F494500

General Info

Members Datasets Scaffolds Average Seq Length
1515 985 937 158

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10999324|Ga0163162_109993241
Length 186
Sequence VDEGVLAVPPKPAFEMTAGWRLEKERHPMAAKKDDGRKTVAENRKARHEYFITEDYEAGIMLTGTEVKSLRKGQANIAESYASYEDGGVWLINSYIQEYPAAGPFFQHAPRRKRKLLLHLKEMAKLTQAIERKGMTIIPLELYFNARGKAKLKLGVAEGKKLHDKREDAKKRDWNREKARLMREKG

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
6 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
7 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
8 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
9 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
10 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
11 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
12 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
13 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
14 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
15 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
16 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
17 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
18 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
19 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
20 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
21 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
22 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
23 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
24 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
25 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
26 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
27 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
28 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
29 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
30 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
31 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
32 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
33 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
34 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
35 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
36 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
37 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
38 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
39 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
40 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
41 2516143018 Ensifer sp. BR816 Isolate Nodule
42 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
43 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
44 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
45 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
46 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
47 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
48 2519899620 Rhizobium sp. Pop5 Isolate Nodule
49 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
50 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
51 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
52 2534681786 Brucella suis 92/29 Isolate Unclassified
53 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
54 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
55 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
56 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
57 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
58 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
59 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
60 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
61 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
62 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
63 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
64 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
65 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
66 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
67 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
68 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
69 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
70 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
71 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
72 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
73 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
74 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
75 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
76 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
77 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
78 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
79 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
80 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
81 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
82 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
83 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
84 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
85 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
86 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
87 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
88 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
89 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
90 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
91 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
92 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
93 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
94 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
95 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
96 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
97 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
98 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
99 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
100 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
101 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
102 2643221557 Ensifer sp. Root558 Isolate Unclassified
103 2643221558 Rhizobium sp. Root149 Isolate Unclassified
104 2643221568 Rhizobium sp. Root564 Isolate Unclassified
105 2643221599 Rhizobium sp. Root708 Isolate Unclassified
106 2643221610 Ensifer sp. Root74 Isolate Unclassified
107 2643221618 Ensifer sp. Root231 Isolate Unclassified
108 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
109 2643221626 Ensifer sp. Root31 Isolate Unclassified
110 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
111 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
112 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
113 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
114 2643221655 Ensifer sp. Root1252 Isolate Unclassified
115 2643221659 Ensifer sp. Root127 Isolate Unclassified
116 2643221668 Ensifer sp. Root423 Isolate Unclassified
117 2643221675 Ensifer sp. Root1298 Isolate Unclassified
118 2643221680 Ensifer sp. Root1312 Isolate Unclassified
119 2643221693 Rhizobium sp. Root491 Isolate Unclassified
120 2643221698 Ensifer sp. Root142 Isolate Unclassified
121 2643221712 Ensifer sp. Root258 Isolate Unclassified
122 2643221718 Rhizobium sp. Root268 Isolate Unclassified
123 2643221719 Rhizobium sp. Root274 Isolate Unclassified
124 2643221723 Ensifer sp. Root278 Isolate Unclassified
125 2643221726 Ensifer sp. Root954 Isolate Unclassified
126 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
127 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
128 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
129 2718217882 Rhizobium sp. N741 Isolate Nodule
130 2718217927 Rhizobium sp. N324 Isolate Nodule
131 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
132 2718218009 Rhizobium sp. N561 Isolate Nodule
133 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
134 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
135 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
136 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
137 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
138 2718218363 Rhizobium sp. N113 Isolate Nodule
139 2718218365 Rhizobium sp. N731 Isolate Nodule
140 2718218366 Rhizobium sp. N621 Isolate Nodule
141 2718218423 Rhizobium sp. N941 Isolate Nodule
142 2721755514 Rhizobium sp. N6212 Isolate Nodule
143 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
144 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
145 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
146 2721755809 Rhizobium sp. N541 Isolate Nodule
147 2721755810 Rhizobium sp. N871 Isolate Nodule
148 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
149 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
150 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
151 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
152 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
153 2728369365 Rhizobium sp. N1341 Isolate Nodule
154 2728369397 Rhizobium sp. N1314 Isolate Nodule
155 2738541293 Rhizobium sp. GV031 Isolate Unclassified
156 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
157 2751185800 Brucella pituitosa AA2 Isolate Unclassified
158 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
159 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
160 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
161 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
162 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
163 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
164 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
165 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
166 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
167 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
168 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
169 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
170 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
171 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
172 2791355256 Rhizobium sp. M10 Isolate Nodule
173 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
174 2791355260 Rhizobium sp. L9 Isolate Nodule
175 2791355261 Rhizobium sp. J15 Isolate Nodule
176 2791355262 Rhizobium sp. M1 Isolate Nodule
177 2791355263 Rhizobium chutanense C5 Isolate Nodule
178 2791355264 Rhizobium sp. S9 Isolate Nodule
179 2791355265 Rhizobium sp. H4 Isolate Nodule
180 2791355266 Rhizobium sp. L43 Isolate Nodule
181 2791355267 Rhizobium sp. L18 Isolate Nodule
182 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
183 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
184 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
185 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
186 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
187 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
188 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
189 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
190 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
191 2802429633 Rhizobium anhuiense J3 Isolate Nodule
192 2802429634 Rhizobium anhuiense S10 Isolate Nodule
193 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
194 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
195 2802429637 Rhizobium anhuiense C15 Isolate Nodule
196 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
197 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
198 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
199 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
200 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
201 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
202 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
203 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
204 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
205 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
206 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
207 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
208 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
209 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
210 2838048938 Rhizobium pisi 27/80 Isolate Nodule
211 2838061910 Rhizobium phaseoli L15 Isolate Nodule
212 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
213 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
214 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
215 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
216 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
217 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
218 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
219 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
220 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
221 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
222 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
223 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
224 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
225 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
226 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
227 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
228 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
229 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
230 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
231 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
232 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
233 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
234 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
235 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
236 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
237 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
238 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
239 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
240 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
241 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
242 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
243 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
244 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
245 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
246 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
247 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
248 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
249 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
250 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
251 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
252 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
253 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
254 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
255 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
256 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
257 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
258 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
259 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
260 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
261 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
262 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
263 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
264 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
265 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
266 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
267 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
268 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
269 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
270 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
271 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
272 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
273 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
274 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
275 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
276 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
277 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
278 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
279 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
280 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
281 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
282 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
283 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
284 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
285 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
286 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
287 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
288 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
289 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
290 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
291 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
292 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
293 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
294 2844163670 Ensifer sp. 1H6 Isolate Unclassified
295 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
296 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
297 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
298 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
299 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
300 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
301 2854911287 Brucella lupini LUP21 Isolate Unclassified
302 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
303 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
304 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
305 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
306 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
307 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
308 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
309 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
310 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
311 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
312 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
313 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
314 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
315 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
316 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
317 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
318 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
319 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
320 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
321 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
322 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
323 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
324 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
325 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
326 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
327 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
328 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
329 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
330 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
331 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
332 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
333 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
334 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
335 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
336 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
337 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
338 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
339 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
340 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
341 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
342 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
343 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
344 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
345 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
346 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
347 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
348 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
349 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
350 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
351 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
352 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
353 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
354 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
355 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
356 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
357 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
358 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
359 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
360 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
361 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
362 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
363 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
364 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
365 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
366 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
367 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
368 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
369 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
370 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
371 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
372 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
373 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
374 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
375 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
376 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
377 2933599457 Rhizobium phaseoli M3 Isolate Nodule
378 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
379 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
380 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
381 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
382 2936381700 Rhizobium chutanense C16 Isolate Unclassified
383 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
384 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
385 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
386 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
387 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
388 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
389 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
390 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
391 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
392 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
393 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
394 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
395 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
396 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
397 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
398 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
399 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
400 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
401 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
402 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
403 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
404 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
405 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
406 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
407 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
408 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
409 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
410 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
