F494394

General Info

Members Datasets Scaffolds Average Seq Length
1498 513 1264 112

Family's Representative Sequence

Representative Sequence 3300046520|Ga0495637_0046259|Ga0495637_0046259_225_602
Length 125
Sequence MPNNKRRSPKEKPMSDLNTLRASLKSGNHAFADTLAFIAAGYDYQPQAFNNGGVENAAGQNEGSCKTLGLALLEGLSDEEALLAFGEHYRSVVATPEGSDHGNIRALIKHGMAGVKFTAQPLTRR

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
6 2511231004 Pseudomonas sp. GM102 Isolate Nodule
7 2511231006 Pseudomonas sp. GM17 Isolate Nodule
8 2511231007 Pseudomonas sp. GM18 Isolate Nodule
9 2511231008 Pseudomonas sp. GM21 Isolate Nodule
10 2511231010 Pseudomonas sp. GM25 Isolate Nodule
11 2511231011 Pseudomonas sp. GM30 Isolate Nodule
12 2511231012 Pseudomonas sp. GM33 Isolate Nodule
13 2511231014 Pseudomonas sp. GM48 Isolate Nodule
14 2511231015 Pseudomonas sp. GM49 Isolate Nodule
15 2511231016 Pseudomonas sp. GM50 Isolate Nodule
16 2511231017 Pseudomonas sp. GM55 Isolate Nodule
17 2511231018 Pseudomonas sp. GM60 Isolate Nodule
18 2511231019 Pseudomonas sp. GM67 Isolate Nodule
19 2511231020 Pseudomonas sp. GM74 Isolate Nodule
20 2511231021 Pseudomonas sp. GM78 Isolate Nodule
21 2511231022 Pseudomonas sp. GM79 Isolate Nodule
22 2511231023 Pseudomonas sp. GM80 Isolate Nodule
23 2511231031 Pseudomonas sp. GM16 Isolate Nodule
24 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
25 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
26 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
27 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
28 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
29 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
30 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
31 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
32 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
33 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
34 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
35 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
36 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
37 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
38 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
39 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
40 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
41 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
42 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
43 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
44 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
45 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
46 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
47 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
48 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
49 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
50 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
51 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
52 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
53 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
54 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
55 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
56 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
57 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
58 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
59 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
60 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
61 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
62 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
63 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
64 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
65 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
66 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
67 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
68 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
69 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
70 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
71 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
72 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
73 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
74 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
75 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
76 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
77 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
78 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
79 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
80 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
81 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
82 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
83 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
84 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
85 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
86 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
87 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
88 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
89 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
90 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
91 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
92 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
93 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
94 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
95 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
96 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
97 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
98 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
99 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
100 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
101 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
102 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
103 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
104 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
105 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
106 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
107 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
108 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
109 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
110 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
111 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
112 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
113 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
114 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
115 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
116 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
117 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
