw44_34341_c1_1924_2229 99
1615 3300050492 nmdc:mga0yw44_374788_c2 nmdc:mga0yw44_374788_c2_154_453 99
1616 3300050492 nmdc:mga0yw44_44835_c1 nmdc:mga0yw44_44835_c1_549_848 99
1617 3300050492 nmdc:mga0yw44_63638_c1 nmdc:mga0yw44_63638_c1_854_1153 99
1618 3300050492 nmdc:mga0yw44_68966_c1 nmdc:mga0yw44_68966_c1_1274_1573 99
1619 3300050494 nmdc:mga06z11_411288_c1 nmdc:mga06z11_411288_c1_458_757 99
1620 3300050495 nmdc:mga04h51_519406_c1 nmdc:mga04h51_519406_c1_11_310 99
1621 3300050507 nmdc:mga05p37_105493_c1 nmdc:mga05p37_105493_c1_235_543 99
1622 3300050507 nmdc:mga05p37_111967_c1 nmdc:mga05p37_111967_c1_2682_2990 99
1623 3300050507 nmdc:mga05p37_1409376_c1 nmdc:mga05p37_1409376_c1_132_431 99
1624 3300050507 nmdc:mga05p37_14698_c1 nmdc:mga05p37_14698_c1_494_802 99
1625 3300050507 nmdc:mga05p37_2063916_c1 nmdc:mga05p37_2063916_c1_63_362 99
1626 3300050507 nmdc:mga05p37_442600_c1 nmdc:mga05p37_442600_c1_323_628 99
1627 3300050507 nmdc:mga05p37_588374_c1 nmdc:mga05p37_588374_c1_747_1046 99
1628 3300050507 nmdc:mga05p37_929984_c1 nmdc:mga05p37_929984_c1_411_716 99
1629 3300050508 nmdc:mga09592_146966_c1 nmdc:mga09592_146966_c1_556_855 99
1630 3300050508 nmdc:mga09592_76757_c1 nmdc:mga09592_76757_c1_1689_1988 99
1631 3300050509 nmdc:mga0qj67_196817_c1 nmdc:mga0qj67_196817_c1_980_1279 99
1632 3300050509 nmdc:mga0qj67_38708_c1 nmdc:mga0qj67_38708_c1_829_1128 99
1633 3300050509 nmdc:mga0qj67_473644_c1 nmdc:mga0qj67_473644_c1_496_801 99
1634 3300050509 nmdc:mga0qj67_856696_c1 nmdc:mga0qj67_856696_c1_31_336 99
1635 3300050510 nmdc:mga06r32_103701_c1 nmdc:mga06r32_103701_c1_828_1127 99
1636 3300050510 nmdc:mga06r32_18667_c1 nmdc:mga06r32_18667_c1_5113_5412 99
1637 3300050510 nmdc:mga06r32_323513_c1 nmdc:mga06r32_323513_c1_345_653 99
1638 3300050510 nmdc:mga06r32_546407_c1 nmdc:mga06r32_546407_c1_806_1111 99
1639 3300050511 nmdc:mga08y16_1030518_c1 nmdc:mga08y16_1030518_c1_157_465 99
1640 3300050511 nmdc:mga08y16_209939_c1 nmdc:mga08y16_209939_c1_1610_1915 99
1641 3300050511 nmdc:mga08y16_237134_c1 nmdc:mga08y16_237134_c1_1218_1526 99
1642 3300050511 nmdc:mga08y16_411885_c1 nmdc:mga08y16_411885_c1_587_892 99
1643 3300050511 nmdc:mga08y16_62297_c1 nmdc:mga08y16_62297_c1_2315_2620 99
1644 3300050511 nmdc:mga08y16_639110_c1 nmdc:mga08y16_639110_c1_478_786 99
1645 3300050511 nmdc:mga08y16_832893_c1 nmdc:mga08y16_832893_c1_383_682 99
1646 3300050511 nmdc:mga08y16_8939_c1 nmdc:mga08y16_8939_c1_2382_2681 99
1647 3300050512 nmdc:mga0n895_18177_c1 nmdc:mga0n895_18177_c1_471_779 99
1648 3300050512 nmdc:mga0n895_2225569_c1 nmdc:mga0n895_2225569_c1_142_450 99
1649 3300050512 nmdc:mga0n895_414462_c1 nmdc:mga0n895_414462_c1_777_1085 99
1650 3300050512 nmdc:mga0n895_81104_c1 nmdc:mga0n895_81104_c1_2723_3031 99
1651 3300050513 nmdc:mga0rr50_1442544_c1 nmdc:mga0rr50_1442544_c1_202_510 99
1652 3300050514 nmdc:mga08x19_355533_c1 nmdc:mga08x19_355533_c1_239_547 99
1653 3300050515 nmdc:mga0a205_192468_c1 nmdc:mga0a205_192468_c1_1007_1315 99
1654 3300050515 nmdc:mga0a205_325223_c1 nmdc:mga0a205_325223_c1_216_515 99
1655 3300050515 nmdc:mga0a205_33197_c1 nmdc:mga0a205_33197_c1_3114_3422 99
1656 3300050515 nmdc:mga0a205_381758_c1 nmdc:mga0a205_381758_c1_423_731 99
1657 3300053077 Ga0495601_0023145 Ga0495601_0023145_420_728 99
1658 3300053077 Ga0495601_0116999 Ga0495601_0116999_453_761 99
1659 3300053077 Ga0495601_0175539 Ga0495601_0175539_780_1088 99
1660 3300053077 Ga0495601_0396108 Ga0495601_0396108_447_755 99
1661 3300053077 Ga0495601_0730073 Ga0495601_0730073_163_471 99
1662 3300053077 Ga0495601_0802361 Ga0495601_0802361_153_461 99
1663 3300053078 Ga0495612_0056999 Ga0495612_0056999_1112_1420 99
1664 3300053078 Ga0495612_0179807 Ga0495612_0179807_492_800 99
1665 3300053078 Ga0495612_0476595 Ga0495612_0476595_88_396 99
1666 3300053083 Ga0495655_0017809 Ga0495655_0017809_968_1276 99
1667 3300053084 Ga0495595_0025212 Ga0495595_0025212_2277_2585 99
1668 3300053084 Ga0495595_0035718 Ga0495595_0035718_1158_1466 99
1669 3300053084 Ga0495595_0056014 Ga0495595_0056014_517_825 99
1670 3300053084 Ga0495595_0105302 Ga0495595_0105302_177_485 99
1671 3300053084 Ga0495595_0534190 Ga0495595_0534190_165_473 99
1672 3300053085 Ga0495619_0026945 Ga0495619_0026945_1105_1413 99
1673 3300053085 Ga0495619_0110205 Ga0495619_0110205_730_1038 99
1674 3300053085 Ga0495619_0272906 Ga0495619_0272906_151_459 99
1675 3300053085 Ga0495619_0931100 Ga0495619_0931100_44_352 99
1676 3300053085 Ga0495619_0978284 Ga0495619_0978284_108_416 99
1677 3300054114 Ga0501084_0046615 Ga0501084_0046615_2159_2464 99
1678 3300054114 Ga0501084_0313361 Ga0501084_0313361_482_790 99
1679 3300054114 Ga0501084_0494523 Ga0501084_0494523_44_352 99
1680 3300054114 Ga0501084_0593404 Ga0501084_0593404_533_841 99
1681 3300054114 Ga0501084_0633608 Ga0501084_0633608_207_515 99
1682 3300059630 Ga0587128_163635 Ga0587128_163635_26_334 99
1683 3300060353 Ga0501082_0082418 Ga0501082_0082418_2265_2570 99
1684 3300060353 Ga0501082_0512996 Ga0501082_0512996_732_1031 99
1685 3300060353 Ga0501082_1100672 Ga0501082_1100672_66_374 99
1686 3300060353 Ga0501082_1709425 Ga0501082_1709425_123_431 99
1687 3300061719 Ga0466962_0672460 Ga0466962_0672460_142_450 99
1688 3300061734 Ga0530510_0053366 Ga0530510_0053366_70_375 99
1689 3300061734 Ga0530510_0125374 Ga0530510_0125374_746_1045 99
1690 3300061734 Ga0530510_0154575 Ga0530510_0154575_63_371 99
1691 3300061734 Ga0530510_0212758 Ga0530510_0212758_370_684 99
1692 3300061734 Ga0530510_0530328 Ga0530510_0530328_409_717 99
1693 3300061734 Ga0530510_0818250 Ga0530510_0818250_261_560 99
1694 3300061734 Ga0530510_1156555 Ga0530510_1156555_227_535 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