411 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
412 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
413 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
414 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
415 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
416 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
417 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
418 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
419 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
420 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
421 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
422 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
423 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
424 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
425 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
426 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
427 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
428 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
429 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
430 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
431 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
432 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
433 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
434 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
435 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
436 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
437 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
438 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
439 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
440 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
441 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
442 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
443 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
444 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
445 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
446 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
447 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
448 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
449 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
450 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
451 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
452 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
453 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
454 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
455 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
456 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
457 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
458 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
459 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
460 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
461 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
462 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
463 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
464 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
465 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
466 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
467 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
468 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
469 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
470 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
471 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
472 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
473 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
474 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
475 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
476 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
477 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
478 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
479 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
480 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
481 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
482 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
483 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
484 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
485 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
486 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
487 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
488 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
489 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
490 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
491 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
492 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
493 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
494 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
495 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
496 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
497 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
498 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
499 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
500 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
501 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
502 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
503 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
504 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
505 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
506 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
507 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
508 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
509 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
510 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
511 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
512 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
513 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
514 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
515 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
516 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
517 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
518 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
519 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
520 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
521 2996887358 Rhizobium sp. R711 Isolate Nodule
522 2996893221 Rhizobium sp. R635 Isolate Nodule
523 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
524 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
525 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
526 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
527 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
528 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
529 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
530 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
531 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
532 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
533 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
534 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
535 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
536 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
537 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
538 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
539 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
540 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
541 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
542 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
543 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
544 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
545 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
546 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
547 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
548 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
549 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
550 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
551 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
552 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
553 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
554 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
555 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
556 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
557 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
558 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
559 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
560 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
561 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
562 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
563 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
564 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
565 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
566 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
567 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
568 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
569 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
570 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
571 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
572 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
573 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
574 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
575 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
576 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
577 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
578 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
579 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
580 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
581 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
582 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
583 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
584 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
585 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
586 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
587 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
588 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
589 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
590 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
591 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
592 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
593 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
594 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
595 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
596 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
597 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
598 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
599 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
600 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
601 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
602 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
603 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
604 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
605 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
606 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
607 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
608 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
609 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
610 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
611 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
612 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
613 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
614 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
615 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
616 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
617 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
618 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
619 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
620 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
621 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
622 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
623 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
624 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
625 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
626 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
627 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
628 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
629 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
630 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
631 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
632 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
633 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
634 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
635 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
636 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
637 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
638 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
639 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
640 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
641 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
642 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
643 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
644 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
645 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
646 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
647 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
648 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
649 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
650 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
651 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
652 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
653 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
654 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
655 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
656 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
657 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
658 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
659 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
660 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
661 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
662 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
663 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
664 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
665 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
666 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
667 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
668 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
669 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
670 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
671 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
672 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
673 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
674 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
675 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
676 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
677 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
678 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
679 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
680 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
681 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
682 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
683 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
684 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
685 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
686 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
687 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
688 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
689 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
690 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
691 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
692 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
693 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
694 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
695 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
696 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
697 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
698 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
699 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
700 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
701 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
702 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
703 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
704 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
705 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
706 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
707 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
708 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
709 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
710 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
711 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
712 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
713 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
714 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
715 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
716 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
717 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
718 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
719 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
720 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
721 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
722 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
723 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
724 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
725 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
726 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
727 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
728 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
729 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
730 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
731 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
732 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
733 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
734 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
735 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
736 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
737 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
738 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
739 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
740 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
741 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
742 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
743 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
744 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
745 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
746 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
747 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
748 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
749 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
750 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
751 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
752 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
753 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
754 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
755 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
756 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
757 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
758 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
759 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
760 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
761 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
762 3300041500 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaT Metatranscriptome Unclassified
763 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
764 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
765 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
766 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
767 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
768 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
769 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
770 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
771 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
772 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
773 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
774 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
775 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
776 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
777 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
778 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
779 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
780 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
781 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
782 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
783 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
784 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
785 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
786 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
787 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
788 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
789 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
790 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
791 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
792 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
793 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
794 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
795 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
796 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
797 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
798 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
799 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
800 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
801 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
802 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
803 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
804 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
805 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
806 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
807 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
808 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
809 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
810 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
811 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
812 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
813 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
814 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
815 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