118 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
119 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
120 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
121 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
122 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
123 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
124 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
125 2773857670 Pseudomonas sp. 478 Isolate Unclassified
126 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
127 2773857673 Pseudomonas sp. 443 Isolate Unclassified
128 2784132063 Pseudomonas sp. 424 Isolate Unclassified
129 2784132072 Pseudomonas sp. 460 Isolate Unclassified
130 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
131 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
132 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
133 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
134 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
135 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
136 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
137 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
138 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
139 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
140 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
141 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
142 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
143 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
144 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
145 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
146 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
147 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
148 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
149 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
150 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
151 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
152 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
153 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
154 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
155 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
156 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
157 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
158 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
159 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
160 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
161 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
162 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
163 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
164 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
165 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
166 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
167 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
168 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
169 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
170 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
171 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
172 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
173 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
174 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
175 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
176 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
177 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
178 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
179 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
180 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
181 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
182 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
183 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
184 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
185 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
186 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
187 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
188 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
189 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
190 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
191 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
192 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
193 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
194 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
195 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
196 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
197 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
198 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
199 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
200 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
201 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
202 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
203 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
204 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
205 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
206 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
207 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
208 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
209 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
210 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
211 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
212 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
213 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
214 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
215 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
216 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
217 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
218 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
219 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
220 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
221 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
222 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
223 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
224 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
225 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
226 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
227 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
228 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
229 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
230 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
231 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
232 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
233 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