8

102

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zmh-assembly1.cif.gz_L cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) - membrane arm 0.9547 9 86
7a24-assembly1.cif.gz_K assembly intermediate of the plant mitochondrial complex i 0.9375 3 84
6h8k-assembly1.cif.gz_L crystal structure of a variant (q133c in psst) of yarrowia lipolytica complex i 0.9325 8 83
6x89-assembly1.cif.gz_4L vigna radiata mitochondrial complex i* 0.9307 3 84
7wg5-assembly1.cif.gz_E cyclic electron transport supercomplex ndh-psi from arabidopsis 0.9295 3 85
ID Description Score Start End Superfamily
af_A0A2P2CLH7_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9433 6 86 1.10.287.3510
5lnkK00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9047 8 85 1.10.287.3510
5xtdk00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8856 7 82 1.10.287.3510
af_Q6R9N1_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8608 6 98 1.10.287.3510
af_Q9XK79_1_97_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8601 7 95 1.10.287.3510
ID Description Score Start End GO Terms
AF-B9L621-F1-model_v4 NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) 0.9743 3 84 GO:0005886
GO:0042773
GO:0048038
GO:0050136
AF-A0A0U5AQX5-F1-model_v4 NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) 0.9649 3 84 GO:0005886
GO:0030964
GO:0042773
GO:0048038
GO:0050136
AF-J0L9T7-F1-model_v4 NADH:ubiquinone oxidoreductase subunit 11 or 4L (Chain K) 0.9648 3 84 GO:0016020
AF-A0A7C1MEI9-F1-model_v4 deleted 0.9647 3 86
AF-A0A4P9J9E2-F1-model_v4 Transporter 0.9615 3 81 GO:0005886
GO:0015075

Feature Viewer

pLDDT pTM Quality
89.62 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map