816 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
817 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
818 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
819 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
820 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
821 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
822 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
823 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
824 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
825 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
826 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
827 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
828 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
829 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
830 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
831 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
832 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
833 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
834 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
835 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
836 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
837 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
838 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
839 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
840 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
841 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
842 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
843 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
844 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
845 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
846 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
847 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
848 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
849 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
850 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
851 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
852 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
853 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
854 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
855 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
856 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
857 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
858 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
859 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
860 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
861 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
862 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
863 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
864 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
865 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
866 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
867 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
868 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
869 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
870 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
871 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
872 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
873 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
874 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
875 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
876 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
877 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
878 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
879 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
880 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
881 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
882 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
883 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
884 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
885 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
886 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
887 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
888 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
889 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
890 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
891 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
892 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
893 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
894 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
895 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
896 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
897 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
898 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
899 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
900 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
901 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
902 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
903 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
904 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
905 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
906 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
907 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
908 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
909 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
910 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
911 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
912 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
913 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
914 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
915 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
916 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
917 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
918 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
919 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
920 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
921 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
922 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
923 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
924 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
925 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
926 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
927 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
928 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
929 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
930 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
931 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
932 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
933 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
934 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
935 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
936 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
937 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
938 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
939 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
940 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
941 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
942 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
943 8005258706 Rhizobium sp. R693 Isolate Nodule
944 8005275841 Rhizobium sp. N4311 Isolate Nodule
945 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
946 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
947 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
948 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
949 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
950 8005321885 Rhizobium sp. R72 Isolate Nodule
951 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
952 8005382845 Rhizobium sp. R634 Isolate Nodule
953 8005395548 Rhizobium sp. R339 Isolate Nodule
954 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
955 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
956 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
957 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
958 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
959 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
960 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
961 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
962 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
963 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
964 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
965 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
966 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
967 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
968 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
969 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
970 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
971 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
972 8018176218 Rhizobium sp. N122 Isolate Nodule
973 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
974 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
975 8024501048 Rhizobium sp. H4 Isolate Nodule
976 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
977 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
978 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
979 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
980 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
981 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
982 8056382006 Rhizobium croatiense 13T Isolate Nodule
983 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
984 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
985 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 61.06
Metatranscriptomes 0.79
Isolates 38.15

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 17.69
Nodule 28.91
Rhizoplane 3.7
Rhizosphere 34.46
Stem 0
Stem Tuber 0
Unclassified 14.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001504 3300001979 Bacteria 10716
2 JGI24739J22299_10159059 3300001989 Bacteria 667
3 JGI24739J22299_10180744 3300001989 Bacteria 621
4 JGI25155J39150_1000783 3300002704 Bacteria 5140
5 JGI25156J39149_1000086 3300002705 Bacteria 69106
6 JGI25162J39368_1002183 3300002737 Bacteria 8107
7 JGI25162J39368_1003431 3300002737 Bacteria 4587
8 JGI25154J39366_1002301 3300002738 Bacteria 5140
9 JGI25158J39367_1000020 3300002739 Bacteria 40034
10 JGI25158J39367_1002568 3300002739 Bacteria 2928
11 JGI25157J39369_1000113 3300002741 Bacteria 69106
12 JGI25152J39213_1000386 3300002773 Bacteria 26927
13 JGI25152J39213_1000911 3300002773 Bacteria 14503
14 JGI25152J39213_1006715 3300002773 Bacteria 3073
15 JGI25152J39213_1031357 3300002773 Bacteria 817
16 JGI25150J39212_1000031 3300002774 Bacteria 100456
17 JGI25150J39212_1004438 3300002774 Bacteria 3121
18 JGI25159J45721_1000361 3300002987 Bacteria 21136
19 JGI25159J45721_1000366 3300002987 Bacteria 21031
20 JGI25159J45721_1000852 3300002987 Bacteria 13301
21 JGI25151J46595_10000062 3300003187 Bacteria 146687
22 JGI25151J46595_10001513 3300003187 Bacteria 15551
23 JGI25151J46595_10026932 3300003187 Bacteria 2312
24 JGI25151J46595_10033323 3300003187 Bacteria 1985
25 JGI25151J46595_10036217 3300003187 Bacteria 1864
26 JGI25151J46595_10082306 3300003187 Bacteria 927
27 JGI25165J46597_1001783 3300003214 Bacteria 9263
28 JGI25165J46597_1001952 3300003214 Bacteria 8112
29 JGI25153J46596_10000501 3300003215 Bacteria 24903
30 JGI25153J46596_10018323 3300003215 Bacteria 2724
31 JGI25153J46596_10067098 3300003215 Bacteria 946
32 JGI25160J50197_1000052 3300003354 Bacteria 127795
33 JGI25160J50197_1000562 3300003354 Bacteria 21031
34 JGI25160J50197_1000754 3300003354 Bacteria 17529
35 JGI25160J50197_1010611 3300003354 Bacteria 3317
36 JGI25160J50197_1013162 3300003354 Bacteria 2834
37 JGI25161J50226_1000073 3300003374 Bacteria 86555
38 JGI25161J50226_1000113 3300003374 Bacteria 63092
39 JGI25161J50226_1000133 3300003374 Bacteria 52508
40 JGI25161J50226_1000436 3300003374 Bacteria 19607
41 JGI25161J50226_1006111 3300003374 Bacteria 2225
42 Ga0006562J51391_1002758 3300003578 Bacteria 2950
43 Ga0055539_1016004 3300003752 Bacteria 911
44 Ga0055526_1001219 3300003771 Bacteria 18486
45 Ga0055526_1002323 3300003771 Bacteria 12953
46 Ga0055526_1006191 3300003771 Bacteria 6579
47 Ga0055526_1009421 3300003771 Bacteria 4697
48 Ga0055526_1011789 3300003771 Bacteria 3889
49 Ga0055526_1017326 3300003771 Bacteria 2757
50 Ga0055526_1017854 3300003771 Bacteria 2683
51 Ga0055524_1002159 3300003775 Bacteria 10351
52 Ga0055524_1003184 3300003775 Bacteria 8061
53 Ga0055524_1004356 3300003775 Bacteria 6548
54 Ga0055524_1013497 3300003775 Bacteria 3077
55 Ga0055524_1029743 3300003775 Bacteria 1607
56 Ga0055524_1033895 3300003775 Bacteria 1421
57 Ga0055524_1036948 3300003775 Bacteria 1303
58 Ga0055524_1062003 3300003775 Bacteria 769
59 Ga0055536_1002650 3300003781 Bacteria 9938
60 Ga0055536_1012718 3300003781 Bacteria 3097
61 Ga0055528_1000149 3300003790 Bacteria 57620
62 Ga0055528_1004486 3300003790 Bacteria 6720
63 Ga0055528_1010018 3300003790 Bacteria 3898
64 Ga0055528_1011985 3300003790 Bacteria 3398
65 Ga0055528_1019374 3300003790 Bacteria 2258
66 Ga0055530_10008208 3300003791 Bacteria 4223
67 Ga0055530_10011253 3300003791 Bacteria 3229
68 Ga0055540_1000406 3300003792 Bacteria 34874
69 Ga0055540_1002588 3300003792 Bacteria 9422
70 Ga0055540_1003073 3300003792 Bacteria 8315
71 Ga0055540_1006048 3300003792 Bacteria 4898
72 Ga0055540_1036446 3300003792 Bacteria 1092
73 Ga0055540_1058187 3300003792 Bacteria 779
74 Ga0055531_10002936 3300003794 Bacteria 11093
75 Ga0055531_10014219 3300003794 Bacteria 3602
76 Ga0058692_1005916 3300003856 Bacteria 3420
77 Ga0058692_1033337 3300003856 Bacteria 955
78 Ga0055543_1000035 3300004625 Bacteria 127833
79 Ga0055543_1000048 3300004625 Bacteria 109807
80 Ga0055543_1000656 3300004625 Bacteria 18294
81 Ga0055543_1000745 3300004625 Bacteria 16423
82 Ga0065165_1000046 3300005262 Bacteria 198873
83 Ga0065165_1000253 3300005262 Bacteria 92969
84 Ga0065165_1001769 3300005262 Bacteria 21422
85 Ga0065165_1002851 3300005262 Bacteria 13416
86 Ga0065165_1007484 3300005262 Bacteria 5353
87 Ga0065165_1118658 3300005262 Bacteria 644
88 Ga0065712_10396488 3300005290 Bacteria 725
89 Ga0070676_10132963 3300005328 Bacteria 1575
90 Ga0070676_10376664 3300005328 Bacteria 982
91 Ga0070676_11262326 3300005328 Bacteria 563
92 Ga0070670_100816691 3300005331 Bacteria 843
93 Ga0070670_100825402 3300005331 Bacteria 838
94 Ga0068869_100852479 3300005334 Bacteria 786
95 Ga0070666_10070199 3300005335 Bacteria 2383
96 Ga0070680_100008030 3300005336 Bacteria 8060
97 Ga0070682_100001337 3300005337 Bacteria 13942
98 Ga0070682_100357034 3300005337 Bacteria 1091
99 Ga0070660_100098549 3300005339 Bacteria 2314
100 Ga0070691_10081399 3300005341 Bacteria 1586
101 Ga0070687_100232317 3300005343 Bacteria 1136
102 Ga0070661_100160982 3300005344 Bacteria 1700
103 Ga0070692_10050870 3300005345 Bacteria 2153
104 Ga0070668_100034681 3300005347 Bacteria 3846
105 Ga0070668_100376604 3300005347 Bacteria 1207
106 Ga0070668_100472903 3300005347 Bacteria 1081
107 Ga0070668_100917371 3300005347 Bacteria 784
108 Ga0070668_100948388 3300005347 Bacteria 771
109 Ga0070669_100147123 3300005353 Bacteria 1821
110 Ga0070675_100896553 3300005354 Bacteria 813
111 Ga0070673_101265932 3300005364 Bacteria 692
112 Ga0070688_100001929 3300005365 Bacteria 10415
113 Ga0070688_100787019 3300005365 Bacteria 743
114 Ga0070659_100041000 3300005366 Bacteria 3617
115 Ga0070667_100906450 3300005367 Bacteria 821
116 Ga0070703_10177356 3300005406 Bacteria 820
117 Ga0070701_10033541 3300005438 Bacteria 2566
118 Ga0070705_100097985 3300005440 Bacteria 1844
119 Ga0070700_100172404 3300005441 Bacteria 1499
120 Ga0070700_100226449 3300005441 Bacteria 1328
121 Ga0070663_100012053 3300005455 Bacteria 5454
122 Ga0070681_10149310 3300005458 Bacteria 2264
123 Ga0070699_101454200 3300005518 Bacteria 628
124 Ga0070679_100011795 3300005530 Bacteria 8334
125 Ga0068853_100006953 3300005539 Bacteria 9037
126 Ga0070686_100728751 3300005544 Bacteria 793
127 Ga0070695_100014657 3300005545 Bacteria 4725
128 Ga0070696_100167660 3300005546 Bacteria 1621
129 Ga0070696_100573476 3300005546 Bacteria 907
130 Ga0070693_100054039 3300005547 Bacteria 2308
131 Ga0070665_100017484 3300005548 Bacteria 7201
132 Ga0070665_100163366 3300005548 Bacteria 2229
133 Ga0070665_100560607 3300005548 Bacteria 1155
134 Ga0070665_101317981 3300005548 Bacteria 732
135 Ga0068855_100264669 3300005563 Bacteria 1914
136 Ga0070664_100122018 3300005564 Bacteria 2283
137 Ga0068857_100011437 3300005577 Bacteria 7722
138 Ga0068856_100042847 3300005614 Bacteria 4454
139 Ga0068852_100229239 3300005616 Bacteria 1770
140 Ga0068852_102009493 3300005616 Bacteria 600
141 Ga0068861_100180275 3300005719 Bacteria 1758
142 Ga0068861_100516386 3300005719 Bacteria 1083
143 Ga0068851_10228557 3300005834 Bacteria 1048
144 Ga0068870_10389177 3300005840 Bacteria 904
145 Ga0068858_100255602 3300005842 Bacteria 1665
146 Ga0068860_100313708 3300005843 Bacteria 1538
147 Ga0068860_101158658 3300005843 Bacteria 793
148 Ga0068862_100659349 3300005844 Bacteria 1010
149 Ga0068862_100936056 3300005844 Bacteria 854
150 Ga0081455_10551017 3300005937 Bacteria 762
151 Ga0075365_10005558 3300006038 Bacteria 6813
152 Ga0075365_10015363 3300006038 Bacteria 4630
153 Ga0075365_10022074 3300006038 Bacteria 3982
154 Ga0075365_10080516 3300006038 Bacteria 2205
155 Ga0075365_10137539 3300006038 Bacteria 1694
156 Ga0075365_10180469 3300006038 Bacteria 1476
157 Ga0075365_10418529 3300006038 Bacteria 946
158 Ga0075368_10000420 3300006042 Bacteria 12500
159 Ga0075368_10007881 3300006042 Bacteria 3777
160 Ga0075368_10059326 3300006042 Bacteria 1530
161 Ga0075368_10170086 3300006042 Bacteria 916
162 Ga0075363_100058165 3300006048 Bacteria 2076
163 Ga0075364_10000626 3300006051 Bacteria 18199
164 Ga0075364_10041349 3300006051 Bacteria 2993
165 Ga0075364_10102197 3300006051 Bacteria 1909
166 Ga0075364_10176575 3300006051 Bacteria 1445
167 Ga0070712_100511178 3300006175 Bacteria 1008
168 Ga0075367_10001232 3300006178 Bacteria 10750
169 Ga0075367_10007139 3300006178 Bacteria 5699
170 Ga0075367_10037445 3300006178 Bacteria 2819
171 Ga0075367_10048820 3300006178 Bacteria 2494
172 Ga0075369_10022821 3300006186 Bacteria 2584
173 Ga0075369_10112930 3300006186 Bacteria 1225
174 Ga0075366_10366080 3300006195 Bacteria 886
175 Ga0097621_100074068 3300006237 Bacteria 2820
176 Ga0075370_10001714 3300006353 Bacteria 9746
177 Ga0075370_10085955 3300006353 Bacteria 1811
178 Ga0075370_10139571 3300006353 Bacteria 1416
179 Ga0075428_100001633 3300006844 Bacteria 23932
180 Ga0075430_100273309 3300006846 Unclassified 1398
181 Ga0075431_100793232 3300006847 Bacteria 921
182 Ga0075434_100753295 3300006871 Bacteria 991
183 Ga0075429_100326005 3300006880 Bacteria 1344
184 Ga0079104_1000010 3300006946 Bacteria 366021
185 Ga0079104_1002748 3300006946 Bacteria 8951
186 Ga0079104_1012466 3300006946 Bacteria 2668
187 Ga0105251_10076072 3300009011 Bacteria 1558
188 Ga0105244_10341864 3300009036 Bacteria 690
189 Ga0105250_10337787 3300009092 Bacteria 657
190 Ga0105250_10388574 3300009092 Bacteria 617
191 Ga0105240_10000032 3300009093 Bacteria 283907
192 Ga0105245_10240025 3300009098 Bacteria 1756
193 Ga0105247_10132849 3300009101 Bacteria 1624
194 Ga0105247_10936699 3300009101 Bacteria 672
195 Ga0114129_10090961 3300009147 Bacteria 4229
196 Ga0114129_10882160 3300009147 Bacteria 1135
197 Ga0114129_11355331 3300009147 Bacteria 880
198 Ga0114129_11555401 3300009147 Bacteria 811
199 Ga0105243_10018348 3300009148 Bacteria 5298
200 Ga0105243_10131512 3300009148 Bacteria 2123
201 Ga0105242_10240740 3300009176 Bacteria 1626
202 Ga0105248_10055661 3300009177 Bacteria 4438
203 Ga0105248_10415690 3300009177 Bacteria 1514
204 Ga0105248_11365872 3300009177 Bacteria 801
205 Ga0105237_10001967 3300009545 Bacteria 26136
206 Ga0105237_10010754 3300009545 Bacteria 9711
207 Ga0105238_10026835 3300009551 Bacteria 5871
208 Ga0105238_11352837 3300009551 Bacteria 739
209 Ga0105249_11082382 3300009553 Bacteria 871
210 Ga0105249_11163537 3300009553 Bacteria 842
211 Ga0123340_1066116 3300009763 Bacteria 937
212 Ga0123341_1000048 3300009765 Bacteria 50946
213 Ga0123341_1090199 3300009765 Bacteria 1107
214 Ga0123341_1105118 3300009765 Bacteria 909
215 Ga0123342_1014993 3300009766 Bacteria 7212
216 Ga0123342_1026748 3300009766 Bacteria 3312
217 Ga0105239_10005020 3300010375 Bacteria 15622
218 Ga0105239_10684422 3300010375 Bacteria 1172
219 Ga0105239_10958856 3300010375 Bacteria 983
220 Ga0105239_11128767 3300010375 Bacteria 903
221 Ga0105239_11318623 3300010375 Bacteria 833
222 Ga0105246_10003304 3300011119 Bacteria 9765
223 Ga0105246_10437253 3300011119 Bacteria 1096
224 Ga0157373_10097971 3300013100 Bacteria 2064
225 Ga0157373_10176040 3300013100 Bacteria 1506
226 Ga0157373_10236448 3300013100 Bacteria 1291
227 Ga0157373_10613016 3300013100 Bacteria 793
228 Ga0157371_10000380 3300013102 Bacteria 55836
229 Ga0157371_10007779 3300013102 Bacteria 8612
230 Ga0157370_10000748 3300013104 Bacteria 40596
231 Ga0157370_10021519 3300013104 Bacteria 6426
232 Ga0157370_10049465 3300013104 Bacteria 4023
233 Ga0157369_10022319 3300013105 Bacteria 7065
234 Ga0157369_10190536 3300013105 Bacteria 2155
235 Ga0157369_10376366 3300013105 Bacteria 1474
236 Ga0157378_10116422 3300013297 Bacteria 2458
237 Ga0163162_10083214 3300013306 Bacteria 3273
238 Ga0163162_10504516 3300013306 Bacteria 1340
239 Ga0163162_10999324 3300013306 Bacteria 946
240 Ga0157375_10061504 3300013308 Bacteria 3729
241 Ga0157375_12192067 3300013308 Bacteria 658
242 Ga0163163_10133774 3300014325 Bacteria 2520
243 Ga0163163_11066444 3300014325 Bacteria 871
244 Ga0157380_10148417 3300014326 Bacteria 2024
245 Ga0157380_10158947 3300014326 Bacteria 1962
246 Ga0157380_10637280 3300014326 Bacteria 1061
247 Ga0157379_10159388 3300014968 Bacteria 2036
248 Ga0157376_10077018 3300014969 Bacteria 2851
249 Ga0182007_10004543 3300015262 Bacteria 6272
250 Ga0182005_1002238 3300015265 Bacteria 7106
251 Ga0214542_1015605 3300021321 Bacteria 7816
252 Ga0214543_1000003 3300021327 Bacteria 692327
253 Ga0228711_1000001 3300022739 Bacteria 357377
254 Ga0228710_1000001 3300022740 Bacteria 314328
255 Ga0209435_100036 3300025206 Bacteria 126970
256 Ga0209436_100064 3300025208 Bacteria 56015
257 Ga0209436_101612 3300025208 Bacteria 7544
258 Ga0209436_102305 3300025208 Bacteria 5850
259 Ga0209436_116920 3300025208 Bacteria 1081
260 Ga0209563_108942 3300025230 Bacteria 1548
261 Ga0209437_100033 3300025233 Bacteria 512520
262 Ga0209437_100075 3300025233 Bacteria 297202
263 Ga0207425_1000031 3300025245 Bacteria 261181
264 Ga0207425_1000994 3300025245 Bacteria 13306
265 Ga0207425_1005615 3300025245 Bacteria 3547
266 Ga0207425_1008116 3300025245 Bacteria 2713
267 Ga0207425_1062337 3300025245 Bacteria 655
268 Ga0207425_1062493 3300025245 Bacteria 654
269 Ga0209646_1000132 3300025246 Bacteria 126859
270 Ga0209646_1007424 3300025246 Bacteria 1794
271 Ga0209026_1000236 3300025250 Bacteria 73740
272 Ga0209677_101911 3300025253 Bacteria 8396
273 Ga0209148_1003173 3300025254 Bacteria 4731
274 Ga0209759_1000269 3300025256 Bacteria 73740
275 Ga0209129_1000053 3300025258 Bacteria 262823
276 Ga0209129_1000362 3300025258 Bacteria 37617
277 Ga0209129_1001787 3300025258 Bacteria 11465
278 Ga0209129_1002780 3300025258 Bacteria 8150
279 Ga0209129_1003220 3300025258 Bacteria 7281
280 Ga0209233_1000056 3300025261 Bacteria 438104