234 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
235 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
236 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
237 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
238 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
239 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
240 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
241 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
242 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
243 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
244 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
245 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
246 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
247 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
248 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
249 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
250 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
251 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
252 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
253 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
254 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
255 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
256 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
257 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
258 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
259 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
260 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
261 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
262 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
263 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
264 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
265 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
266 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
267 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
268 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
269 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
270 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
271 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
272 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
273 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
274 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
275 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
276 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
277 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
278 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
279 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
280 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
283 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
284 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
286 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
287 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
289 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
291 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
292 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
293 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
294 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
296 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
315 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
316 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
317 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
318 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
319 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
321 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
322 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
323 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
324 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
325 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
326 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
327 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
328 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
329 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
330 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
331 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
332 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
333 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
334 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
335 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
336 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
337 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
338 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
339 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
340 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
341 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
342 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
343 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
344 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
345 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
346 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
347 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
348 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
349 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
350 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
351 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
352 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
353 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
354 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
355 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
356 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
357 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
358 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
359 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
360 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
361 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
362 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
363 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
364 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
365 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
366 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
367 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
368 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
369 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
370 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
371 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
372 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
373 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
374 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
375 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
376 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
377 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
378 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
379 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
380 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
381 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
382 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
383 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
384 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
385 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
386 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
387 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
388 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
389 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
390 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
391 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
392 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
393 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
394 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
395 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
396 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
397 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
398 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
399 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
400 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
401 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
402 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
403 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
404 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
405 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
406 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
407 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
408 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
409 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
410 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
411 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
412 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
413 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
414 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
415 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
416 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
417 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
418 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
419 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
420 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
421 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
422 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
423 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
424 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
425 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
426 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
427 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
428 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
429 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
430 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
431 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
432 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
433 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
434 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
435 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
436 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
437 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
438 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
439 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
440 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
441 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
442 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
443 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
444 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
445 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
446 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
447 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
448 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
449 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
450 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
451 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
452 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
453 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
454 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
455 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
456 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
457 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
458 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
459 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
460 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
461 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
462 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
463 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
464 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
465 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
466 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
467 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
468 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
469 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
470 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
471 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
472 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
473 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
474 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
475 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
476 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
477 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
478 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
479 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
480 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
481 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
482 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
483 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
484 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
485 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
486 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
487 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
488 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
489 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
490 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
491 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
492 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
493 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
494 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
495 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
496 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
497 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
498 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
499 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
500 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
501 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
502 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
503 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
504 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
505 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
506 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
507 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
508 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
509 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
510 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
511 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
512 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
513 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.31
Metatranscriptomes 0.07
Isolates 15.62

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 5.07
Nodule 2
Rhizoplane 4.94
Rhizosphere 78.04
Stem 0
Stem Tuber 0
Unclassified 9.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_375 2124908027 Bacteria 2771
2 MRS2a_Contig_64 2124908027 Bacteria 41399
3 MRS2a_Contig_645 2124908027 Bacteria 2458
4 SwRhRL2b_contig_2334513 2162886007 Bacteria 997
5 SwRhRL2b_contig_2732885 2162886007 Bacteria 1038
6 JGI25162J39368_1000101 3300002737 Bacteria 94481
7 JGI25162J39368_1000340 3300002737 Bacteria 40502
8 JGI25154J39366_1001925 3300002738 Bacteria 6222
9 JGI25163J39215_1001292 3300002771 Bacteria 4455
10 JGI25163J39215_1007976 3300002771 Bacteria 582
11 JGI25163J39215_1008667 3300002771 Bacteria 544
12 JGI25164J39214_1000097 3300002772 Bacteria 87008
13 JGI25164J39214_1000249 3300002772 Bacteria 40502
14 JGI25165J46597_1000184 3300003214 Bacteria 94481
15 JGI25165J46597_1000459 3300003214 Bacteria 40502
16 Ga0006562J51391_1109558 3300003578 Bacteria 1030
17 Ga0055538_1000028 3300003751 Bacteria 215806
18 Ga0055539_1000037 3300003752 Bacteria 215806
19 Ga0055533_1000047 3300003756 Bacteria 215806
20 Ga0055532_1000065 3300003758 Bacteria 141003
21 Ga0055525_1000176 3300003759 Bacteria 79649
22 Ga0055535_1003531 3300003761 Bacteria 4362
23 Ga0055536_1000172 3300003781 Bacteria 54152
24 Ga0055536_1000304 3300003781 Bacteria 36931
25 Ga0055530_10000300 3300003791 Bacteria 44962
26 Ga0055530_10000403 3300003791 Bacteria 38788
27 Ga0055530_10001892 3300003791 Bacteria 14351
28 Ga0055540_1000359 3300003792 Bacteria 38788
29 Ga0055540_1000376 3300003792 Bacteria 37376
30 Ga0055540_1000804 3300003792 Bacteria 21223
31 Ga0055531_10000346 3300003794 Bacteria 45327
32 Ga0055531_10004491 3300003794 Bacteria 8472
33 Ga0055541_1000025 3300003841 Bacteria 215806
34 Ga0065714_10002230 3300005288 Bacteria 41722
35 Ga0065714_10003116 3300005288 Bacteria 8511
36 Ga0065714_10007472 3300005288 Bacteria 3065
37 Ga0065714_10009326 3300005288 Bacteria 5961
38 Ga0065714_10016556 3300005288 Bacteria 1385
39 Ga0065714_10019691 3300005288 Bacteria 1961
40 Ga0065714_10045194 3300005288 Bacteria 732
41 Ga0065714_10066201 3300005288 Bacteria 7369
42 Ga0065714_10086184 3300005288 Bacteria 2103
43 Ga0065714_10101026 3300005288 Bacteria 1650
44 Ga0065714_10102128 3300005288 Bacteria 1623
45 Ga0065714_10105471 3300005288 Bacteria 1562
46 Ga0065714_10127095 3300005288 Bacteria 1275
47 Ga0065714_10323357 3300005288 Bacteria 666
48 Ga0065704_10084734 3300005289 Bacteria 3291
49 Ga0065704_10192074 3300005289 Bacteria 1182
50 Ga0065704_10265448 3300005289 Bacteria 942
51 Ga0065704_10473984 3300005289 Bacteria 684
52 Ga0065704_10488205 3300005289 Bacteria 676
53 Ga0065704_10496400 3300005289 Bacteria 670
54 Ga0065712_10067858 3300005290 Bacteria 25175
55 Ga0065712_10317748 3300005290 Bacteria 815
56 Ga0065715_10007881 3300005293 Bacteria 2578
57 Ga0070676_10109649 3300005328 Bacteria 1717
58 Ga0070670_100000553 3300005331 Bacteria 29721
59 Ga0070661_100000056 3300005344 Bacteria 87789
60 Ga0070669_100000850 3300005353 Bacteria 22164
61 Ga0070669_100000901 3300005353 Bacteria 21633
62 Ga0070671_100959924 3300005355 Bacteria 748
63 Ga0070667_101368219 3300005367 Bacteria 664
64 Ga0070662_100000828 3300005457 Bacteria 19049
65 Ga0070662_100064564 3300005457 Bacteria 2681
66 Ga0070662_100817395 3300005457 Bacteria 793
67 Ga0070684_101944719 3300005535 Bacteria 555
68 Ga0070665_100047133 3300005548 Bacteria 4326
69 Ga0070665_100058500 3300005548 Bacteria 3864
70 Ga0070665_101590496 3300005548 Bacteria 662
71 Ga0070664_100000332 3300005564 Bacteria 34336
72 Ga0070664_100069440 3300005564 Bacteria 3015
73 Ga0068854_100003050 3300005578 Bacteria 10416
74 Ga0068851_10000032 3300005834 Bacteria 108531
75 Ga0075364_10015210 3300006051 Bacteria 4767
76 Ga0075364_10044770 3300006051 Bacteria 2879
77 Ga0075364_10324372 3300006051 Bacteria 1049
78 Ga0075364_10329171 3300006051 Bacteria 1040
79 Ga0075364_10543251 3300006051 Bacteria 794
80 Ga0075364_10558476 3300006051 Bacteria 782
81 Ga0075432_10003081 3300006058 Bacteria 5622
82 Ga0075432_10006882 3300006058 Bacteria 3873
83 Ga0075432_10080664 3300006058 Bacteria 1179
84 Ga0075432_10080986 3300006058 Bacteria 1177
85 Ga0075432_10356036 3300006058 Bacteria 621
86 Ga0075432_10358811 3300006058 Bacteria 619
87 Ga0075362_10096371 3300006177 Bacteria 1378
88 Ga0075362_10128112 3300006177 Bacteria 1205
89 Ga0075369_10068611 3300006186 Bacteria 1558
90 Ga0075370_10746931 3300006353 Bacteria 596
91 Ga0075436_100218400 3300006914 Bacteria 1352
92 Ga0075436_101070468 3300006914 Bacteria 606
93 Ga0079104_1000259 3300006946 Bacteria 70490
94 Ga0079104_1000332 3300006946 Bacteria 57787
95 Ga0079104_1005361 3300006946 Bacteria 5145
96 Ga0079104_1028715 3300006946 Bacteria 1410
97 Ga0079104_1055335 3300006946 Bacteria 870
98 Ga0099826_10022026 3300006948 Bacteria 4767
99 Ga0105251_10000012 3300009011 Bacteria 167614
100 Ga0105251_10000023 3300009011 Bacteria 133648
101 Ga0105251_10000421 3300009011 Bacteria 41190
102 Ga0105251_10001064 3300009011 Bacteria 24038
103 Ga0105251_10004783 3300009011 Bacteria 9062
104 Ga0105251_10005326 3300009011 Bacteria 8455
105 Ga0105251_10005631 3300009011 Bacteria 8138
106 Ga0105251_10045330 3300009011 Bacteria 2120
107 Ga0105251_10054519 3300009011 Bacteria 1899