281 Ga0209233_1000064 3300025261 Bacteria 392156
282 Ga0209233_1000209 3300025261 Bacteria 115124
283 Ga0209233_1017599 3300025261 Bacteria 1944
284 Ga0209455_1012736 3300025272 Bacteria 1993
285 Ga0209673_1000041 3300025273 Bacteria 307397
286 Ga0209673_1000254 3300025273 Bacteria 101508
287 Ga0209673_1000850 3300025273 Bacteria 39843
288 Ga0209673_1010993 3300025273 Bacteria 3770
289 Ga0209673_1013263 3300025273 Bacteria 3263
290 Ga0209673_1022903 3300025273 Bacteria 2141
291 Ga0209130_1000006 3300025284 Bacteria 596528
292 Ga0209130_1000007 3300025284 Bacteria 591584
293 Ga0209130_1000018 3300025284 Bacteria 388301
294 Ga0209130_1000201 3300025284 Bacteria 80429
295 Ga0209130_1014518 3300025284 Bacteria 1973
296 Ga0209130_1035369 3300025284 Bacteria 999
297 Ga0209676_1000901 3300025292 Bacteria 37489
298 Ga0209676_1003899 3300025292 Bacteria 8694
299 Ga0209676_1022126 3300025292 Bacteria 2114
300 Ga0209025_1000016 3300025294 Bacteria 770739
301 Ga0209025_1000074 3300025294 Bacteria 277445
302 Ga0209025_1000080 3300025294 Bacteria 267244
303 Ga0209025_1000087 3300025294 Bacteria 261181
304 Ga0209025_1000100 3300025294 Bacteria 229182
305 Ga0209025_1000149 3300025294 Bacteria 173393
306 Ga0209025_1000284 3300025294 Bacteria 114754
307 Ga0209025_1000738 3300025294 Bacteria 55187
308 Ga0209025_1001555 3300025294 Bacteria 29161
309 Ga0209025_1008385 3300025294 Bacteria 7448
310 Ga0209025_1014151 3300025294 Bacteria 4941
311 Ga0209025_1014455 3300025294 Bacteria 4850
312 Ga0209025_1014457 3300025294 Bacteria 4850
313 Ga0209025_1021731 3300025294 Bacteria 3439
314 Ga0209564_1000233 3300025295 Bacteria 121692
315 Ga0209564_1000399 3300025295 Bacteria 77444
316 Ga0209564_1000846 3300025295 Bacteria 41021
317 Ga0209564_1003634 3300025295 Bacteria 10241
318 Ga0209564_1006463 3300025295 Bacteria 6312
319 Ga0209564_1009945 3300025295 Bacteria 4448
320 Ga0209758_1000081 3300025297 Bacteria 261181
321 Ga0209758_1000121 3300025297 Bacteria 192028
322 Ga0209758_1000420 3300025297 Bacteria 71919
323 Ga0209758_1003544 3300025297 Bacteria 14043
324 Ga0209758_1007760 3300025297 Bacteria 7187
325 Ga0209758_1011206 3300025297 Bacteria 5229
326 Ga0209758_1084672 3300025297 Bacteria 947
327 Ga0209758_1085504 3300025297 Bacteria 939
328 Ga0209050_1001776 3300025298 Bacteria 21253
329 Ga0209050_1005697 3300025298 Bacteria 7697
330 Ga0209050_1012695 3300025298 Bacteria 3833
331 Ga0209256_1000262 3300025299 Bacteria 93226
332 Ga0209256_1001151 3300025299 Bacteria 30005
333 Ga0209256_1002690 3300025299 Bacteria 13893
334 Ga0209256_1005237 3300025299 Bacteria 7593
335 Ga0209256_1009404 3300025299 Bacteria 4294
336 Ga0209256_1009886 3300025299 Bacteria 4098
337 Ga0209256_1070042 3300025299 Bacteria 791
338 Ga0207426_1000044 3300025302 Bacteria 428043
339 Ga0207426_1000064 3300025302 Bacteria 358276
340 Ga0207426_1000106 3300025302 Bacteria 244368
341 Ga0207426_1000265 3300025302 Bacteria 110545
342 Ga0207426_1001649 3300025302 Bacteria 17375
343 Ga0207426_1012269 3300025302 Bacteria 3225
344 Ga0209051_1001024 3300025303 Bacteria 26621
345 Ga0209051_1001371 3300025303 Bacteria 21046
346 Ga0209051_1003839 3300025303 Bacteria 9620
347 Ga0209051_1007379 3300025303 Bacteria 6018
348 Ga0209051_1032709 3300025303 Bacteria 1979
349 Ga0209051_1073570 3300025303 Bacteria 1017
350 Ga0209257_1001970 3300025304 Bacteria 22108
351 Ga0209257_1002234 3300025304 Bacteria 19896
352 Ga0209257_1003486 3300025304 Bacteria 13416
353 Ga0209257_1070518 3300025304 Bacteria 923
354 Ga0209257_1070664 3300025304 Bacteria 921
355 Ga0207656_10077781 3300025321 Bacteria 1486
356 Ga0207655_1226194 3300025728 Bacteria 542
357 Ga0207713_1065031 3300025735 Bacteria 1370
358 Ga0207647_10007210 3300025904 Bacteria 8053
359 Ga0207645_10120623 3300025907 Bacteria 1702
360 Ga0207645_10793316 3300025907 Bacteria 644
361 Ga0207645_10968393 3300025907 Bacteria 577
362 Ga0207707_10123433 3300025912 Bacteria 2264
363 Ga0207695_10000024 3300025913 Bacteria 632311
364 Ga0207671_10000548 3300025914 Bacteria 50646
365 Ga0207671_10189774 3300025914 Bacteria 1602
366 Ga0207660_10037859 3300025917 Bacteria 3364
367 Ga0207662_10057392 3300025918 Bacteria 2327
368 Ga0207652_10151956 3300025921 Bacteria 2073
369 Ga0207681_10122745 3300025923 Bacteria 1908
370 Ga0207681_10216967 3300025923 Bacteria 1478
371 Ga0207681_10458558 3300025923 Bacteria 1038
372 Ga0207650_10350317 3300025925 Bacteria 1215
373 Ga0207650_10691984 3300025925 Bacteria 861
374 Ga0207687_10612063 3300025927 Bacteria 919
375 Ga0207644_10941306 3300025931 Bacteria 724
376 Ga0207690_10043762 3300025932 Bacteria 2948
377 Ga0207709_10901001 3300025935 Bacteria 719
378 Ga0207709_11207872 3300025935 Bacteria 623
379 Ga0207704_10243171 3300025938 Bacteria 1346
380 Ga0207711_10106686 3300025941 Bacteria 2486
381 Ga0207711_10217093 3300025941 Bacteria 1748
382 Ga0207711_10736860 3300025941 Bacteria 919
383 Ga0207679_10041268 3300025945 Bacteria 3308
384 Ga0207667_10227210 3300025949 Bacteria 1912
385 Ga0207667_10977064 3300025949 Bacteria 835
386 Ga0207712_10187465 3300025961 Bacteria 1630
387 Ga0207712_11627188 3300025961 Bacteria 579
388 Ga0207668_10085573 3300025972 Bacteria 2301
389 Ga0207668_10088261 3300025972 Bacteria 2271
390 Ga0207668_10118538 3300025972 Bacteria 2000
391 Ga0207703_10293535 3300026035 Bacteria 1480
392 Ga0207703_10513789 3300026035 Bacteria 1126
393 Ga0207678_10000073 3300026067 Bacteria 80235
394 Ga0207678_10213626 3300026067 Bacteria 1650
395 Ga0207678_10506547 3300026067 Bacteria 1053
396 Ga0207708_10356361 3300026075 Bacteria 1201
397 Ga0207708_10461046 3300026075 Bacteria 1060
398 Ga0207708_10685864 3300026075 Bacteria 875
399 Ga0207641_10616016 3300026088 Bacteria 1064
400 Ga0207648_10130898 3300026089 Bacteria 2208
401 Ga0207676_10305401 3300026095 Bacteria 1454
402 Ga0207674_10271250 3300026116 Bacteria 1644
403 Ga0207675_100246178 3300026118 Bacteria 1729
404 Ga0207698_10018742 3300026142 Bacteria 4724
405 Ga0209281_1000053 3300027111 Bacteria 309587
406 Ga0209281_1000164 3300027111 Bacteria 157372
407 Ga0209281_1002461 3300027111 Bacteria 7391
408 Ga0209371_1000021 3300027312 Bacteria 555864
409 Ga0209371_1004458 3300027312 Bacteria 6078
410 Ga0209371_1005193 3300027312 Bacteria 5288
411 Ga0209282_1000007 3300027666 Bacteria 254917
412 Ga0209813_10000849 3300027866 Bacteria 6904
413 Ga0209813_10227465 3300027866 Bacteria 700
414 Ga0209813_10308877 3300027866 Bacteria 616
415 Ga0268266_10039938 3300028379 Bacteria 3998
416 Ga0268266_10043770 3300028379 Bacteria 3827
417 Ga0268266_10063381 3300028379 Bacteria 3191
418 Ga0268266_11296908 3300028379 Bacteria 703
419 Ga0268265_10820190 3300028380 Bacteria 908
420 Ga0268265_10980634 3300028380 Bacteria 834
421 Ga0268264_10416479 3300028381 Bacteria 1295
422 Ga0268264_10542338 3300028381 Bacteria 1140
423 Ga0268264_11277254 3300028381 Bacteria 744
424 Ga0268264_11777694 3300028381 Bacteria 627
425 Ga0265337_1007096 3300028556 Bacteria 4231
426 Ga0265334_10003327 3300028573 Bacteria 7331
427 Ga0307515_10024373 3300028794 Bacteria 10546
428 Ga0307515_10275303 3300028794 Bacteria 1398
429 Ga0307515_10322155 3300028794 Bacteria 1211
430 Ga0307515_10679160 3300028794 Bacteria 644
431 Ga0265338_10011614 3300028800 Bacteria 10150
432 Ga0268256_1000020 3300030500 Bacteria 557873
433 Ga0268256_1001181 3300030500 Bacteria 16760
434 Ga0265339_10158470 3300031249 Bacteria 1140
435 Ga0265331_10047848 3300031250 Bacteria 2058
436 Ga0307513_10004545 3300031456 Bacteria 18512
437 Ga0307513_10115492 3300031456 Bacteria 2667
438 Ga0307408_100084834 3300031548 Bacteria 2377
439 Ga0265313_10033807 3300031595 Bacteria 2594
440 Ga0307405_10158899 3300031731 Bacteria 1598
441 Ga0307405_10184672 3300031731 Bacteria 1500
442 Ga0307406_10028875 3300031901 Bacteria 3354
443 Ga0307412_10051009 3300031911 Bacteria 2733
444 Ga0307412_10102454 3300031911 Bacteria 2027
445 Ga0307412_10103925 3300031911 Bacteria 2015
446 Ga0307412_10283529 3300031911 Bacteria 1302
447 Ga0307412_10386357 3300031911 Bacteria 1135
448 Ga0307412_10464506 3300031911 Bacteria 1046
449 Ga0307412_11640383 3300031911 Bacteria 588
450 Ga0315914_1000006 3300031967 Bacteria 239817
451 Ga0307409_100025497 3300031995 Bacteria 4149
452 Ga0307409_100207573 3300031995 Bacteria 1758
453 Ga0307409_100426765 3300031995 Bacteria 1273
454 Ga0307416_100635463 3300032002 Bacteria 1151
455 Ga0307416_100761462 3300032002 Bacteria 1062
456 Ga0307416_102236989 3300032002 Bacteria 648
457 Ga0307415_100118934 3300032126 Bacteria 1977
458 Ga0315913_1000002 3300033430 Bacteria 241452
459 Ga0315915_1000001 3300033464 Bacteria 481518
460 Ga0373954_0279056 3300035118 Bacteria 824
461 Ga0373956_0462474 3300035119 Bacteria 605
462 Ga0373943_0077583 3300035170 Bacteria 1697
463 Ga0316574_0339157 3300035398 Bacteria 952
464 Ga0373931_0034077 3300035691 Bacteria 2641
465 Ga0373931_0300835 3300035691 Bacteria 991
466 Ga0373935_0020750 3300035692 Bacteria 4017
467 Ga0373927_0000554 3300035695 Bacteria 28491
468 Ga0373927_0134333 3300035695 Bacteria 1617
469 Ga0373933_0212982 3300035724 Bacteria 1238
470 Ga0373947_0265490 3300035725 Bacteria 1138
471 Ga0373937_0213670 3300036401 Bacteria 1815
472 Ga0373937_1368098 3300036401 Bacteria 656
473 Ga0373925_0011828 3300037068 Bacteria 6315
474 Ga0373925_0788134 3300037068 Bacteria 784
475 Ga0395899_0440145 3300037312 Bacteria 856
476 Ga0395900_0081668 3300037418 Bacteria 3321
477 Ga0395900_0318112 3300037418 Bacteria 1537
478 Ga0395905_0006076 3300037471 Bacteria 12209
479 Ga0395905_0013147 3300037471 Bacteria 7944
480 Ga0395905_0030383 3300037471 Bacteria 5091
481 Ga0395905_1268393 3300037471 Bacteria 640
482 Ga0436365_1591560 3300039437 Bacteria 1026
483 Ga0439436_0014549 3300041404 Bacteria 2372
484 Ga0439436_0041064 3300041404 Bacteria 1324
485 Ga0439438_060850 3300041405 Bacteria 946
486 Ga0439466_0038686 3300041411 Bacteria 1602
487 Ga0439466_0054407 3300041411 Bacteria 1304
488 Ga0439465_0002776 3300041413 Bacteria 5734
489 Ga0439465_0044300 3300041413 Bacteria 1445
490 Ga0439465_0155352 3300041413 Bacteria 819
491 Ga0451787_623160 3300041441 Bacteria 3419
492 Ga0451791_0930133 3300041451 Bacteria 569
493 Ga0451791_1108890 3300041451 Bacteria 1082
494 Ga0451798_0731341 3300041458 Bacteria 1136
495 Ga0451802_1141809 3300041460 Bacteria 2009
496 Ga0451802_1570359 3300041460 Bacteria 683
497 Ga0451802_2160217 3300041460 Unclassified 893
498 Ga0451806_262218 3300041462 Bacteria 545
499 Ga0451833_0415382 3300041491 Bacteria 891
500 Ga0451835_1102525 3300041492 Bacteria 1609
501 Ga0451839_1003243 3300041496 Bacteria 2865
502 Ga0451841_0239153 3300041498 Bacteria 2046
503 Ga0451844_18177 3300041500 Bacteria 585
504 Ga0451845_0588294 3300041501 Bacteria 1267
505 Ga0451846_37911 3300041502 Bacteria 1191
506 Ga0451847_0753556 3300041503 Bacteria 2400
507 Ga0451849_0147068 3300041505 Bacteria 2033
508 Ga0451849_1455101 3300041505 Bacteria 1536
509 Ga0451851_0643395 3300041507 Bacteria 1823
510 Ga0451843_0925659 3300041509 Bacteria 1660
511 Ga0451854_20336 3300041510 Bacteria 1925
512 Ga0451855_0785564 3300041511 Bacteria 1790
513 Ga0451855_0812296 3300041511 Bacteria 2029
514 Ga0452268_17162 3300041907 Bacteria 2256
515 Ga0452271_12430 3300041916 Bacteria 1315
516 Ga0439431_0039855 3300041997 Bacteria 1193
517 Ga0439445_0014819 3300042004 Bacteria 1903
518 Ga0439445_0050072 3300042004 Bacteria 1126
519 Ga0439448_0151941 3300042005 Bacteria 804
520 Ga0439449_0035248 3300042007 Bacteria 1863
521 Ga0450920_014679 3300042122 Bacteria 1484
522 Ga0450906_040979 3300042145 Bacteria 817
523 Ga0450918_003382 3300042531 Bacteria 2968
524 Ga0466972_0060492 3300044658 Bacteria 1817
525 Ga0466965_0058713 3300044683 Bacteria 1919
526 Ga0466966_0075696 3300044684 Bacteria 2103
527 Ga0466963_0242014 3300044694 Bacteria 1265
528 Ga0466968_0197590 3300044735 Bacteria 941
529 Ga0466970_0035949 3300044765 Bacteria 2623
530 Ga0466960_0011270 3300044901 Bacteria 3735
531 Ga0451576_0128494 3300045051 Bacteria 2641
532 Ga0495617_033035 3300046452 Bacteria 1737
533 Ga0495617_114079 3300046452 Bacteria 873
534 Ga0495627_089122 3300046453 Bacteria 888
535 Ga0495603_0039840 3300046455 Bacteria 2814
536 Ga0495638_0000353 3300046460 Bacteria 57451
537 Ga0495638_0136555 3300046460 Bacteria 1435
538 Ga0495638_0239196 3300046460 Bacteria 1006
539 Ga0495638_0624781 3300046460 Bacteria 526
540 Ga0495651_0189460 3300046462 Bacteria 1449
541 Ga0495651_0290393 3300046462 Bacteria 1101
542 Ga0495650_0043640 3300046471 Bacteria 1901
543 Ga0495650_0111280 3300046471 Bacteria 1017
544 Ga0495605_0040656 3300046474 Bacteria 2320
545 Ga0495639_0054241 3300046475 Bacteria 1827
546 Ga0495664_0184763 3300046477 Bacteria 1264
547 Ga0495584_0422641 3300046491 Bacteria 678
548 Ga0495585_0013046 3300046492 Bacteria 4875
549 Ga0495585_0033706 3300046492 Bacteria 2898
550 Ga0495585_0053055 3300046492 Bacteria 2244
551 Ga0495607_0076199 3300046501 Bacteria 1856
552 Ga0495607_0133287 3300046501 Bacteria 1290
553 Ga0495607_0173839 3300046501 Bacteria 1085
554 Ga0495583_0008919 3300046506 Bacteria 6060
555 Ga0495583_0031007 3300046506 Bacteria 2597
556 Ga0495606_0000914 3300046507 Bacteria 43775
557 Ga0495606_0040432 3300046507 Bacteria 3134
558 Ga0495606_0064155 3300046507 Bacteria 2339
559 Ga0495606_0086580 3300046507 Bacteria 1936
560 Ga0495606_0088949 3300046507 Bacteria 1903
561 Ga0495606_0160217 3300046507 Bacteria 1313
562 Ga0495606_0185343 3300046507 Bacteria 1197
563 Ga0495610_0009256 3300046512 Bacteria 6247
564 Ga0495610_0025623 3300046512 Bacteria 3160
565 Ga0495610_0058343 3300046512 Bacteria 1847
566 Ga0495616_0051818 3300046513 Bacteria 2045
567 Ga0495616_0073362 3300046513 Bacteria 1651
568 Ga0495620_0006737 3300046515 Bacteria 6286
569 Ga0495620_0212352 3300046515 Bacteria 742
570 Ga0495630_0488050 3300046517 Bacteria 945
571 Ga0495631_0001310 3300046518 Bacteria 15251
572 Ga0495631_0060702 3300046518 Bacteria 1640
573 Ga0495632_0006839 3300046519 Bacteria 7276
574 Ga0495632_0162808 3300046519 Bacteria 1027
575 Ga0495643_0004164 3300046522 Bacteria 10271
576 Ga0495643_0265851 3300046522 Bacteria 794
577 Ga0495663_0109847 3300046525 Bacteria 915
578 Ga0495654_0001866 3300046530 Bacteria 14028
579 Ga0495654_0067784 3300046530 Bacteria 1698
580 Ga0495654_0079108 3300046530 Bacteria 1545
581 Ga0495609_0097941 3300046538 Bacteria 1272
582 Ga0495597_0005582 3300046542 Bacteria 6640
583 Ga0495633_0056857 3300046558 Bacteria 1838
584 Ga0495633_0090924 3300046558 Bacteria 1419
585 Ga0495633_0531915 3300046558 Bacteria 529
586 Ga0495656_0006367 3300046615 Bacteria 4140
587 Ga0495668_0006786 3300046616 Bacteria 7440
588 Ga0495668_0050244 3300046616 Bacteria 2311
589 Ga0495634_0351221 3300046642 Bacteria 883
590 Ga0495625_0002820 3300046660 Bacteria 18292
591 Ga0495625_0037919 3300046660 Bacteria 3531
592 Ga0495625_0038967 3300046660 Bacteria 3473
593 Ga0495625_0050667 3300046660 Bacteria 2979
594 Ga0495625_0172291 3300046660 Bacteria 1444
595 Ga0495625_0201627 3300046660 Bacteria 1313
596 Ga0495625_0304997 3300046660 Bacteria 1018
597 Ga0495588_0007402 3300046674 Bacteria 4993
598 Ga0495647_0386901 3300046681 Bacteria 641
599 Ga0495670_0165237 3300046691 Bacteria 1164
600 Ga0495670_0283078 3300046691 Bacteria 887
601 Ga0495671_0155280 3300046692 Bacteria 1114
602 Ga0495649_0054191 3300046694 Bacteria 2169
603 Ga0495649_0076133 3300046694 Bacteria 1796
604 Ga0495660_0020810 3300046810 Bacteria 3761
605 Ga0495604_0081902 3300047317 Bacteria 2415
606 Ga0495680_0394857 3300047322 Bacteria 956
607 Ga0495687_009165 3300047443 Bacteria 5568
608 Ga0495675_0347517 3300047444 Bacteria 873
609 Ga0495673_0051276 3300047469 Bacteria 1808
610 Ga0495681_0074686 3300047470 Bacteria 1528
611 Ga0495681_0078524 3300047470 Bacteria 1479
612 Ga0495681_0118140 3300047470 Bacteria 1141
613 Ga0495686_0003601 3300047472 Bacteria 13289
614 Ga0495686_0012458 3300047472 Bacteria 5947
615 Ga0495686_0023304 3300047472 Bacteria 4085
616 Ga0495686_0136255 3300047472 Bacteria 1452
617 Ga0495686_0167645 3300047472 Bacteria 1279
618 Ga0495686_0274023 3300047472 Bacteria 940
619 Ga0496100_0675881 3300048903 Bacteria 805
620 Ga0496101_0123285 3300048904 Bacteria 1961
621 Ga0496101_0564764 3300048904 Bacteria 900
622 Ga0496102_0087306 3300048905 Bacteria 2882
623 Ga0496102_0512846 3300048905 Bacteria 1121
624 Ga0496102_0911931 3300048905 Bacteria 800
625 Ga0496103_0005124 3300048906 Bacteria 7890
626 Ga0496103_0034563 3300048906 Bacteria 3091
627 Ga0496103_0151750 3300048906 Bacteria 1484
628 Ga0496103_0283712 3300048906 Bacteria 1065
629 Ga0496104_0000182 3300048907 Bacteria 56117
630 Ga0496104_0182085 3300048907 Bacteria 2011
631 Ga0496104_0194156 3300048907 Bacteria 1942
632 Ga0496105_0016358 3300048908 Bacteria 5921
633 Ga0496105_0314354 3300048908 Bacteria 1257
634 Ga0496106_0000154 3300048909 Bacteria 50775
635 Ga0496106_0004892 3300048909 Bacteria 9919
636 Ga0496106_0231769 3300048909 Bacteria 1474
637 Ga0496106_0384681 3300048909 Bacteria 1127
638 Ga0496106_0761109 3300048909 Bacteria 770
639 Ga0496107_0001454 3300048910 Bacteria 14645
640 Ga0496107_0048975 3300048910 Bacteria 3045
641 Ga0496107_0234246 3300048910 Bacteria 1366
642 Ga0496108_0001152 3300048911 Bacteria 20646
643 Ga0496108_0158482 3300048911 Bacteria 1955
644 Ga0496109_0002055 3300048912 Bacteria 16695
645 Ga0496109_0984563 3300048912 Bacteria 781
646 Ga0496110_0008147 3300048913 Bacteria 8419
647 Ga0496110_0113099 3300048913 Bacteria 2441
648 Ga0496110_0168855 3300048913 Bacteria 1984
649 Ga0496111_0002494 3300048914 Bacteria 11099
650 Ga0496111_0051603 3300048914 Bacteria 2969
651 Ga0496111_0607247 3300048914 Bacteria 800
652 Ga0496112_0015595 3300048915 Bacteria 7097
653 Ga0496112_0259646 3300048915 Bacteria 1687
654 Ga0496113_0020005 3300048916 Bacteria 4696
655 Ga0496113_0290265 3300048916 Bacteria 1308
656 Ga0496113_0446974 3300048916 Bacteria 1038
657 Ga0496114_0395900 3300048917 Bacteria 1223
658 Ga0496115_0003092 3300048918 Bacteria 11954
659 Ga0496116_0000036 3300048919 Bacteria 388508
660 Ga0496116_0002110 3300048919 Bacteria 21206
661 Ga0496116_0027523 3300048919 Bacteria 4138
662 Ga0496116_0029336 3300048919 Bacteria 3968
663 Ga0496116_0037540 3300048919 Bacteria 3376
664 Ga0496116_0053240 3300048919 Bacteria 2674
665 Ga0496116_0067683 3300048919 Bacteria 2279
666 Ga0496116_0152033 3300048919 Bacteria 1284
667 Ga0496116_0216549 3300048919 Bacteria 986
668 Ga0496116_0244832 3300048919 Bacteria 897
669 Ga0496116_0253224 3300048919 Bacteria 874
670 Ga0496117_0000002 3300048920 Bacteria 2483758
671 Ga0496117_0002153 3300048920 Bacteria 25711
672 Ga0496117_0010551 3300048920 Bacteria 8400
673 Ga0496117_0018819 3300048920 Bacteria 5700
674 Ga0496117_0104089 3300048920 Bacteria 1787
675 Ga0496117_0259354 3300048920 Bacteria 943
676 Ga0496117_0321984 3300048920 Bacteria 810
677 Ga0496118_0000695 3300048921 Bacteria 54668
678 Ga0496118_0009554 3300048921 Bacteria 9766
679 Ga0496118_0014074 3300048921 Bacteria 7508
680 Ga0496118_0047727 3300048921 Bacteria 3316
681 Ga0496118_0073124 3300048921 Bacteria 2458
682 Ga0496118_0098500 3300048921 Bacteria 1985
683 Ga0496118_0149953 3300048921 Bacteria 1461
684 Ga0496119_0011122 3300048922 Bacteria 7494
685 Ga0496119_0012390 3300048922 Bacteria 6933
686 Ga0496119_0044942 3300048922 Bacteria 2774
687 Ga0496119_0046970 3300048922 Bacteria 2690
688 Ga0496119_0073510 3300048922 Bacteria 1993
689 Ga0496119_0153522 3300048922 Bacteria 1231
690 Ga0496120_0000125 3300048923 Bacteria 128983
691 Ga0496120_0011795 3300048923 Bacteria 5981
692 Ga0496120_0062552 3300048923 Bacteria 2073
693 Ga0496120_0129367 3300048923 Bacteria 1295
694 Ga0496121_0000001 3300048924 Bacteria 1830318
695 Ga0496121_0003656 3300048924 Bacteria 21630
696 Ga0496121_0014220 3300048924 Bacteria 8464
697 Ga0496121_0017825 3300048924 Bacteria 7212
698 Ga0496121_0042528 3300048924 Bacteria 3949
699 Ga0496121_0138826 3300048924 Bacteria 1806
700 Ga0496121_0597394 3300048924 Unclassified 682
701 Ga0496122_0000001 3300048925 Bacteria 1827766
702 Ga0496122_0000009 3300048925 Bacteria 584024
703 Ga0496122_0012658 3300048925 Bacteria 8365
704 Ga0496122_0021382 3300048925 Bacteria 5794
705 Ga0496122_0027430 3300048925 Bacteria 4868
706 Ga0496122_0041867 3300048925 Bacteria 3613
707 Ga0496122_0054647 3300048925 Bacteria 2996
708 Ga0496122_0104601 3300048925 Bacteria 1880
709 Ga0496122_0106300 3300048925 Bacteria 1858
710 Ga0496122_0107404 3300048925 Bacteria 1844
711 Ga0496122_0118320 3300048925 Bacteria 1717
712 Ga0496122_0121174 3300048925 Bacteria 1686
713 Ga0496122_0249702 3300048925 Bacteria 993
714 Ga0496123_0000001 3300048926 Bacteria 1831497
715 Ga0496123_0000034 3300048926 Bacteria 274836
716 Ga0496123_0000460 3300048926 Bacteria 71476
717 Ga0496123_0014859 3300048926 Bacteria 6424
718 Ga0496123_0030287 3300048926 Bacteria 3963
719 Ga0496123_0045004 3300048926 Bacteria 3011
720 Ga0496123_0053635 3300048926 Bacteria 2662
721 Ga0496123_0064647 3300048926 Bacteria 2330
722 Ga0496123_0077597 3300048926 Bacteria 2039
723 Ga0496123_0082560 3300048926 Bacteria 1947
724 Ga0496123_0083465 3300048926 Bacteria 1932
725 Ga0496123_0130472 3300048926 Bacteria 1393
726 Ga0496123_0154898 3300048926 Bacteria 1230
727 Ga0496123_0234283 3300048926 Bacteria 916
728 Ga0496124_0000133 3300048927 Bacteria 154328
729 Ga0496124_0000679 3300048927 Bacteria 55901
730 Ga0496124_0005281 3300048927 Bacteria 14613
731 Ga0496124_0010940 3300048927 Bacteria 9126
732 Ga0496124_0011796 3300048927 Bacteria 8709
733 Ga0496124_0018876 3300048927 Bacteria 6439
734 Ga0496124_0041605 3300048927 Bacteria 3963
735 Ga0496124_0054133 3300048927 Bacteria 3398
736 Ga0496124_0075360 3300048927 Bacteria 2787
737 Ga0496124_0093958 3300048927 Bacteria 2440
738 Ga0496124_0148303 3300048927 Bacteria 1843
739 Ga0496124_0344022 3300048927 Bacteria 1058
740 Ga0496124_0346016 3300048927 Bacteria 1053
741 Ga0496124_0440027 3300048927 Bacteria 892
742 Ga0496124_0623126 3300048927 Bacteria 697
743 Ga0496125_0000001 3300048928 Bacteria 1766138
744 Ga0496125_0008983 3300048928 Bacteria 10362
745 Ga0496125_0043867 3300048928 Bacteria 3790
746 Ga0496125_0062733 3300048928 Bacteria 2969
747 Ga0496125_0075403 3300048928 Bacteria 2610
748 Ga0496125_0090818 3300048928 Bacteria 2290
749 Ga0496125_0106331 3300048928 Bacteria 2048
750 Ga0496125_0403847 3300048928 Bacteria 797
751 Ga0496125_0468692 3300048928 Bacteria 717
752 Ga0496126_0000597 3300048929 Bacteria 68119
753 Ga0496126_0013467 3300048929 Bacteria 8312
754 Ga0496126_0040374 3300048929 Bacteria 4325
755 Ga0496126_0054420 3300048929 Bacteria 3624
756 Ga0496126_0071472 3300048929 Bacteria 3089
757 Ga0496126_0338241 3300048929 Bacteria 1233
758 Ga0496126_0390178 3300048929 Bacteria 1131
759 Ga0496126_0482486 3300048929 Bacteria 993
760 Ga0496126_1108052 3300048929 Bacteria 587
761 Ga0495678_045935 3300049459 Bacteria 1720
762 Ga0495682_0124544 3300049460 Bacteria 922
763 Ga0501031_0014195 3300049568 Bacteria 5183
764 Ga0501031_0134642 3300049568 Bacteria 1614
765 Ga0501031_0595029 3300049568 Bacteria 712
766 Ga0501032_0033647 3300049569 Bacteria 3511
767 Ga0501032_0079221 3300049569 Bacteria 2187
768 Ga0501032_0099013 3300049569 Bacteria 1931
769 Ga0501032_0180087 3300049569 Bacteria 1384
770 Ga0501032_0260226 3300049569 Bacteria 1125
771 Ga0501032_0268935 3300049569 Bacteria 1105
772 Ga0501032_0409442 3300049569 Bacteria 871
773 Ga0501033_0030548 3300049570 Bacteria 4048
774 Ga0501033_0047968 3300049570 Bacteria 3174
775 Ga0501033_0327875 3300049570 Bacteria 1075
776 Ga0501034_0000391 3300049571 Bacteria 74631
777 Ga0501034_0005961 3300049571 Bacteria 13193
778 Ga0501034_0025458 3300049571 Bacteria 6024
779 Ga0501034_0051843 3300049571 Bacteria 4136
780 Ga0501034_0097519 3300049571 Bacteria 2935
781 Ga0501034_0106827 3300049571 Bacteria 2792
782 Ga0501034_0493967 3300049571 Bacteria 1138
783 Ga0501036_0436232 3300049572 Bacteria 1092
784 Ga0501037_0021211 3300049573 Bacteria 4800
785 Ga0501037_0046042 3300049573 Bacteria 3200
786 Ga0501037_0073660 3300049573 Bacteria 2483
787 Ga0501037_0098144 3300049573 Bacteria 2116
788 Ga0501037_0114748 3300049573 Bacteria 1939
789 Ga0501037_0267143 3300049573 Bacteria 1195
790 Ga0501038_0032464 3300049574 Bacteria 4606
791 Ga0501038_0075660 3300049574 Bacteria 2845
792 Ga0501038_0112787 3300049574 Bacteria 2250
793 Ga0501038_0129996 3300049574 Bacteria 2068
794 Ga0501038_0287674 3300049574 Bacteria 1292
795 Ga0501039_0000070 3300049575 Bacteria 77967
796 Ga0501039_0247721 3300049575 Bacteria 1401
797 Ga0501043_0039452 3300049579 Bacteria 3710
798 Ga0501043_0044532 3300049579 Bacteria 3489
799 Ga0501043_0345825 3300049579 Bacteria 1130
800 Ga0501046_0000319 3300049580 Bacteria 48364
801 Ga0501046_0007046 3300049580 Bacteria 9904
802 Ga0501046_0018480 3300049580 Bacteria 5799
803 Ga0501046_0148397 3300049580 Bacteria 1770
804 Ga0501046_0381913 3300049580 Bacteria 1019
805 Ga0501047_0000102 3300049581 Bacteria 104950
806 Ga0501047_0065018 3300049581 Bacteria 3517
807 Ga0501047_0095919 3300049581 Bacteria 2844
808 Ga0501047_0396403 3300049581 Bacteria 1213
809 Ga0501047_0428924 3300049581 Bacteria 1153
810 Ga0501047_0496454 3300049581 Bacteria 1047
811 Ga0501048_0001040 3300049582 Bacteria 20782
812 Ga0501048_1212629 3300049582 Bacteria 543
813 Ga0501067_0005270 3300049583 Bacteria 7183
814 Ga0501067_0027879 3300049583 Bacteria 3130
815 Ga0501068_0386373 3300049584 Bacteria 902
816 Ga0501070_0021105 3300049586 Bacteria 5465
817 Ga0501070_0045874 3300049586 Bacteria 3634
818 Ga0501070_0188920 3300049586 Bacteria 1694
819 Ga0501073_0045682 3300049589 Bacteria 3084
820 Ga0501073_0066493 3300049589 Bacteria 2513
821 Ga0501073_0122764 3300049589 Bacteria 1800
822 Ga0501073_0127523 3300049589 Bacteria 1764
823 Ga0501073_0398724 3300049589 Bacteria 950
824 Ga0501073_1125718 3300049589 Bacteria 539
825 Ga0501074_0442984 3300049590 Bacteria 921
826 Ga0501075_1230923 3300049591 Bacteria 568
827 Ga0501077_0497639 3300049593 Bacteria 781
828 Ga0501079_0762628 3300049741 Bacteria 762
829 Ga0501080_0000028 3300049742 Bacteria 88948
830 Ga0501080_1077678 3300049742 Bacteria 694
831 Ga0501080_1536519 3300049742 Bacteria 565
832 Ga0501081_0324703 3300049743 Bacteria 1132
833 Ga0501081_1373632 3300049743 Bacteria 536
834 Ga0501083_0035643 3300049744 Bacteria 3397
835 Ga0501083_0534335 3300049744 Bacteria 763
836 Ga0501035_0000020 3300049822 Bacteria 221605
837 Ga0501035_0006482 3300049822 Bacteria 10997
838 Ga0501035_0085856 3300049822 Bacteria 2773
839 Ga0501035_0227840 3300049822 Bacteria 1589
840 Ga0501035_0465802 3300049822 Bacteria 1044
841 Ga0501044_0000007 3300049823 Bacteria 283429
842 Ga0501044_0035814 3300049823 Bacteria 5195
843 Ga0501044_0087555 3300049823 Bacteria 3146
844 Ga0501044_0697956 3300049823 Bacteria 900
845 Ga0501045_0084042 3300049824 Bacteria 2348
846 nmdc:mga03683_212910_c1 3300050489 Bacteria 889
847 nmdc:mga03n38_234574_c1 3300050490 Bacteria 963
848 nmdc:mga03n38_278161_c1 3300050490 Bacteria 892
849 nmdc:mga03n38_9060_c1 3300050490 Bacteria 3601
850 nmdc:mga00v17_10264_c1 3300050491 Bacteria 5107
851 nmdc:mga00v17_1031_c1 3300050491 Bacteria 14843
852 nmdc:mga00v17_193335_c1 3300050491 Bacteria 1314
853 nmdc:mga00v17_272380_c1 3300050491 Bacteria 1098
854 nmdc:mga00v17_33379_c2 3300050491 Bacteria 1660
855 nmdc:mga00v17_402474_c1 3300050491 Bacteria 889
856 nmdc:mga00v17_5417_c1 3300050491 Bacteria 6722
857 nmdc:mga0yw44_114628_c1 3300050492 Bacteria 1730
858 nmdc:mga0yw44_117174_c1 3300050492 Bacteria 1712
859 nmdc:mga0yw44_141492_c1 3300050492 Bacteria 1564
860 nmdc:mga0yw44_7029_c1 3300050492 Bacteria 5505
861 nmdc:mga0k408_20784_c1 3300050493 Bacteria 3683
862 nmdc:mga0k408_89606_c1 3300050493 Bacteria 1807
863 nmdc:mga06z11_1197_c1 3300050494 Bacteria 9554
864 nmdc:mga06z11_41558_c1 3300050494 Bacteria 2302
865 nmdc:mga06z11_490234_c1 3300050494 Bacteria 744
866 nmdc:mga06z11_4979_c1 3300050494 Bacteria 5280
867 nmdc:mga04h51_138143_c1 3300050495 Bacteria 922
868 nmdc:mga04h51_177942_c1 3300050495 Bacteria 826
869 nmdc:mga04h51_4050_c1 3300050495 Bacteria 3613
870 nmdc:mga04h51_71714_c1 3300050495 Bacteria 1211
871 nmdc:mga04h51_90595_c1 3300050495 Bacteria 1100
872 nmdc:mga07m45_705225_c1 3300050496 Bacteria 580
873 nmdc:mga09592_166517_c1 3300050508 Bacteria 1905
874 nmdc:mga0qj67_310528_c1 3300050509 Unclassified 1277
875 nmdc:mga06r32_810729_c1 3300050510 Bacteria 896
876 nmdc:mga06r32_9052_c1 3300050510 Bacteria 8972
877 nmdc:mga08y16_1240461_c1 3300050511 Unclassified 715
878 nmdc:mga08y16_46046_c1 3300050511 Bacteria 4568
879 nmdc:mga0n895_565252_c1 3300050512 Bacteria 1142
880 nmdc:mga0sz30_150_c1 3300050516 Bacteria 25823
881 nmdc:mga0sz30_19706_c1 3300050516 Bacteria 2714
882 nmdc:mga0sz30_420735_c1 3300050516 Bacteria 599
883 Ga0495601_0100774 3300053077 Bacteria 1865
884 Ga0500610_0039413 3300053079 Bacteria 2437
885 Ga0495595_0168963 3300053084 Bacteria 1082
886 Ga0495619_0056285 3300053085 Bacteria 2607
887 Ga0500578_0011601 3300053086 Bacteria 5691
888 Ga0500578_0109402 3300053086 Bacteria 1743
889 Ga0500651_0310442 3300053093 Bacteria 903
890 Ga0500556_0000669 3300053104 Bacteria 21370
891 Ga0500560_002535 3300053107 Bacteria 3510
892 Ga0500562_019421 3300053108 Bacteria 1757
893 Ga0500569_003271 3300053109 Bacteria 3291
894 Ga0500569_004191 3300053109 Bacteria 3014
895 Ga0500572_003895 3300053111 Bacteria 3395
896 Ga0500608_149561 3300053122 Bacteria 1025
897 Ga0500618_000055 3300053125 Bacteria 99876
898 Ga0500618_000272 3300053125 Bacteria 39600
899 Ga0500618_015050 3300053125 Bacteria 1962
900 Ga0500658_0004252 3300053134 Bacteria 5369
901 Ga0500658_0026742 3300053134 Bacteria 2225
902 Ga0500559_0008093 3300053136 Bacteria 4626
903 Ga0500559_0368439 3300053136 Bacteria 671
904 Ga0500561_0000159 3300053137 Bacteria 12696
905 Ga0500568_0001135 3300053139 Bacteria 17879
906 Ga0500568_0050984 3300053139 Bacteria 1629
907 Ga0500573_0009836 3300053140 Bacteria 5326
908 Ga0500573_0361767 3300053140 Bacteria 701
909 Ga0500604_0043084 3300053151 Bacteria 1370
910 Ga0500616_0000224 3300053153 Bacteria 88293
911 Ga0500616_0004285 3300053153 Bacteria 10246
912 Ga0500616_0006020 3300053153 Bacteria 8066
913 Ga0500616_0012356 3300053153 Bacteria 5000
914 Ga0500616_0015808 3300053153 Bacteria 4309
915 Ga0500622_0000322 3300053156 Bacteria 48225
916 Ga0500622_0000380 3300053156 Bacteria 42838
917 Ga0500624_032942 3300053157 Bacteria 899
918 Ga0500627_0190460 3300053158 Bacteria 921
919 Ga0500634_0001027 3300053161 Bacteria 10223
920 Ga0500634_0032813 3300053161 Bacteria 2831
921 Ga0500636_0004186 3300053177 Bacteria 8174
922 Ga0500645_046847 3300053730 Bacteria 1268
923 Ga0501084_0181657 3300054114 Bacteria 1776
924 Ga0587088_015076 3300059508 Bacteria 1213
925 Ga0587090_083836 3300059510 Bacteria 643
926 Ga0587091_164049 3300059511 Bacteria 573
927 Ga0587072_004663 3300059643 Bacteria 2007
928 Ga0587072_174754 3300059643 Bacteria 533
929 Ga0587111_0123281 3300060346 Bacteria 670
930 Ga0501082_0051487 3300060353 Bacteria 3549
931 Ga0501082_0052928 3300060353 Bacteria 3500
932 Ga0501082_0139561 3300060353 Bacteria 2104
933 Ga0501082_0327733 3300060353 Bacteria 1334
934 Ga0501082_0510399 3300060353 Bacteria 1051
935 Ga0501082_0548649 3300060353 Bacteria 1011
936 Ga0466962_0204618 3300061719 Bacteria 965
937 Ga0530510_0436336 3300061734 Bacteria 989

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049584 Ga0501068_0386373 Ga0501068_0386373_260_736 143
2 3300025294 Ga0209025_1000016 Ga0209025_1000016205 145
3 3300025304 Ga0209257_1070518 Ga0209257_10705182 145
4 3300050490 nmdc:mga03n38_278161_c1 nmdc:mga03n38_278161_c1_333_806 145
5 3300050496 nmdc:mga07m45_705225_c1 nmdc:mga07m45_705225_c1_43_516 145
6 3300049569 Ga0501032_0099013 Ga0501032_0099013_374_820 146
7 3300042531 Ga0450918_003382 Ga0450918_003382_2279_2722 147
8 3300048923 Ga0496120_0129367 Ga0496120_0129367_22_465 147
9 3300048925 Ga0496122_0121174 Ga0496122_0121174_1223_1666 147
10 3300049589 Ga0501073_1125718 Ga0501073_1125718_11_454 147
11 iso_pu_bacteria 639633055 639647380 147
12 3300006844 Ga0075428_100001633 Ga0075428_10000163315 148
13 3300006846 Ga0075430_100273309 Ga0075430_1002733092 148
14 3300006880 Ga0075429_100326005 Ga0075429_1003260052 148
15 3300009147 Ga0114129_10090961 Ga0114129_100909612 148
16 3300028381 Ga0268264_11777694 Ga0268264_117776942 148
17 3300050508 nmdc:mga09592_166517_c1 nmdc:mga09592_166517_c1_1002_1478 148
18 3300050509 nmdc:mga0qj67_310528_c1 nmdc:mga0qj67_310528_c1_253_729 148
19 3300050510 nmdc:mga06r32_9052_c1 nmdc:mga06r32_9052_c1_3576_4052 148
20 3300050511 nmdc:mga08y16_1240461_c1 nmdc:mga08y16_1240461_c1_218_694 148
21 3300046522 Ga0495643_0265851 Ga0495643_0265851_14_466 150
22 iso_pu_bacteria 2508501050 2508732623 152
23 iso_pu_bacteria 2508501114 2509078241 152
24 iso_pu_bacteria 2643221623 2644132832 152
25 iso_pu_bacteria 2775506901 2776259490 152
26 iso_pu_bacteria 2829745981 2829748389 152
27 iso_pu_bacteria 2835312727 2835315014 152
28 iso_pu_bacteria 2861691609 2861693718 152
29 iso_pu_bacteria 2884298095 2884299743 152
30 iso_pu_bacteria 2889306138 2889306752 152
31 iso_pu_bacteria 2894232714 2894234458 152
32 iso_pu_bacteria 2902405164 2902409599 152
33 iso_pu_bacteria 2996336353 2996340271 152
34 iso_pu_bacteria 8002285264 8002287896 152
35 3300003775 Ga0055524_1003184 Ga0055524_10031844 154
36 3300025299 Ga0209256_1000262 Ga0209256_10002624 154
37 3300041451 Ga0451791_0930133 Ga0451791_0930133_80_556 154
38 3300041460 Ga0451802_1141809 Ga0451802_1141809_1044_1520 154
39 iso_pu_bacteria 2510917026 2511175453 154
40 iso_pu_bacteria 2513237159 2513999491 154
41 iso_pu_bacteria 2534681786 2535484398 154
42 iso_pu_bacteria 2558860983 2561466010 154
43 iso_pu_bacteria 2582581306 2585266249 154
44 iso_pu_bacteria 2582581865 2585387251 154
45 iso_pu_bacteria 2582581866 2585392648 154
46 iso_pu_bacteria 2599185156 2599333858 154
47 iso_pu_bacteria 2599185236 2599723148 154
48 iso_pu_bacteria 2600254933 2600375205 154
49 iso_pu_bacteria 2643221558 2643810063 154
50 iso_pu_bacteria 2643221637 2644206282 154
51 iso_pu_bacteria 2643221653 2644296899 154
52 iso_pu_bacteria 2643221718 2644649930 154
53 iso_pu_bacteria 2643221719 2644655153 154
54 iso_pu_bacteria 2751185800 2753358964 154
55 iso_pu_bacteria 2758568016 2758641200 154
56 iso_pu_bacteria 2791355253 2793282245 154
57 iso_pu_bacteria 2818991272 2819242613 154
58 iso_pu_bacteria 2821123053 2821124184 154
59 iso_pu_bacteria 2838736955 2838738793 154
60 iso_pu_bacteria 2841840854 2841842692 154
61 iso_pu_bacteria 2842140634 2842142472 154
62 iso_pu_bacteria 2842521101 2842525285 154
63 iso_pu_bacteria 2842922631 2842924703 154
64 iso_pu_bacteria 2854896431 2854898819 154
65 iso_pu_bacteria 2854911287 2854914480 154
66 iso_pu_bacteria 2854916844 2854918291 154
67 iso_pu_bacteria 2857531043 2857531763 154
68 iso_pu_bacteria 2915650412 2915651468 154
69 iso_pu_bacteria 2919171160 2919171507 154
70 iso_pu_bacteria 2989776772 2989778115 154
71 iso_pu_bacteria 8005246636 8005251389 154
72 iso_pu_bacteria 8018150411 8018152182 154
73 iso_pu_bacteria 8055431914 8055434120 154
74 iso_pu_bacteria 8056875544 8056876637 154
75 3300003775 Ga0055524_1062003 Ga0055524_10620031 155
76 3300005262 Ga0065165_1000046 Ga0065165_100004673 155
77 3300005328 Ga0070676_11262326 Ga0070676_112623261 155
78 3300005336 Ga0070680_100008030 Ga0070680_1000080306 155
79 3300005337 Ga0070682_100001337 Ga0070682_1000013376 155
80 3300005339 Ga0070660_100098549 Ga0070660_1000985491 155
81 3300005344 Ga0070661_100160982 Ga0070661_1001609822 155
82 3300005345 Ga0070692_10050870 Ga0070692_100508703 155
83 3300005366 Ga0070659_100041000 Ga0070659_1000410002 155
84 3300005406 Ga0070703_10177356 Ga0070703_101773562 155
85 3300005440 Ga0070705_100097985 Ga0070705_1000979852 155
86 3300005455 Ga0070663_100012053 Ga0070663_1000120535 155
87 3300005458 Ga0070681_10149310 Ga0070681_101493104 155
88 3300005530 Ga0070679_100011795 Ga0070679_1000117951 155
89 3300005539 Ga0068853_100006953 Ga0068853_1000069535 155
90 3300005545 Ga0070695_100014657 Ga0070695_1000146573 155
91 3300005546 Ga0070696_100167660 Ga0070696_1001676601 155
92 3300005547 Ga0070693_100054039 Ga0070693_1000540392 155
93 3300005564 Ga0070664_100122018 Ga0070664_1001220182 155
94 3300005577 Ga0068857_100011437 Ga0068857_1000114373 155
95 3300005840 Ga0068870_10389177 Ga0068870_103891772 155
96 3300005842 Ga0068858_100255602 Ga0068858_1002556023 155
97 3300006237 Ga0097621_100074068 Ga0097621_1000740683 155
98 3300009098 Ga0105245_10240025 Ga0105245_102400252 155
99 3300009101 Ga0105247_10132849 Ga0105247_101328493 155
100 3300009148 Ga0105243_10131512 Ga0105243_101315123 155
101 3300009545 Ga0105237_10010754 Ga0105237_1001075411 155
102 3300009551 Ga0105238_10026835 Ga0105238_100268354 155
103 3300009553 Ga0105249_11082382 Ga0105249_110823821 155
104 3300010375 Ga0105239_10958856 Ga0105239_109588562 155
105 3300011119 Ga0105246_10003304 Ga0105246_100033047 155
106 3300013100 Ga0157373_10236448 Ga0157373_102364482 155
107 3300013105 Ga0157369_10190536 Ga0157369_101905362 155
108 3300013297 Ga0157378_10116422 Ga0157378_101164224 155
109 3300013308 Ga0157375_10061504 Ga0157375_100615042 155
110 3300014326 Ga0157380_10148417 Ga0157380_101484172 155
111 3300014326 Ga0157380_10637280 Ga0157380_106372801 155
112 3300014968 Ga0157379_10159388 Ga0157379_101593883 155
113 3300014969 Ga0157376_10077018 Ga0157376_100770182 155
114 3300025208 Ga0209436_116920 Ga0209436_1169202 155
115 3300025284 Ga0209130_1000201 Ga0209130_100020159 155
116 3300025294 Ga0209025_1000738 Ga0209025_100073816 155
117 3300025294 Ga0209025_1008385 Ga0209025_10083855 155
118 3300025297 Ga0209758_1085504 Ga0209758_10855042 155
119 3300025299 Ga0209256_1070042 Ga0209256_10700422 155
120 3300025302 Ga0207426_1012269 Ga0207426_10122693 155
121 3300025904 Ga0207647_10007210 Ga0207647_100072108 155
122 3300025907 Ga0207645_10968393 Ga0207645_109683931 155
123 3300025912 Ga0207707_10123433 Ga0207707_101234333 155
124 3300025914 Ga0207671_10189774 Ga0207671_101897742 155
125 3300025917 Ga0207660_10037859 Ga0207660_100378592 155
126 3300025921 Ga0207652_10151956 Ga0207652_101519562 155
127 3300025927 Ga0207687_10612063 Ga0207687_106120632 155
128 3300025932 Ga0207690_10043762 Ga0207690_100437624 155
129 3300025935 Ga0207709_10901001 Ga0207709_109010011 155
130 3300025945 Ga0207679_10041268 Ga0207679_100412683 155
131 3300025949 Ga0207667_10977064 Ga0207667_109770641 155
132 3300026035 Ga0207703_10293535 Ga0207703_102935352 155
133 3300026067 Ga0207678_10000073 Ga0207678_1000007369 155
134 3300026116 Ga0207674_10271250 Ga0207674_102712503 155
135 3300037312 Ga0395899_0440145 Ga0395899_0440145_164_637 155
136 3300037418 Ga0395900_0318112 Ga0395900_0318112_649_1122 155
137 3300046462 Ga0495651_0290393 Ga0495651_0290393_119_595 155
138 3300048904 Ga0496101_0123285 Ga0496101_0123285_838_1311 155
139 3300048905 Ga0496102_0512846 Ga0496102_0512846_207_680 155
140 3300048906 Ga0496103_0005124 Ga0496103_0005124_7209_7682 155
141 3300048906 Ga0496103_0283712 Ga0496103_0283712_407_880 155
142 3300048907 Ga0496104_0182085 Ga0496104_0182085_526_999 155
143 3300048908 Ga0496105_0314354 Ga0496105_0314354_352_825 155
144 3300048909 Ga0496106_0004892 Ga0496106_0004892_4920_5393 155
145 3300048910 Ga0496107_0001454 Ga0496107_0001454_274_747 155
146 3300048918 Ga0496115_0003092 Ga0496115_0003092_10608_11081 155
147 3300048924 Ga0496121_0597394 Ga0496121_0597394_33_506 155
148 3300049568 Ga0501031_0595029 Ga0501031_0595029_204_680 155
149 3300049569 Ga0501032_0079221 Ga0501032_0079221_811_1284 155
150 3300049569 Ga0501032_0180087 Ga0501032_0180087_794_1267 155
151 3300049569 Ga0501032_0268935 Ga0501032_0268935_357_830 155
152 3300049571 Ga0501034_0000391 Ga0501034_0000391_54259_54732 155
153 3300049571 Ga0501034_0005961 Ga0501034_0005961_2552_3025 155
154 3300049571 Ga0501034_0493967 Ga0501034_0493967_484_957 155
155 3300049573 Ga0501037_0098144 Ga0501037_0098144_718_1191 155
156 3300049573 Ga0501037_0114748 Ga0501037_0114748_1268_1741 155
157 3300049574 Ga0501038_0112787 Ga0501038_0112787_1684_2157 155
158 3300049575 Ga0501039_0000070 Ga0501039_0000070_50347_50820 155
159 3300049579 Ga0501043_0044532 Ga0501043_0044532_2351_2824 155
160 3300049580 Ga0501046_0007046 Ga0501046_0007046_4363_4836 155
161 3300049580 Ga0501046_0018480 Ga0501046_0018480_2101_2574 155
162 3300049581 Ga0501047_0000102 Ga0501047_0000102_19455_19928 155
163 3300049581 Ga0501047_0065018 Ga0501047_0065018_774_1250 155
164 3300049581 Ga0501047_0095919 Ga0501047_0095919_2209_2682 155
165 3300049582 Ga0501048_0001040 Ga0501048_0001040_15477_15950 155
166 3300049583 Ga0501067_0005270 Ga0501067_0005270_1575_2048 155
167 3300049583 Ga0501067_0027879 Ga0501067_0027879_764_1237 155
168 3300049586 Ga0501070_0021105 Ga0501070_0021105_1982_2455 155
169 3300049586 Ga0501070_0188920 Ga0501070_0188920_519_992 155
170 3300049589 Ga0501073_0066493 Ga0501073_0066493_70_543 155
171 3300049589 Ga0501073_0122764 Ga0501073_0122764_1146_1616 155
172 3300049589 Ga0501073_0127523 Ga0501073_0127523_1242_1715 155
173 3300049589 Ga0501073_0398724 Ga0501073_0398724_413_883 155
174 3300049593 Ga0501077_0497639 Ga0501077_0497639_135_605 155
175 3300049742 Ga0501080_0000028 Ga0501080_0000028_39259_39732 155
176 3300049742 Ga0501080_1077678 Ga0501080_1077678_79_552 155
177 3300049822 Ga0501035_0000020 Ga0501035_0000020_56833_57306 155
178 3300049823 Ga0501044_0000007 Ga0501044_0000007_124261_124734 155
179 3300049823 Ga0501044_0087555 Ga0501044_0087555_1518_1991 155
180 3300049824 Ga0501045_0084042 Ga0501045_0084042_1391_1864 155
181 3300053153 Ga0500616_0006020 Ga0500616_0006020_3348_3821 155
182 3300060353 Ga0501082_0051487 Ga0501082_0051487_1271_1744 155
183 3300060353 Ga0501082_0052928 Ga0501082_0052928_2689_3162 155
184 3300060353 Ga0501082_0510399 Ga0501082_0510399_68_538 155
185 iso_pu_bacteria 2508501122 2509108455 155
186 iso_pu_bacteria 2509276019 2509374518 155
187 iso_pu_bacteria 2510065019 2510132245 155
188 iso_pu_bacteria 2510065057 2510306585 155
189 iso_pu_bacteria 2510461069 2510840277 155
190 iso_pu_bacteria 2510461076 2510898583 155
191 iso_pu_bacteria 2510917022 2511133545 155
192 iso_pu_bacteria 2510917028 2511182795 155
193 iso_pu_bacteria 2510917030 2511197198 155
194 iso_pu_bacteria 2511231052 2511500947 155
195 iso_pu_bacteria 2512047086 2512532366 155
196 iso_pu_bacteria 2512875026 2512972305 155
197 iso_pu_bacteria 2513237084 2513569082 155
198 iso_pu_bacteria 2513237085 2513580775 155
199 iso_pu_bacteria 2513237086 2513583515 155
200 iso_pu_bacteria 2513237088 2513596191 155
201 iso_pu_bacteria 2513237089 2513603384 155
202 iso_pu_bacteria 2513237091 2513617637 155
203 iso_pu_bacteria 2513237093 2513630850 155
204 iso_pu_bacteria 2513237103 2513709261 155
205 iso_pu_bacteria 2513237138 2513865678 155
206 iso_pu_bacteria 2513237140 2513882727 155
207 iso_pu_bacteria 2513237143 2513905272 155
208 iso_pu_bacteria 2513237144 2513907581 155
209 iso_pu_bacteria 2513237146 2513925653 155
210 iso_pu_bacteria 2513237156 2513983988 155
211 iso_pu_bacteria 2513237160 2514004839 155
212 iso_pu_bacteria 2513237162 2514020806 155
213 iso_pu_bacteria 2515075009 2515111229 155
214 iso_pu_bacteria 2515154107 2515608069 155
215 iso_pu_bacteria 2515154113 2515635984 155
216 iso_pu_bacteria 2515154114 2515642636 155
217 iso_pu_bacteria 2515154116 2515659246 155
218 iso_pu_bacteria 2515154134 2515740407 155
219 iso_pu_bacteria 2516143018 2516208823 155
220 iso_pu_bacteria 2516653046 2516892228 155
221 iso_pu_bacteria 2516653077 2517039871 155
222 iso_pu_bacteria 2516653085 2517075412 155
223 iso_pu_bacteria 2517093000 2517094001 155
224 iso_pu_bacteria 2517287029 2517405815 155
225 iso_pu_bacteria 2517487022 2517569030 155
226 iso_pu_bacteria 2519899620 2520375306 155
227 iso_pu_bacteria 2524023207 2524451202 155
228 iso_pu_bacteria 2524023209 2524460709 155
229 iso_pu_bacteria 2529292951 2530643948 155
230 iso_pu_bacteria 2534681796 2535515661 155
231 iso_pu_bacteria 2537561587 2537877099 155
232 iso_pu_bacteria 2551306084 2551676407 155
233 iso_pu_bacteria 2551306085 2551687236 155
234 iso_pu_bacteria 2551306086 2551693447 155
235 iso_pu_bacteria 2551306087 2551702505 155
236 iso_pu_bacteria 2551306089 2551714821 155
237 iso_pu_bacteria 2551306090 2551720575 155
238 iso_pu_bacteria 2551306091 2551730298 155
239 iso_pu_bacteria 2551306092 2551732193 155
240 iso_pu_bacteria 2551306093 2551740899 155
241 iso_pu_bacteria 2554235003 2554247048 155
242 iso_pu_bacteria 2558860100 2558863545 155
243 iso_pu_bacteria 2558860242 2559294273 155
244 iso_pu_bacteria 2582581294 2585203021 155
245 iso_pu_bacteria 2582581298 2585220935 155
246 iso_pu_bacteria 2582581299 2585231552 155
247 iso_pu_bacteria 2582581304 2585256670 155
248 iso_pu_bacteria 2582581307 2585273315 155
249 iso_pu_bacteria 2582581308 2585278849 155
250 iso_pu_bacteria 2582581315 2585325537 155
251 iso_pu_bacteria 2582581316 2585329691 155
252 iso_pu_bacteria 2585427526 2585527909 155
253 iso_pu_bacteria 2585427527 2585530647 155
254 iso_pu_bacteria 2585427528 2585541487 155
255 iso_pu_bacteria 2585427529 2585549965 155
256 iso_pu_bacteria 2585427530 2585554827 155
257 iso_pu_bacteria 2585427531 2585559385 155
258 iso_pu_bacteria 2585427590 2585822743 155
259 iso_pu_bacteria 2585427593 2585839380 155
260 iso_pu_bacteria 2585427594 2585847274 155
261 iso_pu_bacteria 2585427608 2585902055 155
262 iso_pu_bacteria 2585427609 2585905239 155
263 iso_pu_bacteria 2585428125 2587979646 155
264 iso_pu_bacteria 2599185170 2599418648 155
265 iso_pu_bacteria 2599185210 2599602662 155
266 iso_pu_bacteria 2599185352 2600191869 155
267 iso_pu_bacteria 2615840626 2616305877 155
268 iso_pu_bacteria 2615840698 2616553881 155
269 iso_pu_bacteria 2617270742 2617383805 155
270 iso_pu_bacteria 2643221557 2643807266 155
271 iso_pu_bacteria 2643221568 2643855933 155
272 iso_pu_bacteria 2643221599 2644007866 155
273 iso_pu_bacteria 2643221610 2644069467 155
274 iso_pu_bacteria 2643221618 2644109057 155
275 iso_pu_bacteria 2643221626 2644151579 155
276 iso_pu_bacteria 2643221634 2644196457 155
277 iso_pu_bacteria 2643221655 2644311713 155
278 iso_pu_bacteria 2643221659 2644329970 155
279 iso_pu_bacteria 2643221668 2644380648 155
280 iso_pu_bacteria 2643221675 2644420621 155
281 iso_pu_bacteria 2643221680 2644454146 155
282 iso_pu_bacteria 2643221693 2644518809 155
283 iso_pu_bacteria 2643221698 2644546644 155
284 iso_pu_bacteria 2643221712 2644617512 155
285 iso_pu_bacteria 2643221723 2644675715 155
286 iso_pu_bacteria 2643221726 2644689483 155
287 iso_pu_bacteria 2657244999 2657683323 155
288 iso_pu_bacteria 2667528174 2671115369 155
289 iso_pu_bacteria 2690316117 2692316883 155
290 iso_pu_bacteria 2718217882 2719180229 155
291 iso_pu_bacteria 2718217997 2719664558 155
292 iso_pu_bacteria 2718218009 2719730978 155
293 iso_pu_bacteria 2718218199 2720490978 155
294 iso_pu_bacteria 2718218232 2720612340 155
295 iso_pu_bacteria 2718218233 2720619178 155
296 iso_pu_bacteria 2718218235 2720630580 155
297 iso_pu_bacteria 2718218269 2720774273 155
298 iso_pu_bacteria 2718218363 2721146323 155
299 iso_pu_bacteria 2718218365 2721157843 155
300 iso_pu_bacteria 2718218366 2721163202 155
301 iso_pu_bacteria 2721755514 2722839372 155
302 iso_pu_bacteria 2721755556 2723026000 155
303 iso_pu_bacteria 2721755684 2723559544 155
304 iso_pu_bacteria 2721755685 2723566161 155
305 iso_pu_bacteria 2721755810 2724043734 155
306 iso_pu_bacteria 2721755819 2724088880 155
307 iso_pu_bacteria 2721755822 2724103426 155
308 iso_pu_bacteria 2721755823 2724109271 155
309 iso_pu_bacteria 2724679232 2725948429 155
310 iso_pu_bacteria 2728369352 2730106936 155
311 iso_pu_bacteria 2728369365 2730163466 155
312 iso_pu_bacteria 2728369397 2730297475 155
313 iso_pu_bacteria 2738541293 2738802106 155
314 iso_pu_bacteria 2738541333 2739035841 155
315 iso_pu_bacteria 2751185821 2753460751 155
316 iso_pu_bacteria 2765235942 2766067658 155
317 iso_pu_bacteria 2775507266 2778177405 155
318 iso_pu_bacteria 2791355082 2792584106 155
319 iso_pu_bacteria 2791355091 2792622742 155
320 iso_pu_bacteria 2791355092 2792628338 155
321 iso_pu_bacteria 2791355094 2792638400 155
322 iso_pu_bacteria 2791355256 2793296147 155
323 iso_pu_bacteria 2791355259 2793317469 155
324 iso_pu_bacteria 2791355260 2793321158 155
325 iso_pu_bacteria 2791355261 2793327187 155
326 iso_pu_bacteria 2791355262 2793333562 155
327 iso_pu_bacteria 2791355263 2793339859 155
328 iso_pu_bacteria 2791355264 2793347870 155
329 iso_pu_bacteria 2791355265 2793353514 155
330 iso_pu_bacteria 2791355266 2793358857 155
331 iso_pu_bacteria 2802428858 2802717673 155
332 iso_pu_bacteria 2802428859 2802723399 155
333 iso_pu_bacteria 2802428860 2802731150 155
334 iso_pu_bacteria 2802428861 2802736157 155
335 iso_pu_bacteria 2802428862 2802743633 155
336 iso_pu_bacteria 2802428863 2802750655 155
337 iso_pu_bacteria 2802429268 2804751287 155
338 iso_pu_bacteria 2802429606 2805937485 155
339 iso_pu_bacteria 2802429633 2806046980 155
340 iso_pu_bacteria 2802429634 2806052563 155
341 iso_pu_bacteria 2802429635 2806058666 155
342 iso_pu_bacteria 2802429636 2806067566 155
343 iso_pu_bacteria 2802429637 2806073925 155
344 iso_pu_bacteria 2808606387 2808985952 155
345 iso_pu_bacteria 2818991439 2819556072 155
346 iso_pu_bacteria 2818991448 2819612268 155
347 iso_pu_bacteria 2818991453 2819639306 155
348 iso_pu_bacteria 2838016132 2838017229 155
349 iso_pu_bacteria 2838022645 2838023221 155
350 iso_pu_bacteria 2838029111 2838031360 155
351 iso_pu_bacteria 2838035591 2838037662 155
352 iso_pu_bacteria 2838042994 2838048046 155
353 iso_pu_bacteria 2838048938 2838049289 155
354 iso_pu_bacteria 2838061910 2838063265 155
355 iso_pu_bacteria 2838068647 2838074091 155
356 iso_pu_bacteria 2838074704 2838076383 155
357 iso_pu_bacteria 2838661181 2838662669 155
358 iso_pu_bacteria 2838668709 2838670792 155
359 iso_pu_bacteria 2838675328 2838676798 155
360 iso_pu_bacteria 2838680041 2838681283 155
361 iso_pu_bacteria 2838686498 2838688672 155
362 iso_pu_bacteria 2838694306 2838694682 155
363 iso_pu_bacteria 2838701080 2838703163 155
364 iso_pu_bacteria 2838707686 2838708060 155
365 iso_pu_bacteria 2838714209 2838715682 155
366 iso_pu_bacteria 2838719591 2838720517 155
367 iso_pu_bacteria 2838724970 2838726438 155
368 iso_pu_bacteria 2838729681 2838730967 155
369 iso_pu_bacteria 2838742623 2838744139 155
370 iso_pu_bacteria 2841846520 2841847451 155
371 iso_pu_bacteria 2841851746 2841856820 155
372 iso_pu_bacteria 2841859092 2841860012 155
373 iso_pu_bacteria 2841864319 2841865537 155
374 iso_pu_bacteria 2842077413 2842080709 155
375 iso_pu_bacteria 2842110456 2842117624 155
376 iso_pu_bacteria 2842118031 2842121328 155
377 iso_pu_bacteria 2842124991 2842126519 155
378 iso_pu_bacteria 2842130223 2842131691 155
379 iso_pu_bacteria 2842146304 2842147613 155
380 iso_pu_bacteria 2842152218 2842153140 155
381 iso_pu_bacteria 2842156927 2842159990 155
382 iso_pu_bacteria 2842163707 2842168232 155
383 iso_pu_bacteria 2842170452 2842171926 155
384 iso_pu_bacteria 2842175837 2842176759 155
385 iso_pu_bacteria 2842180545 2842183393 155
386 iso_pu_bacteria 2842187318 2842188791 155
387 iso_pu_bacteria 2842192696 2842197895 155
388 iso_pu_bacteria 2842198810 2842199649 155
389 iso_pu_bacteria 2842205361 2842207755 155
390 iso_pu_bacteria 2842211629 2842213102 155
391 iso_pu_bacteria 2842217011 2842221148 155
392 iso_pu_bacteria 2842224351 2842225279 155
393 iso_pu_bacteria 2842229732 2842235006 155
394 iso_pu_bacteria 2842237096 2842237471 155
395 iso_pu_bacteria 2842243621 2842245603 155
396 iso_pu_bacteria 2842250916 2842252679 155
397 iso_pu_bacteria 2842257432 2842259747 155
398 iso_pu_bacteria 2842264693 2842270149 155
399 iso_pu_bacteria 2842271015 2842274586 155
400 iso_pu_bacteria 2842278818 2842281450 155
401 iso_pu_bacteria 2842285085 2842287171 155
402 iso_pu_bacteria 2842291075 2842294365 155
403 iso_pu_bacteria 2842298080 2842302513 155
404 iso_pu_bacteria 2842304105 2842306830 155
405 iso_pu_bacteria 2842311132 2842314510 155
406 iso_pu_bacteria 2842317721 2842318707 155
407 iso_pu_bacteria 2842341865 2842343658 155
408 iso_pu_bacteria 2842357229 2842360754 155
409 iso_pu_bacteria 2842363717 2842365186 155
410 iso_pu_bacteria 2842370503 2842371746 155
411 iso_pu_bacteria 2842377471 2842380763 155
412 iso_pu_bacteria 2842384541 2842387834 155
413 iso_pu_bacteria 2842395702 2842398328 155
414 iso_pu_bacteria 2842402390 2842404439 155
415 iso_pu_bacteria 2842409023 2842410876 155
416 iso_pu_bacteria 2842415677 2842417668 155
417 iso_pu_bacteria 2842422224 2842427297 155
418 iso_pu_bacteria 2842428310 2842433971 155
419 iso_pu_bacteria 2842434925 2842440347 155
420 iso_pu_bacteria 2842441272 2842446886 155
421 iso_pu_bacteria 2842447887 2842453426 155
422 iso_pu_bacteria 2842462802 2842468390 155
423 iso_pu_bacteria 2842469257 2842474908 155
424 iso_pu_bacteria 2842475841 2842478045 155
425 iso_pu_bacteria 2842482326 2842482794 155
426 iso_pu_bacteria 2842489311 2842493703 155
427 iso_pu_bacteria 2842495871 2842497342 155
428 iso_pu_bacteria 2842502639 2842504854 155
429 iso_pu_bacteria 2842509118 2842509667 155
430 iso_pu_bacteria 2842515876 2842516797 155
431 iso_pu_bacteria 2844163670 2844168581 155
432 iso_pu_bacteria 2844454524 2844455189 155
433 iso_pu_bacteria 2847417321 2847418050 155
434 iso_pu_bacteria 2848992105 2848993025 155
435 iso_pu_bacteria 2850079185 2850080416 155
436 iso_pu_bacteria 2852387548 2852389010 155
437 iso_pu_bacteria 2855825444 2855831298 155
438 iso_pu_bacteria 2855839649 2855840423 155
439 iso_pu_bacteria 2855872281 2855879163 155
440 iso_pu_bacteria 2857516855 2857520347 155
441 iso_pu_bacteria 2858800743 2858800952 155
442 iso_pu_bacteria 2891373044 2891374750 155
443 iso_pu_bacteria 2896384573 2896386583 155
444 iso_pu_bacteria 2899792073 2899792079 155
445 iso_pu_bacteria 2899845264 2899847197 155
446 iso_pu_bacteria 2913295892 2913297499 155
447 iso_pu_bacteria 2915980308 2915986153 155
448 iso_pu_bacteria 2915986958 2915990918 155
449 iso_pu_bacteria 2915993759 2915996286 155
450 iso_pu_bacteria 2916000859 2916005880 155
451 iso_pu_bacteria 2916007675 2916010902 155
452 iso_pu_bacteria 2916014648 2916016539 155
453 iso_pu_bacteria 2916021584 2916024738 155
454 iso_pu_bacteria 2916028427 2916034776 155
455 iso_pu_bacteria 2916035215 2916038140 155
456 iso_pu_bacteria 2916041962 2916047931 155
457 iso_pu_bacteria 2916048683 2916054348 155
458 iso_pu_bacteria 2916055098 2916055383 155
459 iso_pu_bacteria 2916061851 2916062804 155
460 iso_pu_bacteria 2916068649 2916075807 155
461 iso_pu_bacteria 2916076590 2916080520 155
462 iso_pu_bacteria 2919100787 2919103773 155
463 iso_pu_bacteria 2919114240 2919115886 155
464 iso_pu_bacteria 2919166419 2919167301 155
465 iso_pu_bacteria 2919408235 2919409246 155
466 iso_pu_bacteria 2920760137 2920762931 155
467 iso_pu_bacteria 2920822456 2920823786 155
468 iso_pu_bacteria 2921201388 2921204915 155
469 iso_pu_bacteria 2921208531 2921213506 155
470 iso_pu_bacteria 2921237296 2921241597 155
471 iso_pu_bacteria 2921244191 2921247540 155
472 iso_pu_bacteria 2921250672 2921250935 155
473 iso_pu_bacteria 2921257292 2921261585 155
474 iso_pu_bacteria 2921263974 2921270388 155
475 iso_pu_bacteria 2921282425 2921284004 155
476 iso_pu_bacteria 2921289301 2921290154 155
477 iso_pu_bacteria 2921296804 2921301510 155
478 iso_pu_bacteria 2923556063 2923557629 155
479 iso_pu_bacteria 2924144063 2924145624 155
480 iso_pu_bacteria 2924150972 2924157247 155
481 iso_pu_bacteria 2924158325 2924160548 155
482 iso_pu_bacteria 2924165586 2924168175 155
483 iso_pu_bacteria 2924172951 2924179527 155
484 iso_pu_bacteria 2924179722 2924181447 155
485 iso_pu_bacteria 2924186466 2924189488 155
486 iso_pu_bacteria 2924193448 2924195911 155
487 iso_pu_bacteria 2924200457 2924204083 155
488 iso_pu_bacteria 2924207177 2924209885 155
489 iso_pu_bacteria 2924214083 2924215905 155
490 iso_pu_bacteria 2924221636 2924226253 155
491 iso_pu_bacteria 2924228884 2924234911 155
492 iso_pu_bacteria 2926754445 2926756825 155
493 iso_pu_bacteria 2926760298 2926761064 155
494 iso_pu_bacteria 2929138655 2929139460 155
495 iso_pu_bacteria 2933006813 2933007783 155
496 iso_pu_bacteria 2933011516 2933012561 155
497 iso_pu_bacteria 2933016740 2933018854 155
498 iso_pu_bacteria 2933570622 2933573056 155
499 iso_pu_bacteria 2933586486 2933593706 155
500 iso_pu_bacteria 2933599457 2933604546 155
501 iso_pu_bacteria 2935894831 2935895204 155
502 iso_pu_bacteria 2935901341 2935904194 155
503 iso_pu_bacteria 2936367885 2936368182 155
504 iso_pu_bacteria 2936375103 2936381425 155
505 iso_pu_bacteria 2936381700 2936387447 155
506 iso_pu_bacteria 2937002841 2937009538 155
507 iso_pu_bacteria 2937009748 2937010862 155
508 iso_pu_bacteria 2937016420 2937022016 155
509 iso_pu_bacteria 2937023124 2937027949 155
510 iso_pu_bacteria 2937029754 2937029886 155
511 iso_pu_bacteria 2937042894 2937045877 155
512 iso_pu_bacteria 2937049772 2937052512 155
513 iso_pu_bacteria 2937056579 2937063350 155
514 iso_pu_bacteria 2937063883 2937070649 155
515 iso_pu_bacteria 2937071275 2937073356 155
516 iso_pu_bacteria 2937078374 2937082993 155
517 iso_pu_bacteria 2937084907 2937087049 155
518 iso_pu_bacteria 2937091812 2937097492 155
519 iso_pu_bacteria 2937098957 2937103660 155
520 iso_pu_bacteria 2937106411 2937112537 155
521 iso_pu_bacteria 2937113482 2937118198 155
522 iso_pu_bacteria 2937119839 2937121161 155
523 iso_pu_bacteria 2937126314 2937130110 155
524 iso_pu_bacteria 2941499720 2941500279 155
525 iso_pu_bacteria 2957375807 2957380045 155
526 iso_pu_bacteria 2957382221 2957385093 155
527 iso_pu_bacteria 2957388812 2957389156 155
528 iso_pu_bacteria 2957395598 2957397438 155
529 iso_pu_bacteria 2957402308 2957405472 155
530 iso_pu_bacteria 2957408893 2957415255 155
531 iso_pu_bacteria 2957415311 2957418062 155
532 iso_pu_bacteria 2957422303 2957425131 155
533 iso_pu_bacteria 2957430029 2957431115 155
534 iso_pu_bacteria 2957437181 2957441983 155
535 iso_pu_bacteria 2957443900 2957446676 155
536 iso_pu_bacteria 2957450854 2957453464 155
537 iso_pu_bacteria 2957457609 2957457626 155
538 iso_pu_bacteria 2957464669 2957467772 155
539 iso_pu_bacteria 2957471148 2957472759 155
540 iso_pu_bacteria 2957478035 2957480653 155
541 iso_pu_bacteria 2957484790 2957485814 155
542 iso_pu_bacteria 2957491536 2957495971 155
543 iso_pu_bacteria 2957498199 2957501011 155
544 iso_pu_bacteria 2957505466 2957507677 155
545 iso_pu_bacteria 2960584000 2960590065 155
546 iso_pu_bacteria 2960591022 2960595553 155
547 iso_pu_bacteria 2960597568 2960600599 155
548 iso_pu_bacteria 2960603979 2960609499 155
549 iso_pu_bacteria 2960610863 2960616734 155
550 iso_pu_bacteria 2960617483 2960617681 155
551 iso_pu_bacteria 2960624210 2960629791 155
552 iso_pu_bacteria 2960631154 2960633246 155
553 iso_pu_bacteria 2960637947 2960640183 155
554 iso_pu_bacteria 2960645483 2960648752 155
555 iso_pu_bacteria 2960652885 2960659509 155
556 iso_pu_bacteria 2960660292 2960666382 155
557 iso_pu_bacteria 2960667422 2960673901 155
558 iso_pu_bacteria 2960674078 2960676407 155
559 iso_pu_bacteria 2960680706 2960684142 155
560 iso_pu_bacteria 2960687367 2960692056 155
561 iso_pu_bacteria 2960693952 2960696353 155
562 iso_pu_bacteria 2964607997 2964610472 155
563 iso_pu_bacteria 2964615318 2964620725 155
564 iso_pu_bacteria 2964621998 2964627783 155
565 iso_pu_bacteria 2964628898 2964633141 155
566 iso_pu_bacteria 2964636051 2964637675 155
567 iso_pu_bacteria 2964643177 2964646137 155
568 iso_pu_bacteria 2964649959 2964653079 155
569 iso_pu_bacteria 2964656573 2964661909 155
570 iso_pu_bacteria 2964663802 2964665997 155
571 iso_pu_bacteria 2964670856 2964671710 155
572 iso_pu_bacteria 2964678106 2964680404 155
573 iso_pu_bacteria 2964685014 2964688084 155
574 iso_pu_bacteria 2964691889 2964695817 155
575 iso_pu_bacteria 2964698721 2964705280 155
576 iso_pu_bacteria 2964705432 2964712265 155
577 iso_pu_bacteria 2964712639 2964718511 155
578 iso_pu_bacteria 2964719344 2964725747 155
579 iso_pu_bacteria 2967664464 2967667346 155
580 iso_pu_bacteria 2967671571 2967672168 155
581 iso_pu_bacteria 2967678726 2967678900 155
582 iso_pu_bacteria 2967686174 2967686395 155
583 iso_pu_bacteria 2967693043 2967693221 155
584 iso_pu_bacteria 2967699805 2967700837 155
585 iso_pu_bacteria 2967706974 2967712924 155
586 iso_pu_bacteria 2967714385 2967716554 155
587 iso_pu_bacteria 2967721400 2967722876 155
588 iso_pu_bacteria 2967728569 2967734755 155
589 iso_pu_bacteria 2967735183 2967740922 155
590 iso_pu_bacteria 2967742019 2967744071 155
591 iso_pu_bacteria 2967748971 2967752129 155
592 iso_pu_bacteria 2967755722 2967757710 155
593 iso_pu_bacteria 2967762386 2967763795 155
594 iso_pu_bacteria 2967769361 2967770768 155
595 iso_pu_bacteria 2967775926 2967782152 155
596 iso_pu_bacteria 2970019648 2970026046 155
597 iso_pu_bacteria 2970026789 2970031809 155
598 iso_pu_bacteria 2970033650 2970037778 155
599 iso_pu_bacteria 2970040964 2970043309 155
600 iso_pu_bacteria 2970047711 2970049943 155
601 iso_pu_bacteria 2970054988 2970059632 155
602 iso_pu_bacteria 2970061556 2970065318 155
603 iso_pu_bacteria 2970068827 2970075659 155
604 iso_pu_bacteria 2970076120 2970076992 155
605 iso_pu_bacteria 2970082768 2970085672 155
606 iso_pu_bacteria 2970088815 2970093284 155
607 iso_pu_bacteria 2970095765 2970097653 155
608 iso_pu_bacteria 2970102677 2970108540 155
609 iso_pu_bacteria 2970109326 2970109843 155
610 iso_pu_bacteria 2970116247 2970117992 155
611 iso_pu_bacteria 2970122695 2970128199 155
612 iso_pu_bacteria 2970129317 2970129494 155
613 iso_pu_bacteria 2970136068 2970143174 155
614 iso_pu_bacteria 2970143518 2970148666 155
615 iso_pu_bacteria 2970149975 2970153838 155
616 iso_pu_bacteria 2970156795 2970162830 155
617 iso_pu_bacteria 2970164137 2970167480 155
618 iso_pu_bacteria 2970170962 2970171769 155
619 iso_pu_bacteria 2970177841 2970184127 155
620 iso_pu_bacteria 2970184632 2970185119 155
621 iso_pu_bacteria 2970191845 2970198348 155
622 iso_pu_bacteria 2977516862 2977523644 155
623 iso_pu_bacteria 2977523885 2977524496 155
624 iso_pu_bacteria 2977530762 2977531879 155
625 iso_pu_bacteria 2977537788 2977537965 155
626 iso_pu_bacteria 2977544691 2977544912 155
627 iso_pu_bacteria 2977551784 2977551962 155
628 iso_pu_bacteria 2977558990 2977561696 155
629 iso_pu_bacteria 2977565890 2977568958 155
630 iso_pu_bacteria 2977572785 2977578985 155
631 iso_pu_bacteria 2977579622 2977581518 155
632 iso_pu_bacteria 2979089926 2979093657 155
633 iso_pu_bacteria 2979095461 2979098959 155
634 iso_pu_bacteria 2979100975 2979105634 155
635 iso_pu_bacteria 2984509177 2984512519 155
636 iso_pu_bacteria 2984518228 2984521120 155
637 iso_pu_bacteria 2984537506 2984540414 155
638 iso_pu_bacteria 2984601300 2984602611 155
639 iso_pu_bacteria 2989349275 2989354241 155
640 iso_pu_bacteria 2989771324 2989771993 155
641 iso_pu_bacteria 2996887358 2996891520 155
642 iso_pu_bacteria 2996893221 2996896576 155
643 iso_pu_bacteria 3003930520 3003932604 155
644 iso_pu_bacteria 3005409236 3005412388 155
645 iso_pu_bacteria 3005416602 3005417084 155
646 iso_pu_bacteria 3005445848 3005446703 155
647 iso_pu_bacteria 3005452660 3005453386 155
648 iso_pu_bacteria 643692032 643825027 155
649 iso_pu_bacteria 648276728 648740579 155
650 iso_pu_bacteria 650716007 650739470 155
651 iso_pu_bacteria 8003992118 8003992921 155
652 iso_pu_bacteria 8003999396 8004000163 155
653 iso_pu_bacteria 8005258706 8005261746 155
654 iso_pu_bacteria 8005282627 8005284840 155
655 iso_pu_bacteria 8005289223 8005292737 155
656 iso_pu_bacteria 8005301065 8005304538 155
657 iso_pu_bacteria 8005307578 8005309110 155
658 iso_pu_bacteria 8005314921 8005315145 155
659 iso_pu_bacteria 8005321885 8005326047 155
660 iso_pu_bacteria 8005376324 8005376669 155
661 iso_pu_bacteria 8005382845 8005386060 155
662 iso_pu_bacteria 8005395548 8005399412 155
663 iso_pu_bacteria 8005430974 8005432207 155
664 iso_pu_bacteria 8005460587 8005461873 155
665 iso_pu_bacteria 8005484373 8005485686 155
666 iso_pu_bacteria 8005497431 8005499273 155
667 iso_pu_bacteria 8005542996 8005544292 155
668 iso_pu_bacteria 8005556819 8005558980 155
669 iso_pu_bacteria 8005563573 8005570382 155
670 iso_pu_bacteria 8005570704 8005572626 155
671 iso_pu_bacteria 8005619151 8005620468 155
672 iso_pu_bacteria 8005626139 8005627566 155
673 iso_pu_bacteria 8005645114 8005648295 155
674 iso_pu_bacteria 8005668836 8005670689 155
675 iso_pu_bacteria 8005682033 8005684632 155
676 iso_pu_bacteria 8005688590 8005690961 155
677 iso_pu_bacteria 8005695170 8005698853 155
678 iso_pu_bacteria 8018163183 8018169103 155
679 iso_pu_bacteria 8023680758 8023687014 155
680 iso_pu_bacteria 8024479707 8024481048 155
681 iso_pu_bacteria 8046767195 8046767619 155
682 iso_pu_bacteria 8054460903 8054461837 155
683 iso_pu_bacteria 8054558443 8054562226 155
684 iso_pu_bacteria 8056382006 8056384813 155
685 iso_pu_bacteria 8057575449 8057582260 155
686 iso_pu_bacteria 8057874678 8057879533 155
687 3300005328 Ga0070676_10132963 Ga0070676_101329633 156
688 3300005328 Ga0070676_10376664 Ga0070676_103766642 156
689 3300005331 Ga0070670_100816691 Ga0070670_1008166911 156
690 3300005334 Ga0068869_100852479 Ga0068869_1008524791 156
691 3300005341 Ga0070691_10081399 Ga0070691_100813992 156
692 3300005343 Ga0070687_100232317 Ga0070687_1002323172 156
693 3300005347 Ga0070668_100034681 Ga0070668_1000346813 156
694 3300005347 Ga0070668_100472903 Ga0070668_1004729032 156
695 3300005347 Ga0070668_100917371 Ga0070668_1009173712 156
696 3300005354 Ga0070675_100896553 Ga0070675_1008965532 156
697 3300005364 Ga0070673_101265932 Ga0070673_1012659321 156
698 3300005365 Ga0070688_100001929 Ga0070688_1000019299 156
699 3300005365 Ga0070688_100787019 Ga0070688_1007870192 156
700 3300005438 Ga0070701_10033541 Ga0070701_100335412 156
701 3300005441 Ga0070700_100172404 Ga0070700_1001724042 156
702 3300005441 Ga0070700_100226449 Ga0070700_1002264492 156
703 3300005518 Ga0070699_101454200 Ga0070699_1014542002 156
704 3300005544 Ga0070686_100728751 Ga0070686_1007287512 156
705 3300005546 Ga0070696_100573476 Ga0070696_1005734762 156
706 3300005548 Ga0070665_100163366 Ga0070665_1001633663 156
707 3300005719 Ga0068861_100180275 Ga0068861_1001802752 156
708 3300005719 Ga0068861_100516386 Ga0068861_1005163862 156
709 3300005843 Ga0068860_101158658 Ga0068860_1011586582 156
710 3300006038 Ga0075365_10022074 Ga0075365_100220743 156
711 3300006038 Ga0075365_10080516 Ga0075365_100805163 156
712 3300006038 Ga0075365_10180469 Ga0075365_101804692 156
713 3300006042 Ga0075368_10000420 Ga0075368_100004202 156
714 3300006042 Ga0075368_10170086 Ga0075368_101700862 156
715 3300006048 Ga0075363_100058165 Ga0075363_1000581652 156
716 3300006175 Ga0070712_100511178 Ga0070712_1005111782 156
717 3300006178 Ga0075367_10001232 Ga0075367_100012325 156
718 3300006178 Ga0075367_10007139 Ga0075367_100071394 156
719 3300006178 Ga0075367_10037445 Ga0075367_100374454 156
720 3300006847 Ga0075431_100793232 Ga0075431_1007932322 156
721 3300009147 Ga0114129_11555401 Ga0114129_115554011 156
722 3300009176 Ga0105242_10240740 Ga0105242_102407403 156
723 3300009177 Ga0105248_11365872 Ga0105248_113658722 156
724 3300010375 Ga0105239_11128767 Ga0105239_111287672 156
725 3300013100 Ga0157373_10613016 Ga0157373_106130162 156
726 3300013306 Ga0163162_10083214 Ga0163162_100832142 156
727 3300013306 Ga0163162_10504516 Ga0163162_105045162 156
728 3300013306 Ga0163162_10999324 Ga0163162_109993241 156
729 3300013308 Ga0157375_12192067 Ga0157375_121920671 156
730 3300014325 Ga0163163_10133774 Ga0163163_101337743 156
731 3300014325 Ga0163163_11066444 Ga0163163_110664441 156
732 3300014326 Ga0157380_10158947 Ga0157380_101589473 156
733 3300025261 Ga0209233_1017599 Ga0209233_10175992 156
734 3300025907 Ga0207645_10120623 Ga0207645_101206232 156
735 3300025907 Ga0207645_10793316 Ga0207645_107933162 156
736 3300025918 Ga0207662_10057392 Ga0207662_100573923 156
737 3300025923 Ga0207681_10122745 Ga0207681_101227451 156
738 3300025923 Ga0207681_10458558 Ga0207681_104585582 156
739 3300025925 Ga0207650_10350317 Ga0207650_103503172 156
740 3300025931 Ga0207644_10941306 Ga0207644_109413061 156
741 3300025935 Ga0207709_11207872 Ga0207709_112078721 156
742 3300025938 Ga0207704_10243171 Ga0207704_102431712 156
743 3300025941 Ga0207711_10106686 Ga0207711_101066863 156
744 3300025961 Ga0207712_10187465 Ga0207712_101874652 156
745 3300025961 Ga0207712_11627188 Ga0207712_116271881 156
746 3300025972 Ga0207668_10088261 Ga0207668_100882613 156
747 3300026035 Ga0207703_10513789 Ga0207703_105137892 156
748 3300026067 Ga0207678_10213626 Ga0207678_102136262 156
749 3300026075 Ga0207708_10356361 Ga0207708_103563612 156
750 3300026075 Ga0207708_10461046 Ga0207708_104610462 156
751 3300026075 Ga0207708_10685864 Ga0207708_106858642 156
752 3300026088 Ga0207641_10616016 Ga0207641_106160161 156
753 3300026089 Ga0207648_10130898 Ga0207648_101308982 156
754 3300026095 Ga0207676_10305401 Ga0207676_103054012 156
755 3300026118 Ga0207675_100246178 Ga0207675_1002461783 156
756 3300027866 Ga0209813_10000849 Ga0209813_100008496 156
757 3300028381 Ga0268264_10416479 Ga0268264_104164792 156
758 3300028381 Ga0268264_11277254 Ga0268264_112772541 156
759 3300028556 Ga0265337_1007096 Ga0265337_10070962 156
760 3300028573 Ga0265334_10003327 Ga0265334_1000332710 156
761 3300028800 Ga0265338_10011614 Ga0265338_100116145 156
762 3300031249 Ga0265339_10158470 Ga0265339_101584702 156
763 3300031250 Ga0265331_10047848 Ga0265331_100478483 156
764 3300031595 Ga0265313_10033807 Ga0265313_100338072 156
765 3300031911 Ga0307412_10103925 Ga0307412_101039252 156
766 3300031995 Ga0307409_100207573 Ga0307409_1002075733 156
767 3300032002 Ga0307416_100635463 Ga0307416_1006354632 156
768 3300032002 Ga0307416_102236989 Ga0307416_1022369892 156
769 3300032126 Ga0307415_100118934 Ga0307415_1001189342 156
770 3300035118 Ga0373954_0279056 Ga0373954_0279056_244_717 156
771 3300035119 Ga0373956_0462474 Ga0373956_0462474_99_575 156
772 3300035398 Ga0316574_0339157 Ga0316574_0339157_194_670 156
773 3300035691 Ga0373931_0034077 Ga0373931_0034077_1664_2137 156
774 3300035695 Ga0373927_0134333 Ga0373927_0134333_78_551 156
775 3300035724 Ga0373933_0212982 Ga0373933_0212982_622_1098 156
776 3300035725 Ga0373947_0265490 Ga0373947_0265490_562_1035 156
777 3300036401 Ga0373937_0213670 Ga0373937_0213670_542_1018 156
778 3300036401 Ga0373937_1368098 Ga0373937_1368098_33_506 156
779 3300037068 Ga0373925_0788134 Ga0373925_0788134_129_605 156
780 3300041413 Ga0439465_0155352 Ga0439465_0155352_213_689 156
781 3300041491 Ga0451833_0415382 Ga0451833_0415382_334_810 156
782 3300044658 Ga0466972_0060492 Ga0466972_0060492_138_611 156
783 3300044684 Ga0466966_0075696 Ga0466966_0075696_961_1434 156
784 3300044901 Ga0466960_0011270 Ga0466960_0011270_939_1412 156
785 3300045051 Ga0451576_0128494 Ga0451576_0128494_995_1468 156
786 3300046455 Ga0495603_0039840 Ga0495603_0039840_391_867 156
787 3300046460 Ga0495638_0239196 Ga0495638_0239196_379_858 156
788 3300046460 Ga0495638_0624781 Ga0495638_0624781_12_491 156
789 3300046462 Ga0495651_0189460 Ga0495651_0189460_929_1405 156
790 3300046475 Ga0495639_0054241 Ga0495639_0054241_767_1243 156
791 3300046477 Ga0495664_0184763 Ga0495664_0184763_476_949 156
792 3300046517 Ga0495630_0488050 Ga0495630_0488050_263_736 156
793 3300046642 Ga0495634_0351221 Ga0495634_0351221_269_745 156
794 3300046681 Ga0495647_0386901 Ga0495647_0386901_98_571 156
795 3300047317 Ga0495604_0081902 Ga0495604_0081902_549_1025 156
796 3300047322 Ga0495680_0394857 Ga0495680_0394857_371_844 156
797 3300047444 Ga0495675_0347517 Ga0495675_0347517_57_533 156
798 3300048903 Ga0496100_0675881 Ga0496100_0675881_171_647 156
799 3300048904 Ga0496101_0564764 Ga0496101_0564764_199_675 156
800 3300048905 Ga0496102_0911931 Ga0496102_0911931_131_607 156
801 3300048907 Ga0496104_0000182 Ga0496104_0000182_21576_22052 156
802 3300048908 Ga0496105_0016358 Ga0496105_0016358_1585_2061 156
803 3300048911 Ga0496108_0001152 Ga0496108_0001152_17232_17708 156
804 3300048911 Ga0496108_0158482 Ga0496108_0158482_278_751 156
805 3300048912 Ga0496109_0002055 Ga0496109_0002055_5816_6292 156
806 3300048912 Ga0496109_0984563 Ga0496109_0984563_138_614 156
807 3300048913 Ga0496110_0008147 Ga0496110_0008147_1907_2383 156
808 3300048914 Ga0496111_0051603 Ga0496111_0051603_842_1318 156
809 3300048914 Ga0496111_0607247 Ga0496111_0607247_302_781 156
810 3300048915 Ga0496112_0015595 Ga0496112_0015595_6504_6980 156
811 3300048915 Ga0496112_0259646 Ga0496112_0259646_103_579 156
812 3300048916 Ga0496113_0020005 Ga0496113_0020005_691_1167 156
813 3300048916 Ga0496113_0446974 Ga0496113_0446974_289_762 156
814 3300049568 Ga0501031_0134642 Ga0501031_0134642_367_843 156
815 3300049570 Ga0501033_0030548 Ga0501033_0030548_1285_1761 156
816 3300049571 Ga0501034_0025458 Ga0501034_0025458_3476_3952 156
817 3300049571 Ga0501034_0051843 Ga0501034_0051843_2020_2496 156
818 3300049573 Ga0501037_0021211 Ga0501037_0021211_1159_1635 156
819 3300049573 Ga0501037_0073660 Ga0501037_0073660_303_779 156
820 3300049573 Ga0501037_0267143 Ga0501037_0267143_156_635 156
821 3300049574 Ga0501038_0032464 Ga0501038_0032464_3331_3807 156
822 3300049574 Ga0501038_0075660 Ga0501038_0075660_604_1080 156
823 3300049580 Ga0501046_0000319 Ga0501046_0000319_39661_40137 156
824 3300049581 Ga0501047_0396403 Ga0501047_0396403_247_723 156
825 3300049581 Ga0501047_0428924 Ga0501047_0428924_602_1078 156
826 3300049582 Ga0501048_1212629 Ga0501048_1212629_24_500 156
827 3300049586 Ga0501070_0045874 Ga0501070_0045874_28_504 156
828 3300049589 Ga0501073_0045682 Ga0501073_0045682_426_902 156
829 3300049590 Ga0501074_0442984 Ga0501074_0442984_118_594 156
830 3300049591 Ga0501075_1230923 Ga0501075_1230923_84_557 156
831 3300049741 Ga0501079_0762628 Ga0501079_0762628_151_627 156
832 3300049742 Ga0501080_1536519 Ga0501080_1536519_23_499 156
833 3300049743 Ga0501081_0324703 Ga0501081_0324703_494_970 156
834 3300049743 Ga0501081_1373632 Ga0501081_1373632_38_514 156
835 3300049744 Ga0501083_0534335 Ga0501083_0534335_226_702 156
836 3300049822 Ga0501035_0085856 Ga0501035_0085856_1808_2284 156
837 3300049822 Ga0501035_0465802 Ga0501035_0465802_125_601 156
838 3300050489 nmdc:mga03683_212910_c1 nmdc:mga03683_212910_c1_305_778 156
839 3300050490 nmdc:mga03n38_9060_c1 nmdc:mga03n38_9060_c1_2015_2491 156
840 3300050491 nmdc:mga00v17_10264_c1 nmdc:mga00v17_10264_c1_2001_2477 156
841 3300050491 nmdc:mga00v17_272380_c1 nmdc:mga00v17_272380_c1_255_728 156
842 3300050492 nmdc:mga0yw44_114628_c1 nmdc:mga0yw44_114628_c1_422_898 156
843 3300050492 nmdc:mga0yw44_141492_c1 nmdc:mga0yw44_141492_c1_606_1082 156
844 3300050494 nmdc:mga06z11_1197_c1 nmdc:mga06z11_1197_c1_7825_8301 156
845 3300050494 nmdc:mga06z11_490234_c1 nmdc:mga06z11_490234_c1_17_490 156
846 3300050494 nmdc:mga06z11_4979_c1 nmdc:mga06z11_4979_c1_3377_3853 156
847 3300050495 nmdc:mga04h51_4050_c1 nmdc:mga04h51_4050_c1_2987_3463 156
848 3300050495 nmdc:mga04h51_90595_c1 nmdc:mga04h51_90595_c1_37_513 156
849 3300050510 nmdc:mga06r32_810729_c1 nmdc:mga06r32_810729_c1_211_684 156
850 3300050511 nmdc:mga08y16_46046_c1 nmdc:mga08y16_46046_c1_2637_3116 156
851 3300053077 Ga0495601_0100774 Ga0495601_0100774_668_1141 156
852 3300053084 Ga0495595_0168963 Ga0495595_0168963_132_608 156
853 3300053085 Ga0495619_0056285 Ga0495619_0056285_1451_1927 156
854 3300053104 Ga0500556_0000669 Ga0500556_0000669_17003_17479 156
855 3300053108 Ga0500562_019421 Ga0500562_019421_389_865 156
856 3300053153 Ga0500616_0015808 Ga0500616_0015808_157_636 156
857 3300053730 Ga0500645_046847 Ga0500645_046847_275_751 156
858 3300054114 Ga0501084_0181657 Ga0501084_0181657_489_965 156
859 3300060353 Ga0501082_0139561 Ga0501082_0139561_649_1125 156
860 3300060353 Ga0501082_0548649 Ga0501082_0548649_438_914 156
861 3300061734 Ga0530510_0436336 Ga0530510_0436336_14_490 156
862 iso_pu_bacteria 2765235802 2765465140 156
863 iso_pu_bacteria 2775506902 2776272007 156
864 iso_pu_bacteria 2775506904 2776279474 156
865 iso_pu_bacteria 2839993093 2839995953 156
866 iso_pu_bacteria 2894652903 2894654947 156
867 iso_pu_bacteria 2904578770 2904581309 156
868 iso_pu_bacteria 2919119836 2919122548 156
869 iso_pu_bacteria 2936996657 2937001246 156
870 iso_pu_bacteria 8049293176 8049293864 156
871 3300003578 Ga0006562J51391_1002758 Ga0006562J51391_10027583 157
872 3300048922 Ga0496119_0012390 Ga0496119_0012390_4299_4775 157
873 3300048926 Ga0496123_0064647 Ga0496123_0064647_1479_1955 157
874 3300048928 Ga0496125_0090818 Ga0496125_0090818_369_845 157
875 3300048928 Ga0496125_0403847 Ga0496125_0403847_183_659 157
876 iso_pu_bacteria 2757320392 2757570722 157
877 3300003781 Ga0055536_1012718 Ga0055536_10127184 158
878 3300003792 Ga0055540_1006048 Ga0055540_10060484 158
879 3300003794 Ga0055531_10014219 Ga0055531_100142193 158
880 3300005262 Ga0065165_1007484 Ga0065165_10074845 158
881 3300005548 Ga0070665_100560607 Ga0070665_1005606071 158
882 3300006038 Ga0075365_10015363 Ga0075365_100153635 158
883 3300006051 Ga0075364_10000626 Ga0075364_1000062616 158
884 3300006946 Ga0079104_1000010 Ga0079104_100001015 158
885 3300013104 Ga0157370_10049465 Ga0157370_100494653 158
886 3300013105 Ga0157369_10022319 Ga0157369_100223193 158
887 3300025284 Ga0209130_1035369 Ga0209130_10353692 158
888 3300025292 Ga0209676_1003899 Ga0209676_10038993 158
889 3300025297 Ga0209758_1000121 Ga0209758_1000121195 158
890 3300025298 Ga0209050_1005697 Ga0209050_10056977 158
891 3300025303 Ga0209051_1001371 Ga0209051_100137120 158
892 3300025304 Ga0209257_1002234 Ga0209257_10022344 158
893 3300025304 Ga0209257_1070664 Ga0209257_10706641 158
894 3300027111 Ga0209281_1000053 Ga0209281_100005399 158
895 3300028379 Ga0268266_10043770 Ga0268266_100437702 158
896 3300031731 Ga0307405_10184672 Ga0307405_101846722 158
897 3300031911 Ga0307412_10051009 Ga0307412_100510093 158
898 3300031911 Ga0307412_10386357 Ga0307412_103863572 158
899 3300031995 Ga0307409_100025497 Ga0307409_1000254972 158
900 3300032002 Ga0307416_100761462 Ga0307416_1007614622 158
901 3300041404 Ga0439436_0014549 Ga0439436_0014549_963_1439 158
902 3300041405 Ga0439438_060850 Ga0439438_060850_287_763 158
903 3300041413 Ga0439465_0044300 Ga0439465_0044300_402_878 158
904 3300041462 Ga0451806_262218 Ga0451806_262218_54_530 158
905 3300042122 Ga0450920_014679 Ga0450920_014679_299_775 158
906 3300044683 Ga0466965_0058713 Ga0466965_0058713_1378_1854 158
907 3300044735 Ga0466968_0197590 Ga0466968_0197590_324_800 158
908 3300046501 Ga0495607_0076199 Ga0495607_0076199_1355_1831 158
909 3300046530 Ga0495654_0001866 Ga0495654_0001866_3329_3805 158
910 3300046530 Ga0495654_0079108 Ga0495654_0079108_389_865 158
911 3300046660 Ga0495625_0037919 Ga0495625_0037919_1018_1494 158
912 3300048913 Ga0496110_0113099 Ga0496110_0113099_1517_1993 158
913 3300048914 Ga0496111_0002494 Ga0496111_0002494_2063_2539 158
914 3300048924 Ga0496121_0003656 Ga0496121_0003656_11367_11843 158
915 3300048925 Ga0496122_0000009 Ga0496122_0000009_20988_21464 158
916 3300048925 Ga0496122_0118320 Ga0496122_0118320_799_1275 158
917 3300048926 Ga0496123_0000034 Ga0496123_0000034_209873_210349 158
918 3300048926 Ga0496123_0045004 Ga0496123_0045004_1737_2213 158
919 3300048927 Ga0496124_0054133 Ga0496124_0054133_2737_3213 158
920 3300048927 Ga0496124_0344022 Ga0496124_0344022_366_842 158
921 3300050491 nmdc:mga00v17_1031_c1 nmdc:mga00v17_1031_c1_4166_4642 158
922 3300050491 nmdc:mga00v17_402474_c1 nmdc:mga00v17_402474_c1_378_854 158
923 3300050492 nmdc:mga0yw44_7029_c1 nmdc:mga0yw44_7029_c1_4792_5268 158
924 3300053125 Ga0500618_000055 Ga0500618_000055_97813_98289 158
925 3300053125 Ga0500618_000272 Ga0500618_000272_34813_35289 158
926 3300053125 Ga0500618_015050 Ga0500618_015050_1412_1888 158
927 3300053153 Ga0500616_0000224 Ga0500616_0000224_29291_29767 158
928 iso_pu_bacteria 2818991461 2819684208 158
929 3300001979 JGI24740J21852_10001504 JGI24740J21852_100015042 159
930 3300001989 JGI24739J22299_10159059 JGI24739J22299_101590592 159
931 3300001989 JGI24739J22299_10180744 JGI24739J22299_101807441 159
932 3300002704 JGI25155J39150_1000783 JGI25155J39150_10007835 159
933 3300002705 JGI25156J39149_1000086 JGI25156J39149_10000861 159
934 3300002737 JGI25162J39368_1002183 JGI25162J39368_10021836 159
935 3300002737 JGI25162J39368_1003431 JGI25162J39368_10034313 159
936 3300002738 JGI25154J39366_1002301 JGI25154J39366_10023015 159
937 3300002739 JGI25158J39367_1000020 JGI25158J39367_100002037 159
938 3300002739 JGI25158J39367_1002568 JGI25158J39367_10025682 159
939 3300002741 JGI25157J39369_1000113 JGI25157J39369_10001131 159
940 3300002773 JGI25152J39213_1000386 JGI25152J39213_100038627 159
941 3300002773 JGI25152J39213_1000911 JGI25152J39213_10009114 159
942 3300002773 JGI25152J39213_1006715 JGI25152J39213_10067154 159
943 3300002773 JGI25152J39213_1031357 JGI25152J39213_10313571 159
944 3300002774 JGI25150J39212_1000031 JGI25150J39212_100003163 159
945 3300002774 JGI25150J39212_1004438 JGI25150J39212_10044383 159
946 3300002987 JGI25159J45721_1000361 JGI25159J45721_100036119 159
947 3300002987 JGI25159J45721_1000366 JGI25159J45721_10003665 159
948 3300002987 JGI25159J45721_1000852 JGI25159J45721_10008524 159
949 3300003187 JGI25151J46595_10000062 JGI25151J46595_1000006261 159
950 3300003187 JGI25151J46595_10001513 JGI25151J46595_100015133 159
951 3300003187 JGI25151J46595_10026932 JGI25151J46595_100269322 159
952 3300003187 JGI25151J46595_10033323 JGI25151J46595_100333232 159
953 3300003187 JGI25151J46595_10036217 JGI25151J46595_100362171 159
954 3300003187 JGI25151J46595_10082306 JGI25151J46595_100823061 159
955 3300003214 JGI25165J46597_1001783 JGI25165J46597_10017833 159
956 3300003214 JGI25165J46597_1001952 JGI25165J46597_10019526 159
957 3300003215 JGI25153J46596_10000501 JGI25153J46596_1000050128 159
958 3300003215 JGI25153J46596_10018323 JGI25153J46596_100183232 159
959 3300003215 JGI25153J46596_10067098 JGI25153J46596_100670981 159
960 3300003354 JGI25160J50197_1000052 JGI25160J50197_100005263 159
961 3300003354 JGI25160J50197_1000562 JGI25160J50197_100056216 159
962 3300003354 JGI25160J50197_1000754 JGI25160J50197_10007549 159
963 3300003354 JGI25160J50197_1010611 JGI25160J50197_10106114 159
964 3300003354 JGI25160J50197_1013162 JGI25160J50197_10131622 159
965 3300003374 JGI25161J50226_1000073 JGI25161J50226_100007316 159
966 3300003374 JGI25161J50226_1000113 JGI25161J50226_10001137 159
967 3300003374 JGI25161J50226_1000133 JGI25161J50226_100013313 159
968 3300003374 JGI25161J50226_1000436 JGI25161J50226_100043614 159
969 3300003374 JGI25161J50226_1006111 JGI25161J50226_10061113 159
970 3300003752 Ga0055539_1016004 Ga0055539_10160041 159
971 3300003771 Ga0055526_1001219 Ga0055526_100121917 159
972 3300003771 Ga0055526_1002323 Ga0055526_10023233 159
973 3300003771 Ga0055526_1006191 Ga0055526_10061911 159
974 3300003771 Ga0055526_1009421 Ga0055526_10094213 159
975 3300003771 Ga0055526_1011789 Ga0055526_10117894 159
976 3300003771 Ga0055526_1017326 Ga0055526_10173262 159
977 3300003771 Ga0055526_1017854 Ga0055526_10178544 159
978 3300003775 Ga0055524_1002159 Ga0055524_10021599 159
979 3300003775 Ga0055524_1004356 Ga0055524_10043565 159
980 3300003775 Ga0055524_1013497 Ga0055524_10134973 159
981 3300003775 Ga0055524_1029743 Ga0055524_10297431 159
982 3300003775 Ga0055524_1033895 Ga0055524_10338952 159
983 3300003775 Ga0055524_1036948 Ga0055524_10369482 159
984 3300003781 Ga0055536_1002650 Ga0055536_10026505 159
985 3300003790 Ga0055528_1000149 Ga0055528_100014964 159
986 3300003790 Ga0055528_1004486 Ga0055528_10044865 159
987 3300003790 Ga0055528_1010018 Ga0055528_10100184 159
988 3300003790 Ga0055528_1011985 Ga0055528_10119852 159
989 3300003790 Ga0055528_1019374 Ga0055528_10193742 159
990 3300003791 Ga0055530_10008208 Ga0055530_100082084 159
991 3300003791 Ga0055530_10011253 Ga0055530_100112534 159
992 3300003792 Ga0055540_1000406 Ga0055540_100040635 159
993 3300003792 Ga0055540_1002588 Ga0055540_10025882 159
994 3300003792 Ga0055540_1003073 Ga0055540_10030737 159
995 3300003792 Ga0055540_1036446 Ga0055540_10364461 159
996 3300003792 Ga0055540_1058187 Ga0055540_10581871 159
997 3300003794 Ga0055531_10002936 Ga0055531_100029367 159
998 3300003856 Ga0058692_1005916 Ga0058692_10059161 159
999 3300003856 Ga0058692_1033337 Ga0058692_10333371 159
1000 3300004625 Ga0055543_1000035 Ga0055543_100003558 159
1001 3300004625 Ga0055543_1000048 Ga0055543_100004855 159
1002 3300004625 Ga0055543_1000656 Ga0055543_100065615 159
1003 3300004625 Ga0055543_1000745 Ga0055543_100074516 159
1004 3300005262 Ga0065165_1000253 Ga0065165_100025337 159
1005 3300005262 Ga0065165_1001769 Ga0065165_10017696 159
1006 3300005262 Ga0065165_1002851 Ga0065165_10028519 159
1007 3300005262 Ga0065165_1118658 Ga0065165_11186581 159
1008 3300005290 Ga0065712_10396488 Ga0065712_103964882 159
1009 3300005331 Ga0070670_100825402 Ga0070670_1008254021 159
1010 3300005335 Ga0070666_10070199 Ga0070666_100701992 159
1011 3300005337 Ga0070682_100357034 Ga0070682_1003570341 159
1012 3300005347 Ga0070668_100376604 Ga0070668_1003766042 159
1013 3300005347 Ga0070668_100948388 Ga0070668_1009483881 159
1014 3300005353 Ga0070669_100147123 Ga0070669_1001471232 159
1015 3300005367 Ga0070667_100906450 Ga0070667_1009064501 159
1016 3300005548 Ga0070665_100017484 Ga0070665_1000174845 159
1017 3300005548 Ga0070665_101317981 Ga0070665_1013179811 159
1018 3300005563 Ga0068855_100264669 Ga0068855_1002646692 159
1019 3300005614 Ga0068856_100042847 Ga0068856_1000428472 159
1020 3300005616 Ga0068852_100229239 Ga0068852_1002292391 159
1021 3300005616 Ga0068852_102009493 Ga0068852_1020094931 159
1022 3300005834 Ga0068851_10228557 Ga0068851_102285572 159
1023 3300005843 Ga0068860_100313708 Ga0068860_1003137082 159
1024 3300005844 Ga0068862_100659349 Ga0068862_1006593492 159
1025 3300005844 Ga0068862_100936056 Ga0068862_1009360562 159
1026 3300005937 Ga0081455_10551017 Ga0081455_105510172 159
1027 3300006038 Ga0075365_10005558 Ga0075365_100055584 159
1028 3300006038 Ga0075365_10137539 Ga0075365_101375392 159
1029 3300006038 Ga0075365_10418529 Ga0075365_104185292 159
1030 3300006042 Ga0075368_10007881 Ga0075368_100078814 159
1031 3300006042 Ga0075368_10059326 Ga0075368_100593262 159
1032 3300006051 Ga0075364_10041349 Ga0075364_100413493 159
1033 3300006051 Ga0075364_10102197 Ga0075364_101021972 159
1034 3300006051 Ga0075364_10176575 Ga0075364_101765752 159
1035 3300006178 Ga0075367_10048820 Ga0075367_100488202 159
1036 3300006186 Ga0075369_10022821 Ga0075369_100228212 159
1037 3300006186 Ga0075369_10112930 Ga0075369_101129302 159
1038 3300006195 Ga0075366_10366080 Ga0075366_103660801 159
1039 3300006353 Ga0075370_10001714 Ga0075370_100017146 159
1040 3300006353 Ga0075370_10085955 Ga0075370_100859552 159
1041 3300006353 Ga0075370_10139571 Ga0075370_101395712 159
1042 3300006871 Ga0075434_100753295 Ga0075434_1007532952 159
1043 3300006946 Ga0079104_1002748 Ga0079104_10027487 159
1044 3300006946 Ga0079104_1012466 Ga0079104_10124663 159
1045 3300009011 Ga0105251_10076072 Ga0105251_100760722 159
1046 3300009036 Ga0105244_10341864 Ga0105244_103418641 159
1047 3300009092 Ga0105250_10337787 Ga0105250_103377871 159
1048 3300009092 Ga0105250_10388574 Ga0105250_103885741 159
1049 3300009093 Ga0105240_10000032 Ga0105240_10000032273 159
1050 3300009101 Ga0105247_10936699 Ga0105247_109366991 159
1051 3300009147 Ga0114129_10882160 Ga0114129_108821603 159
1052 3300009147 Ga0114129_11355331 Ga0114129_113553312 159
1053 3300009148 Ga0105243_10018348 Ga0105243_100183483 159
1054 3300009177 Ga0105248_10055661 Ga0105248_100556612 159
1055 3300009177 Ga0105248_10415690 Ga0105248_104156902 159
1056 3300009545 Ga0105237_10001967 Ga0105237_1000196723 159
1057 3300009551 Ga0105238_11352837 Ga0105238_113528371 159
1058 3300009553 Ga0105249_11163537 Ga0105249_111635371 159
1059 3300009763 Ga0123340_1066116 Ga0123340_10661161 159
1060 3300009765 Ga0123341_1000048 Ga0123341_100004838 159
1061 3300009765 Ga0123341_1090199 Ga0123341_10901992 159
1062 3300009765 Ga0123341_1105118 Ga0123341_11051181 159
1063 3300009766 Ga0123342_1014993 Ga0123342_10149935 159
1064 3300009766 Ga0123342_1026748 Ga0123342_10267482 159
1065 3300010375 Ga0105239_10005020 Ga0105239_1000502012 159
1066 3300010375 Ga0105239_10684422 Ga0105239_106844222 159
1067 3300010375 Ga0105239_11318623 Ga0105239_113186231 159
1068 3300011119 Ga0105246_10437253 Ga0105246_104372532 159
1069 3300013100 Ga0157373_10097971 Ga0157373_100979712 159
1070 3300013100 Ga0157373_10176040 Ga0157373_101760402 159
1071 3300013102 Ga0157371_10000380 Ga0157371_1000038054 159
1072 3300013102 Ga0157371_10007779 Ga0157371_100077794 159
1073 3300013104 Ga0157370_10000748 Ga0157370_1000074839 159
1074 3300013104 Ga0157370_10021519 Ga0157370_100215194 159
1075 3300013105 Ga0157369_10376366 Ga0157369_103763662 159
1076 3300015262 Ga0182007_10004543 Ga0182007_100045434 159
1077 3300015265 Ga0182005_1002238 Ga0182005_10022384 159
1078 3300021321 Ga0214542_1015605 Ga0214542_10156054 159
1079 3300021327 Ga0214543_1000003 Ga0214543_1000003415 159
1080 3300022739 Ga0228711_1000001 Ga0228711_1000001133 159
1081 3300022740 Ga0228710_1000001 Ga0228710_1000001192 159
1082 3300025206 Ga0209435_100036 Ga0209435_100036124 159
1083 3300025208 Ga0209436_100064 Ga0209436_10006449 159
1084 3300025208 Ga0209436_101612 Ga0209436_1016126 159
1085 3300025208 Ga0209436_102305 Ga0209436_1023053 159
1086 3300025230 Ga0209563_108942 Ga0209563_1089422 159
1087 3300025233 Ga0209437_100033 Ga0209437_100033218 159
1088 3300025233 Ga0209437_100075 Ga0209437_100075293 159
1089 3300025245 Ga0207425_1000031 Ga0207425_1000031177 159
1090 3300025245 Ga0207425_1000994 Ga0207425_100099415 159
1091 3300025245 Ga0207425_1005615 Ga0207425_10056152 159
1092 3300025245 Ga0207425_1008116 Ga0207425_10081163 159
1093 3300025245 Ga0207425_1062337 Ga0207425_10623372 159
1094 3300025245 Ga0207425_1062493 Ga0207425_10624931 159
1095 3300025246 Ga0209646_1000132 Ga0209646_1000132124 159
1096 3300025246 Ga0209646_1007424 Ga0209646_10074241 159
1097 3300025250 Ga0209026_1000236 Ga0209026_100023661 159
1098 3300025253 Ga0209677_101911 Ga0209677_1019111 159
1099 3300025254 Ga0209148_1003173 Ga0209148_10031735 159
1100 3300025256 Ga0209759_1000269 Ga0209759_100026961 159
1101 3300025258 Ga0209129_1000053 Ga0209129_1000053178 159
1102 3300025258 Ga0209129_1000362 Ga0209129_10003623 159
1103 3300025258 Ga0209129_1001787 Ga0209129_10017872 159
1104 3300025258 Ga0209129_1002780 Ga0209129_10027802 159
1105 3300025258 Ga0209129_1003220 Ga0209129_10032203 159
1106 3300025261 Ga0209233_1000056 Ga0209233_1000056117 159
1107 3300025261 Ga0209233_1000064 Ga0209233_1000064204 159
1108 3300025261 Ga0209233_1000209 Ga0209233_10002096 159
1109 3300025272 Ga0209455_1012736 Ga0209455_10127362 159
1110 3300025273 Ga0209673_1000041 Ga0209673_10000414 159
1111 3300025273 Ga0209673_1000254 Ga0209673_100025457 159
1112 3300025273 Ga0209673_1000850 Ga0209673_100085039 159
1113 3300025273 Ga0209673_1010993 Ga0209673_10109934 159
1114 3300025273 Ga0209673_1013263 Ga0209673_10132634 159
1115 3300025273 Ga0209673_1022903 Ga0209673_10229032 159
1116 3300025284 Ga0209130_1000006 Ga0209130_1000006591 159
1117 3300025284 Ga0209130_1000007 Ga0209130_10000076 159
1118 3300025284 Ga0209130_1000018 Ga0209130_1000018327 159
1119 3300025284 Ga0209130_1014518 Ga0209130_10145181 159
1120 3300025292 Ga0209676_1000901 Ga0209676_10009018 159
1121 3300025292 Ga0209676_1022126 Ga0209676_10221263 159
1122 3300025294 Ga0209025_1000074 Ga0209025_1000074191 159
1123 3300025294 Ga0209025_1000080 Ga0209025_1000080102 159
1124 3300025294 Ga0209025_1000087 Ga0209025_1000087177 159
1125 3300025294 Ga0209025_1000100 Ga0209025_1000100151 159
1126 3300025294 Ga0209025_1000149 Ga0209025_10001495 159
1127 3300025294 Ga0209025_1000284 Ga0209025_100028470 159
1128 3300025294 Ga0209025_1001555 Ga0209025_100155532 159
1129 3300025294 Ga0209025_1014151 Ga0209025_10141514 159
1130 3300025294 Ga0209025_1014455 Ga0209025_10144553 159
1131 3300025294 Ga0209025_1014457 Ga0209025_10144573 159
1132 3300025294 Ga0209025_1021731 Ga0209025_10217313 159
1133 3300025295 Ga0209564_1000233 Ga0209564_100023354 159
1134 3300025295 Ga0209564_1000399 Ga0209564_100039945 159
1135 3300025295 Ga0209564_1000846 Ga0209564_100084616 159
1136 3300025295 Ga0209564_1003634 Ga0209564_10036344 159
1137 3300025295 Ga0209564_1006463 Ga0209564_10064632 159
1138 3300025295 Ga0209564_1009945 Ga0209564_10099452 159
1139 3300025297 Ga0209758_1000081 Ga0209758_1000081177 159
1140 3300025297 Ga0209758_1000420 Ga0209758_10004203 159
1141 3300025297 Ga0209758_1003544 Ga0209758_100354415 159
1142 3300025297 Ga0209758_1007760 Ga0209758_10077604 159
1143 3300025297 Ga0209758_1011206 Ga0209758_10112062 159
1144 3300025297 Ga0209758_1084672 Ga0209758_10846722 159
1145 3300025298 Ga0209050_1001776 Ga0209050_10017765 159
1146 3300025298 Ga0209050_1012695 Ga0209050_10126952 159
1147 3300025299 Ga0209256_1001151 Ga0209256_100115112 159
1148 3300025299 Ga0209256_1002690 Ga0209256_10026903 159
1149 3300025299 Ga0209256_1005237 Ga0209256_10052375 159
1150 3300025299 Ga0209256_1009404 Ga0209256_10094044 159
1151 3300025299 Ga0209256_1009886 Ga0209256_10098862 159
1152 3300025302 Ga0207426_1000044 Ga0207426_100004462 159
1153 3300025302 Ga0207426_1000064 Ga0207426_10000646 159
1154 3300025302 Ga0207426_1000106 Ga0207426_1000106168 159
1155 3300025302 Ga0207426_1000265 Ga0207426_100026554 159
1156 3300025302 Ga0207426_1001649 Ga0207426_100164915 159
1157 3300025303 Ga0209051_1001024 Ga0209051_100102422 159
1158 3300025303 Ga0209051_1003839 Ga0209051_10038393 159
1159 3300025303 Ga0209051_1007379 Ga0209051_10073795 159
1160 3300025303 Ga0209051_1032709 Ga0209051_10327092 159
1161 3300025303 Ga0209051_1073570 Ga0209051_10735702 159
1162 3300025304 Ga0209257_1001970 Ga0209257_10019706 159
1163 3300025304 Ga0209257_1003486 Ga0209257_10034865 159
1164 3300025321 Ga0207656_10077781 Ga0207656_100777812 159
1165 3300025728 Ga0207655_1226194 Ga0207655_12261941 159
1166 3300025735 Ga0207713_1065031 Ga0207713_10650311 159
1167 3300025913 Ga0207695_10000024 Ga0207695_10000024274 159
1168 3300025914 Ga0207671_10000548 Ga0207671_1000054849 159
1169 3300025923 Ga0207681_10216967 Ga0207681_102169672 159
1170 3300025925 Ga0207650_10691984 Ga0207650_106919842 159
1171 3300025941 Ga0207711_10217093 Ga0207711_102170932 159
1172 3300025941 Ga0207711_10736860 Ga0207711_107368602 159
1173 3300025949 Ga0207667_10227210 Ga0207667_102272102 159
1174 3300025972 Ga0207668_10085573 Ga0207668_100855732 159
1175 3300025972 Ga0207668_10118538 Ga0207668_101185382 159
1176 3300026067 Ga0207678_10506547 Ga0207678_105065471 159
1177 3300026142 Ga0207698_10018742 Ga0207698_100187423 159
1178 3300027111 Ga0209281_1000164 Ga0209281_100016438 159
1179 3300027111 Ga0209281_1002461 Ga0209281_10024612 159
1180 3300027312 Ga0209371_1000021 Ga0209371_1000021547 159
1181 3300027312 Ga0209371_1004458 Ga0209371_10044583 159
1182 3300027312 Ga0209371_1005193 Ga0209371_10051935 159
1183 3300027666 Ga0209282_1000007 Ga0209282_1000007119 159
1184 3300027866 Ga0209813_10227465 Ga0209813_102274651 159
1185 3300027866 Ga0209813_10308877 Ga0209813_103088771 159
1186 3300028379 Ga0268266_10039938 Ga0268266_100399382 159
1187 3300028379 Ga0268266_10063381 Ga0268266_100633811 159
1188 3300028379 Ga0268266_11296908 Ga0268266_112969081 159
1189 3300028380 Ga0268265_10820190 Ga0268265_108201902 159
1190 3300028380 Ga0268265_10980634 Ga0268265_109806342 159
1191 3300028381 Ga0268264_10542338 Ga0268264_105423382 159
1192 3300028794 Ga0307515_10024373 Ga0307515_1002437311 159
1193 3300028794 Ga0307515_10275303 Ga0307515_102753032 159
1194 3300028794 Ga0307515_10322155 Ga0307515_103221552 159
1195 3300028794 Ga0307515_10679160 Ga0307515_106791601 159
1196 3300030500 Ga0268256_1000020 Ga0268256_1000020553 159
1197 3300030500 Ga0268256_1001181 Ga0268256_100118115 159
1198 3300031456 Ga0307513_10004545 Ga0307513_1000454514 159
1199 3300031456 Ga0307513_10115492 Ga0307513_101154922 159
1200 3300031548 Ga0307408_100084834 Ga0307408_1000848342 159
1201 3300031731 Ga0307405_10158899 Ga0307405_101588992 159
1202 3300031901 Ga0307406_10028875 Ga0307406_100288753 159
1203 3300031911 Ga0307412_10102454 Ga0307412_101024543 159
1204 3300031911 Ga0307412_10283529 Ga0307412_102835292 159
1205 3300031911 Ga0307412_10464506 Ga0307412_104645062 159
1206 3300031911 Ga0307412_11640383 Ga0307412_116403831 159
1207 3300031967 Ga0315914_1000006 Ga0315914_1000006124 159
1208 3300031995 Ga0307409_100426765 Ga0307409_1004267651 159
1209 3300033430 Ga0315913_1000002 Ga0315913_1000002119 159
1210 3300033464 Ga0315915_1000001 Ga0315915_1000001368 159
1211 3300035170 Ga0373943_0077583 Ga0373943_0077583_198_677 159
1212 3300035691 Ga0373931_0300835 Ga0373931_0300835_154_651 159
1213 3300035692 Ga0373935_0020750 Ga0373935_0020750_2592_3071 159
1214 3300035695 Ga0373927_0000554 Ga0373927_0000554_18444_18923 159
1215 3300037068 Ga0373925_0011828 Ga0373925_0011828_3945_4424 159
1216 3300037418 Ga0395900_0081668 Ga0395900_0081668_302_781 159
1217 3300037471 Ga0395905_0006076 Ga0395905_0006076_4745_5224 159
1218 3300037471 Ga0395905_0013147 Ga0395905_0013147_967_1446 159
1219 3300037471 Ga0395905_0030383 Ga0395905_0030383_1541_2020 159
1220 3300037471 Ga0395905_1268393 Ga0395905_1268393_118_597 159
1221 3300039437 Ga0436365_1591560 Ga0436365_1591560_300_779 159
1222 3300041404 Ga0439436_0041064 Ga0439436_0041064_390_869 159
1223 3300041411 Ga0439466_0038686 Ga0439466_0038686_916_1395 159
1224 3300041411 Ga0439466_0054407 Ga0439466_0054407_676_1155 159
1225 3300041413 Ga0439465_0002776 Ga0439465_0002776_571_1050 159
1226 3300041441 Ga0451787_623160 Ga0451787_623160_2811_3290 159
1227 3300041451 Ga0451791_1108890 Ga0451791_1108890_512_1018 159
1228 3300041458 Ga0451798_0731341 Ga0451798_0731341_178_657 159
1229 3300041460 Ga0451802_1570359 Ga0451802_1570359_169_648 159
1230 3300041460 Ga0451802_2160217 Ga0451802_2160217_227_724 159
1231 3300041492 Ga0451835_1102525 Ga0451835_1102525_27_533 159
1232 3300041496 Ga0451839_1003243 Ga0451839_1003243_913_1392 159
1233 3300041498 Ga0451841_0239153 Ga0451841_0239153_1087_1566 159
1234 3300041500 Ga0451844_18177 Ga0451844_18177_36_542 159
1235 3300041501 Ga0451845_0588294 Ga0451845_0588294_27_506 159
1236 3300041502 Ga0451846_37911 Ga0451846_37911_336_842 159
1237 3300041503 Ga0451847_0753556 Ga0451847_0753556_1087_1566 159
1238 3300041505 Ga0451849_0147068 Ga0451849_0147068_832_1311 159
1239 3300041505 Ga0451849_1455101 Ga0451849_1455101_633_1112 159
1240 3300041507 Ga0451851_0643395 Ga0451851_0643395_832_1311 159
1241 3300041509 Ga0451843_0925659 Ga0451843_0925659_127_606 159
1242 3300041510 Ga0451854_20336 Ga0451854_20336_1104_1610 159
1243 3300041511 Ga0451855_0785564 Ga0451855_0785564_276_755 159
1244 3300041511 Ga0451855_0812296 Ga0451855_0812296_998_1504 159
1245 3300041907 Ga0452268_17162 Ga0452268_17162_76_555 159
1246 3300041916 Ga0452271_12430 Ga0452271_12430_633_1139 159
1247 3300041997 Ga0439431_0039855 Ga0439431_0039855_542_1021 159
1248 3300042004 Ga0439445_0014819 Ga0439445_0014819_131_613 159
1249 3300042004 Ga0439445_0050072 Ga0439445_0050072_349_828 159
1250 3300042005 Ga0439448_0151941 Ga0439448_0151941_241_738 159
1251 3300042007 Ga0439449_0035248 Ga0439449_0035248_1179_1700 159
1252 3300042145 Ga0450906_040979 Ga0450906_040979_137_658 159
1253 3300044694 Ga0466963_0242014 Ga0466963_0242014_431_910 159
1254 3300044765 Ga0466970_0035949 Ga0466970_0035949_1586_2065 159
1255 3300046452 Ga0495617_033035 Ga0495617_033035_892_1371 159
1256 3300046452 Ga0495617_114079 Ga0495617_114079_344_850 159
1257 3300046453 Ga0495627_089122 Ga0495627_089122_35_514 159
1258 3300046460 Ga0495638_0000353 Ga0495638_0000353_43184_43663 159
1259 3300046460 Ga0495638_0136555 Ga0495638_0136555_169_648 159
1260 3300046471 Ga0495650_0043640 Ga0495650_0043640_991_1470 159
1261 3300046471 Ga0495650_0111280 Ga0495650_0111280_285_764 159
1262 3300046474 Ga0495605_0040656 Ga0495605_0040656_920_1399 159
1263 3300046491 Ga0495584_0422641 Ga0495584_0422641_89_568 159
1264 3300046492 Ga0495585_0013046 Ga0495585_0013046_420_926 159
1265 3300046492 Ga0495585_0033706 Ga0495585_0033706_1345_1824 159
1266 3300046492 Ga0495585_0053055 Ga0495585_0053055_411_890 159
1267 3300046501 Ga0495607_0133287 Ga0495607_0133287_510_1016 159
1268 3300046501 Ga0495607_0173839 Ga0495607_0173839_579_1058 159
1269 3300046506 Ga0495583_0008919 Ga0495583_0008919_5291_5770 159
1270 3300046506 Ga0495583_0031007 Ga0495583_0031007_1450_1929 159
1271 3300046507 Ga0495606_0000914 Ga0495606_0000914_36473_36952 159
1272 3300046507 Ga0495606_0040432 Ga0495606_0040432_1884_2363 159
1273 3300046507 Ga0495606_0064155 Ga0495606_0064155_1364_1843 159
1274 3300046507 Ga0495606_0086580 Ga0495606_0086580_22_501 159
1275 3300046507 Ga0495606_0088949 Ga0495606_0088949_282_761 159
1276 3300046507 Ga0495606_0160217 Ga0495606_0160217_519_998 159
1277 3300046507 Ga0495606_0185343 Ga0495606_0185343_534_1013 159
1278 3300046512 Ga0495610_0009256 Ga0495610_0009256_1408_1887 159
1279 3300046512 Ga0495610_0025623 Ga0495610_0025623_2513_2992 159
1280 3300046512 Ga0495610_0058343 Ga0495610_0058343_136_615 159
1281 3300046513 Ga0495616_0051818 Ga0495616_0051818_705_1184 159
1282 3300046513 Ga0495616_0073362 Ga0495616_0073362_715_1194 159
1283 3300046515 Ga0495620_0006737 Ga0495620_0006737_1186_1665 159
1284 3300046515 Ga0495620_0212352 Ga0495620_0212352_54_533 159
1285 3300046518 Ga0495631_0001310 Ga0495631_0001310_12624_13103 159
1286 3300046518 Ga0495631_0060702 Ga0495631_0060702_170_676 159
1287 3300046519 Ga0495632_0006839 Ga0495632_0006839_5430_5909 159
1288 3300046519 Ga0495632_0162808 Ga0495632_0162808_243_722 159
1289 3300046522 Ga0495643_0004164 Ga0495643_0004164_2048_2527 159
1290 3300046525 Ga0495663_0109847 Ga0495663_0109847_225_704 159
1291 3300046530 Ga0495654_0067784 Ga0495654_0067784_334_813 159
1292 3300046538 Ga0495609_0097941 Ga0495609_0097941_479_985 159
1293 3300046542 Ga0495597_0005582 Ga0495597_0005582_2955_3434 159
1294 3300046558 Ga0495633_0056857 Ga0495633_0056857_135_620 159
1295 3300046558 Ga0495633_0090924 Ga0495633_0090924_77_583 159
1296 3300046558 Ga0495633_0531915 Ga0495633_0531915_28_513 159
1297 3300046615 Ga0495656_0006367 Ga0495656_0006367_3390_3869 159
1298 3300046616 Ga0495668_0006786 Ga0495668_0006786_5040_5519 159
1299 3300046616 Ga0495668_0050244 Ga0495668_0050244_647_1126 159
1300 3300046660 Ga0495625_0002820 Ga0495625_0002820_11580_12059 159
1301 3300046660 Ga0495625_0038967 Ga0495625_0038967_2513_2992 159
1302 3300046660 Ga0495625_0050667 Ga0495625_0050667_518_997 159
1303 3300046660 Ga0495625_0172291 Ga0495625_0172291_78_584 159
1304 3300046660 Ga0495625_0201627 Ga0495625_0201627_569_1048 159
1305 3300046660 Ga0495625_0304997 Ga0495625_0304997_446_925 159
1306 3300046674 Ga0495588_0007402 Ga0495588_0007402_844_1329 159
1307 3300046691 Ga0495670_0165237 Ga0495670_0165237_281_760 159
1308 3300046691 Ga0495670_0283078 Ga0495670_0283078_173_679 159
1309 3300046692 Ga0495671_0155280 Ga0495671_0155280_548_1027 159
1310 3300046694 Ga0495649_0054191 Ga0495649_0054191_798_1277 159
1311 3300046694 Ga0495649_0076133 Ga0495649_0076133_521_1000 159
1312 3300046810 Ga0495660_0020810 Ga0495660_0020810_1765_2244 159
1313 3300047443 Ga0495687_009165 Ga0495687_009165_2730_3209 159
1314 3300047469 Ga0495673_0051276 Ga0495673_0051276_593_1072 159
1315 3300047470 Ga0495681_0074686 Ga0495681_0074686_257_736 159
1316 3300047470 Ga0495681_0078524 Ga0495681_0078524_882_1364 159
1317 3300047470 Ga0495681_0118140 Ga0495681_0118140_576_1082 159
1318 3300047472 Ga0495686_0003601 Ga0495686_0003601_8059_8538 159
1319 3300047472 Ga0495686_0012458 Ga0495686_0012458_1341_1820 159
1320 3300047472 Ga0495686_0023304 Ga0495686_0023304_1094_1573 159
1321 3300047472 Ga0495686_0136255 Ga0495686_0136255_383_862 159
1322 3300047472 Ga0495686_0167645 Ga0495686_0167645_342_821 159
1323 3300047472 Ga0495686_0274023 Ga0495686_0274023_129_635 159
1324 3300048905 Ga0496102_0087306 Ga0496102_0087306_1532_2011 159
1325 3300048906 Ga0496103_0034563 Ga0496103_0034563_1730_2209 159
1326 3300048906 Ga0496103_0151750 Ga0496103_0151750_857_1336 159
1327 3300048907 Ga0496104_0194156 Ga0496104_0194156_258_737 159
1328 3300048909 Ga0496106_0000154 Ga0496106_0000154_38921_39400 159
1329 3300048909 Ga0496106_0231769 Ga0496106_0231769_459_938 159
1330 3300048909 Ga0496106_0384681 Ga0496106_0384681_473_952 159
1331 3300048909 Ga0496106_0761109 Ga0496106_0761109_195_692 159
1332 3300048910 Ga0496107_0048975 Ga0496107_0048975_1369_1848 159
1333 3300048910 Ga0496107_0234246 Ga0496107_0234246_182_661 159
1334 3300048913 Ga0496110_0168855 Ga0496110_0168855_326_805 159
1335 3300048916 Ga0496113_0290265 Ga0496113_0290265_470_949 159
1336 3300048917 Ga0496114_0395900 Ga0496114_0395900_152_631 159
1337 3300048919 Ga0496116_0000036 Ga0496116_0000036_211603_212082 159
1338 3300048919 Ga0496116_0002110 Ga0496116_0002110_650_1129 159
1339 3300048919 Ga0496116_0027523 Ga0496116_0027523_2569_3048 159
1340 3300048919 Ga0496116_0029336 Ga0496116_0029336_379_861 159
1341 3300048919 Ga0496116_0037540 Ga0496116_0037540_971_1450 159
1342 3300048919 Ga0496116_0053240 Ga0496116_0053240_1276_1755 159
1343 3300048919 Ga0496116_0067683 Ga0496116_0067683_1608_2087 159
1344 3300048919 Ga0496116_0152033 Ga0496116_0152033_734_1213 159
1345 3300048919 Ga0496116_0216549 Ga0496116_0216549_145_624 159
1346 3300048919 Ga0496116_0244832 Ga0496116_0244832_102_584 159
1347 3300048919 Ga0496116_0253224 Ga0496116_0253224_374_856 159
1348 3300048920 Ga0496117_0000002 Ga0496117_0000002_1553534_1554016 159
1349 3300048920 Ga0496117_0002153 Ga0496117_0002153_7090_7569 159
1350 3300048920 Ga0496117_0010551 Ga0496117_0010551_5434_5913 159
1351 3300048920 Ga0496117_0018819 Ga0496117_0018819_3872_4354 159
1352 3300048920 Ga0496117_0104089 Ga0496117_0104089_913_1392 159
1353 3300048920 Ga0496117_0259354 Ga0496117_0259354_26_505 159
1354 3300048920 Ga0496117_0321984 Ga0496117_0321984_193_672 159
1355 3300048921 Ga0496118_0000695 Ga0496118_0000695_18875_19354 159
1356 3300048921 Ga0496118_0009554 Ga0496118_0009554_4610_5092 159
1357 3300048921 Ga0496118_0014074 Ga0496118_0014074_1678_2157 159
1358 3300048921 Ga0496118_0047727 Ga0496118_0047727_1212_1694 159
1359 3300048921 Ga0496118_0073124 Ga0496118_0073124_1059_1538 159
1360 3300048921 Ga0496118_0098500 Ga0496118_0098500_931_1410 159
1361 3300048921 Ga0496118_0149953 Ga0496118_0149953_172_654 159
1362 3300048922 Ga0496119_0011122 Ga0496119_0011122_5332_5811 159
1363 3300048922 Ga0496119_0044942 Ga0496119_0044942_949_1428 159
1364 3300048922 Ga0496119_0046970 Ga0496119_0046970_1623_2105 159
1365 3300048922 Ga0496119_0073510 Ga0496119_0073510_623_1105 159
1366 3300048922 Ga0496119_0153522 Ga0496119_0153522_145_624 159
1367 3300048923 Ga0496120_0000125 Ga0496120_0000125_122181_122663 159
1368 3300048923 Ga0496120_0011795 Ga0496120_0011795_3910_4389 159
1369 3300048923 Ga0496120_0062552 Ga0496120_0062552_127_609 159
1370 3300048924 Ga0496121_0000001 Ga0496121_0000001_828914_829396 159
1371 3300048924 Ga0496121_0014220 Ga0496121_0014220_1752_2231 159
1372 3300048924 Ga0496121_0017825 Ga0496121_0017825_528_1007 159
1373 3300048924 Ga0496121_0042528 Ga0496121_0042528_1540_2019 159
1374 3300048924 Ga0496121_0138826 Ga0496121_0138826_1057_1536 159
1375 3300048925 Ga0496122_0000001 Ga0496122_0000001_924323_924805 159
1376 3300048925 Ga0496122_0012658 Ga0496122_0012658_1572_2051 159
1377 3300048925 Ga0496122_0021382 Ga0496122_0021382_14_493 159
1378 3300048925 Ga0496122_0027430 Ga0496122_0027430_95_574 159
1379 3300048925 Ga0496122_0041867 Ga0496122_0041867_3092_3574 159
1380 3300048925 Ga0496122_0054647 Ga0496122_0054647_1257_1736 159
1381 3300048925 Ga0496122_0104601 Ga0496122_0104601_928_1407 159
1382 3300048925 Ga0496122_0106300 Ga0496122_0106300_741_1220 159
1383 3300048925 Ga0496122_0107404 Ga0496122_0107404_414_896 159
1384 3300048925 Ga0496122_0249702 Ga0496122_0249702_39_518 159
1385 3300048926 Ga0496123_0000001 Ga0496123_0000001_928054_928536 159
1386 3300048926 Ga0496123_0000460 Ga0496123_0000460_64863_65342 159
1387 3300048926 Ga0496123_0014859 Ga0496123_0014859_5518_5997 159
1388 3300048926 Ga0496123_0030287 Ga0496123_0030287_1487_1966 159
1389 3300048926 Ga0496123_0053635 Ga0496123_0053635_1104_1586 159
1390 3300048926 Ga0496123_0077597 Ga0496123_0077597_879_1358 159
1391 3300048926 Ga0496123_0082560 Ga0496123_0082560_1364_1846 159
1392 3300048926 Ga0496123_0083465 Ga0496123_0083465_1382_1861 159
1393 3300048926 Ga0496123_0130472 Ga0496123_0130472_531_1010 159
1394 3300048926 Ga0496123_0154898 Ga0496123_0154898_681_1160 159
1395 3300048926 Ga0496123_0234283 Ga0496123_0234283_44_523 159
1396 3300048927 Ga0496124_0000133 Ga0496124_0000133_27151_27630 159
1397 3300048927 Ga0496124_0000679 Ga0496124_0000679_49283_49762 159
1398 3300048927 Ga0496124_0005281 Ga0496124_0005281_8767_9246 159
1399 3300048927 Ga0496124_0010940 Ga0496124_0010940_1023_1502 159
1400 3300048927 Ga0496124_0011796 Ga0496124_0011796_4675_5157 159
1401 3300048927 Ga0496124_0018876 Ga0496124_0018876_3108_3590 159
1402 3300048927 Ga0496124_0041605 Ga0496124_0041605_1664_2143 159
1403 3300048927 Ga0496124_0075360 Ga0496124_0075360_1216_1695 159
1404 3300048927 Ga0496124_0093958 Ga0496124_0093958_1546_2025 159
1405 3300048927 Ga0496124_0148303 Ga0496124_0148303_364_843 159
1406 3300048927 Ga0496124_0346016 Ga0496124_0346016_402_881 159
1407 3300048927 Ga0496124_0440027 Ga0496124_0440027_112_591 159
1408 3300048927 Ga0496124_0623126 Ga0496124_0623126_198_677 159
1409 3300048928 Ga0496125_0000001 Ga0496125_0000001_942847_943329 159
1410 3300048928 Ga0496125_0008983 Ga0496125_0008983_5363_5842 159
1411 3300048928 Ga0496125_0043867 Ga0496125_0043867_2842_3321 159
1412 3300048928 Ga0496125_0062733 Ga0496125_0062733_2029_2508 159
1413 3300048928 Ga0496125_0075403 Ga0496125_0075403_989_1468 159
1414 3300048928 Ga0496125_0106331 Ga0496125_0106331_496_975 159
1415 3300048928 Ga0496125_0468692 Ga0496125_0468692_38_520 159
1416 3300048929 Ga0496126_0000597 Ga0496126_0000597_3633_4112 159
1417 3300048929 Ga0496126_0013467 Ga0496126_0013467_4959_5438 159
1418 3300048929 Ga0496126_0040374 Ga0496126_0040374_292_774 159
1419 3300048929 Ga0496126_0054420 Ga0496126_0054420_1693_2172 159
1420 3300048929 Ga0496126_0071472 Ga0496126_0071472_1695_2174 159
1421 3300048929 Ga0496126_0338241 Ga0496126_0338241_493_975 159
1422 3300048929 Ga0496126_0390178 Ga0496126_0390178_632_1114 159
1423 3300048929 Ga0496126_0482486 Ga0496126_0482486_299_778 159
1424 3300048929 Ga0496126_1108052 Ga0496126_1108052_18_500 159
1425 3300049459 Ga0495678_045935 Ga0495678_045935_918_1397 159
1426 3300049460 Ga0495682_0124544 Ga0495682_0124544_349_828 159
1427 3300049568 Ga0501031_0014195 Ga0501031_0014195_23_502 159
1428 3300049569 Ga0501032_0033647 Ga0501032_0033647_2725_3204 159
1429 3300049569 Ga0501032_0260226 Ga0501032_0260226_304_783 159
1430 3300049569 Ga0501032_0409442 Ga0501032_0409442_38_517 159
1431 3300049570 Ga0501033_0047968 Ga0501033_0047968_2449_2928 159
1432 3300049570 Ga0501033_0327875 Ga0501033_0327875_213_692 159
1433 3300049571 Ga0501034_0097519 Ga0501034_0097519_1705_2184 159
1434 3300049571 Ga0501034_0106827 Ga0501034_0106827_1432_1911 159
1435 3300049572 Ga0501036_0436232 Ga0501036_0436232_184_663 159
1436 3300049573 Ga0501037_0046042 Ga0501037_0046042_1129_1608 159
1437 3300049574 Ga0501038_0129996 Ga0501038_0129996_257_736 159
1438 3300049574 Ga0501038_0287674 Ga0501038_0287674_574_1053 159
1439 3300049575 Ga0501039_0247721 Ga0501039_0247721_409_888 159
1440 3300049579 Ga0501043_0039452 Ga0501043_0039452_1016_1495 159
1441 3300049579 Ga0501043_0345825 Ga0501043_0345825_555_1034 159
1442 3300049580 Ga0501046_0148397 Ga0501046_0148397_1194_1673 159
1443 3300049580 Ga0501046_0381913 Ga0501046_0381913_125_604 159
1444 3300049581 Ga0501047_0496454 Ga0501047_0496454_365_844 159
1445 3300049744 Ga0501083_0035643 Ga0501083_0035643_797_1276 159
1446 3300049822 Ga0501035_0006482 Ga0501035_0006482_9714_10193 159
1447 3300049822 Ga0501035_0227840 Ga0501035_0227840_593_1072 159
1448 3300049823 Ga0501044_0035814 Ga0501044_0035814_2764_3243 159
1449 3300049823 Ga0501044_0697956 Ga0501044_0697956_306_785 159
1450 3300050490 nmdc:mga03n38_234574_c1 nmdc:mga03n38_234574_c1_386_907 159
1451 3300050491 nmdc:mga00v17_193335_c1 nmdc:mga00v17_193335_c1_649_1128 159
1452 3300050491 nmdc:mga00v17_33379_c2 nmdc:mga00v17_33379_c2_17_499 159
1453 3300050491 nmdc:mga00v17_5417_c1 nmdc:mga00v17_5417_c1_3233_3715 159
1454 3300050492 nmdc:mga0yw44_117174_c1 nmdc:mga0yw44_117174_c1_562_1044 159
1455 3300050493 nmdc:mga0k408_20784_c1 nmdc:mga0k408_20784_c1_395_874 159
1456 3300050493 nmdc:mga0k408_89606_c1 nmdc:mga0k408_89606_c1_354_836 159
1457 3300050494 nmdc:mga06z11_41558_c1 nmdc:mga06z11_41558_c1_650_1132 159
1458 3300050495 nmdc:mga04h51_138143_c1 nmdc:mga04h51_138143_c1_232_711 159
1459 3300050495 nmdc:mga04h51_177942_c1 nmdc:mga04h51_177942_c1_270_758 159
1460 3300050495 nmdc:mga04h51_71714_c1 nmdc:mga04h51_71714_c1_299_781 159
1461 3300050512 nmdc:mga0n895_565252_c1 nmdc:mga0n895_565252_c1_156_653 159
1462 3300050516 nmdc:mga0sz30_150_c1 nmdc:mga0sz30_150_c1_23737_24219 159
1463 3300050516 nmdc:mga0sz30_19706_c1 nmdc:mga0sz30_19706_c1_1920_2402 159
1464 3300050516 nmdc:mga0sz30_420735_c1 nmdc:mga0sz30_420735_c1_41_562 159
1465 3300053079 Ga0500610_0039413 Ga0500610_0039413_1720_2199 159
1466 3300053086 Ga0500578_0011601 Ga0500578_0011601_2385_2864 159
1467 3300053086 Ga0500578_0109402 Ga0500578_0109402_688_1167 159
1468 3300053093 Ga0500651_0310442 Ga0500651_0310442_127_606 159
1469 3300053107 Ga0500560_002535 Ga0500560_002535_74_559 159
1470 3300053109 Ga0500569_003271 Ga0500569_003271_60_539 159
1471 3300053109 Ga0500569_004191 Ga0500569_004191_2127_2606 159
1472 3300053111 Ga0500572_003895 Ga0500572_003895_1252_1734 159
1473 3300053122 Ga0500608_149561 Ga0500608_149561_519_998 159
1474 3300053134 Ga0500658_0004252 Ga0500658_0004252_2378_2857 159
1475 3300053134 Ga0500658_0026742 Ga0500658_0026742_682_1161 159
1476 3300053136 Ga0500559_0008093 Ga0500559_0008093_1926_2405 159
1477 3300053136 Ga0500559_0368439 Ga0500559_0368439_99_578 159
1478 3300053137 Ga0500561_0000159 Ga0500561_0000159_12098_12580 159
1479 3300053139 Ga0500568_0001135 Ga0500568_0001135_3169_3648 159
1480 3300053139 Ga0500568_0050984 Ga0500568_0050984_771_1250 159
1481 3300053140 Ga0500573_0009836 Ga0500573_0009836_283_768 159
1482 3300053140 Ga0500573_0361767 Ga0500573_0361767_138_623 159
1483 3300053151 Ga0500604_0043084 Ga0500604_0043084_72_551 159
1484 3300053153 Ga0500616_0004285 Ga0500616_0004285_3590_4069 159
1485 3300053153 Ga0500616_0012356 Ga0500616_0012356_3002_3481 159
1486 3300053156 Ga0500622_0000322 Ga0500622_0000322_11884_12363 159
1487 3300053156 Ga0500622_0000380 Ga0500622_0000380_2130_2609 159
1488 3300053157 Ga0500624_032942 Ga0500624_032942_268_753 159
1489 3300053158 Ga0500627_0190460 Ga0500627_0190460_232_711 159
1490 3300053161 Ga0500634_0001027 Ga0500634_0001027_445_930 159
1491 3300053161 Ga0500634_0032813 Ga0500634_0032813_66_551 159
1492 3300053177 Ga0500636_0004186 Ga0500636_0004186_6045_6530 159
1493 3300059508 Ga0587088_015076 Ga0587088_015076_39_518 159
1494 3300059510 Ga0587090_083836 Ga0587090_083836_122_601 159
1495 3300059511 Ga0587091_164049 Ga0587091_164049_45_524 159
1496 3300059643 Ga0587072_004663 Ga0587072_004663_109_591 159
1497 3300059643 Ga0587072_174754 Ga0587072_174754_40_519 159
1498 3300060346 Ga0587111_0123281 Ga0587111_0123281_122_601 159
1499 3300060353 Ga0501082_0327733 Ga0501082_0327733_286_765 159
1500 3300061719 Ga0466962_0204618 Ga0466962_0204618_303_782 159
1501 iso_pu_bacteria 2509276021 2509387774 159
1502 iso_pu_bacteria 2509276033 2509443133 159
1503 iso_pu_bacteria 2582581867 2585400184 159
1504 iso_pu_bacteria 2615840624 2616298200 159
1505 iso_pu_bacteria 2643221643 2644242829 159
1506 iso_pu_bacteria 2718217927 2719384797 159
1507 iso_pu_bacteria 2718218423 2721398517 159
1508 iso_pu_bacteria 2721755809 2724037330 159
1509 iso_pu_bacteria 2791355267 2793367792 159
1510 iso_pu_bacteria 2802429605 2805926631 159
1511 iso_pu_bacteria 8005275841 8005279515 159
1512 iso_pu_bacteria 8018127388 8018131275 159
1513 iso_pu_bacteria 8018176218 8018177308 159
1514 iso_pu_bacteria 8024501048 8024503306 159
1515 iso_pu_bacteria 8056375014 8056380673 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01668

SmpB

SmpB protein

40

184

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ob7-assembly1.cif.gz_B structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.9229 10 135
7ljp-assembly2.cif.gz_B structure of thermotoga maritima smpb 0.9221 11 133
2ob7-assembly1.cif.gz_C structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.9202 10 129
1p6v-assembly2.cif.gz_C crystal structure of the trna domain of transfer-messenger rna in complex with smpb 0.9127 10 135
2ob7-assembly1.cif.gz_B structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.9014 10 135
ID Description Score Start End Superfamily
af_P0A832_7_135_2.40.280.10 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9288 10 134 2.40.280.10
2czjC00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.9089 16 133 2.40.280.10
af_P0A832_7_135_2.40.280.10 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.8944 10 134 2.40.280.10
2czjC00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.8728 16 133 2.40.280.10
1j1hA00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.6786 13 133 2.40.280.10
ID Description Score Start End GO Terms
AF-A7L9H9-F1-model_v4 SmpB 0.9631 26 129 GO:0003723
GO:0005829
AF-A7L9H9-F1-model_v4 SmpB 0.9541 26 129 GO:0003723
GO:0005829
AF-A0A3C2C3N6-F1-model_v4 SsrA-binding protein 0.9495 10 124 GO:0003723
GO:0005829
AF-A0A660ZPQ7-F1-model_v4 SsrA-binding protein 0.9475 10 134 GO:0003723
GO:0005829
AF-A0A519KLB3-F1-model_v4 SsrA-binding protein SmpB 0.9465 5 129 GO:0003723
GO:0005829

Feature Viewer

pLDDT pTM Quality
86.05 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map