108 Ga0105251_10098581 3300009011 Bacteria 1337
109 Ga0105251_10174683 3300009011 Bacteria 968
110 Ga0105251_10338456 3300009011 Bacteria 685
111 Ga0105244_10007748 3300009036 Bacteria 6796
112 Ga0105244_10010899 3300009036 Bacteria 5482
113 Ga0105244_10015058 3300009036 Bacteria 4447
114 Ga0105244_10015138 3300009036 Bacteria 4434
115 Ga0105244_10035142 3300009036 Bacteria 2634
116 Ga0105244_10071164 3300009036 Bacteria 1734
117 Ga0105244_10101422 3300009036 Bacteria 1407
118 Ga0105244_10126824 3300009036 Bacteria 1233
119 Ga0105244_10155536 3300009036 Bacteria 1094
120 Ga0105244_10171780 3300009036 Bacteria 1031
121 Ga0105244_10171842 3300009036 Bacteria 1031
122 Ga0105244_10193851 3300009036 Bacteria 960
123 Ga0105244_10201216 3300009036 Bacteria 939
124 Ga0105244_10268640 3300009036 Bacteria 792
125 Ga0105244_10363162 3300009036 Bacteria 667
126 Ga0105244_10384132 3300009036 Bacteria 646
127 Ga0105244_10405845 3300009036 Bacteria 627
128 Ga0105244_10536737 3300009036 Bacteria 539
129 Ga0105250_10000366 3300009092 Bacteria 33900
130 Ga0105250_10000494 3300009092 Bacteria 27715
131 Ga0105250_10000567 3300009092 Bacteria 24604
132 Ga0105250_10005062 3300009092 Bacteria 5960
133 Ga0105250_10021477 3300009092 Bacteria 2605
134 Ga0105250_10036837 3300009092 Bacteria 1963
135 Ga0105250_10048060 3300009092 Bacteria 1711
136 Ga0105250_10075508 3300009092 Bacteria 1363
137 Ga0105243_10000136 3300009148 Bacteria 84363
138 Ga0105243_10000821 3300009148 Bacteria 29660
139 Ga0105243_10005639 3300009148 Bacteria 9745
140 Ga0105243_10141922 3300009148 Bacteria 2050
141 Ga0105243_10457832 3300009148 Bacteria 1199
142 Ga0105242_10005336 3300009176 Bacteria 9933
143 Ga0105242_10087991 3300009176 Bacteria 2608
144 Ga0105248_10076617 3300009177 Bacteria 3759
145 Ga0105237_10001335 3300009545 Bacteria 32719
146 Ga0105237_10653049 3300009545 Bacteria 1058
147 Ga0105249_10034194 3300009553 Bacteria 4604
148 Ga0105239_11222763 3300010375 Bacteria 866
149 Ga0105246_10000928 3300011119 Bacteria 16760
150 Ga0105246_10003502 3300011119 Bacteria 9503
151 Ga0105246_10005437 3300011119 Bacteria 7760
152 Ga0105246_10041202 3300011119 Bacteria 3120
153 Ga0105246_10367519 3300011119 Bacteria 1184
154 Ga0105246_11881466 3300011119 Bacteria 574
155 Ga0105246_12521438 3300011119 Bacteria 506
156 Ga0157337_1005319 3300012483 Bacteria 854
157 Ga0157345_1000089 3300012498 Bacteria 19348
158 Ga0157347_1004780 3300012502 Bacteria 1272
159 Ga0157373_10000627 3300013100 Bacteria 27691
160 Ga0157373_10074164 3300013100 Bacteria 2400
161 Ga0157373_10101055 3300013100 Bacteria 2029
162 Ga0157373_10122230 3300013100 Bacteria 1830
163 Ga0157373_10152943 3300013100 Bacteria 1623
164 Ga0157373_10155145 3300013100 Bacteria 1611
165 Ga0157373_10177562 3300013100 Bacteria 1499
166 Ga0157373_10326211 3300013100 Bacteria 1093
167 Ga0157373_10367551 3300013100 Bacteria 1028
168 Ga0157371_10000227 3300013102 Bacteria 81890
169 Ga0157371_10000278 3300013102 Bacteria 69168
170 Ga0157371_10001992 3300013102 Bacteria 20223
171 Ga0157371_10002027 3300013102 Bacteria 20002
172 Ga0157371_10233818 3300013102 Bacteria 1321
173 Ga0157371_10269450 3300013102 Bacteria 1229
174 Ga0157371_11226318 3300013102 Bacteria 579
175 Ga0157370_10044973 3300013104 Bacteria 4240
176 Ga0157370_10157289 3300013104 Bacteria 2114
177 Ga0157370_10170726 3300013104 Bacteria 2022
178 Ga0157370_10291896 3300013104 Bacteria 1506
179 Ga0157370_10301531 3300013104 Bacteria 1479
180 Ga0157370_10341809 3300013104 Bacteria 1379
181 Ga0157370_10640221 3300013104 Bacteria 972
182 Ga0157370_10860737 3300013104 Bacteria 823
183 Ga0157370_11408882 3300013104 Bacteria 627
184 Ga0157369_10005304 3300013105 Bacteria 15024
185 Ga0157369_10005555 3300013105 Bacteria 14644
186 Ga0157369_10014083 3300013105 Bacteria 9037
187 Ga0157369_10070212 3300013105 Bacteria 3763
188 Ga0157369_10191307 3300013105 Bacteria 2150
189 Ga0157369_10366580 3300013105 Bacteria 1495
190 Ga0163162_10006260 3300013306 Bacteria 11534
191 Ga0163162_10025982 3300013306 Bacteria 5787
192 Ga0163162_10369315 3300013306 Bacteria 1568
193 Ga0163162_11902043 3300013306 Bacteria 681
194 Ga0157372_10022880 3300013307 Bacteria 6768
195 Ga0157372_11123987 3300013307 Bacteria 909
196 Ga0157375_10001083 3300013308 Bacteria 23636
197 Ga0157375_10273285 3300013308 Bacteria 1852
198 Ga0157375_10281417 3300013308 Bacteria 1826
199 Ga0157375_10986472 3300013308 Bacteria 983
200 Ga0182008_10000305 3300014497 Bacteria 38494
201 Ga0182008_10002373 3300014497 Bacteria 11852
202 Ga0182008_10003708 3300014497 Bacteria 9110
203 Ga0182008_10012970 3300014497 Bacteria 4386
204 Ga0182008_10020816 3300014497 Bacteria 3374
205 Ga0182008_10078160 3300014497 Bacteria 1628
206 Ga0182008_10083288 3300014497 Bacteria 1575
207 Ga0182008_10214141 3300014497 Bacteria 984
208 Ga0182008_10471333 3300014497 Bacteria 686
209 Ga0182008_10907932 3300014497 Bacteria 519
210 Ga0182006_1000667 3300015261 Bacteria 24099
211 Ga0182006_1007434 3300015261 Bacteria 5012
212 Ga0182006_1008825 3300015261 Bacteria 4554
213 Ga0182006_1031205 3300015261 Bacteria 2149
214 Ga0182006_1088175 3300015261 Bacteria 1120
215 Ga0182006_1178246 3300015261 Bacteria 709
216 Ga0182006_1180544 3300015261 Bacteria 704
217 Ga0182006_1180546 3300015261 Bacteria 704
218 Ga0182006_1308035 3300015261 Bacteria 520
219 Ga0182007_10000462 3300015262 Bacteria 24569
220 Ga0182007_10046924 3300015262 Bacteria 1429
221 Ga0182007_10080615 3300015262 Bacteria 1067
222 Ga0182005_1001060 3300015265 Bacteria 11631
223 Ga0182005_1001702 3300015265 Bacteria 8510
224 Ga0182005_1005551 3300015265 Bacteria 3932
225 Ga0182005_1006496 3300015265 Bacteria 3566
226 Ga0182005_1095910 3300015265 Bacteria 828
227 Ga0182005_1100184 3300015265 Bacteria 811
228 Ga0182005_1137146 3300015265 Bacteria 705
229 Ga0163161_10040179 3300017792 Bacteria 3360
230 Ga0163161_10099695 3300017792 Bacteria 2160
231 Ga0163161_10112792 3300017792 Bacteria 2034
232 Ga0163161_10189551 3300017792 Bacteria 1580
233 Ga0163161_10209371 3300017792 Bacteria 1506
234 Ga0163161_10231181 3300017792 Bacteria 1435
235 Ga0163161_10275396 3300017792 Bacteria 1318
236 Ga0163161_10315422 3300017792 Bacteria 1234
237 Ga0163161_10345438 3300017792 Bacteria 1181
238 Ga0163161_10508162 3300017792 Bacteria 982
239 Ga0163161_10625752 3300017792 Bacteria 890
240 Ga0163161_11134202 3300017792 Bacteria 673
241 Ga0163161_11136475 3300017792 Bacteria 673
242 Ga0209435_104127 3300025206 Bacteria 1646
243 Ga0209760_100003 3300025207 Bacteria 257011
244 Ga0209760_100198 3300025207 Bacteria 28964
245 Ga0209784_100032 3300025224 Bacteria 314079
246 Ga0209566_100036 3300025225 Bacteria 314079
247 Ga0209674_100054 3300025226 Bacteria 314079
248 Ga0209147_100055 3300025229 Bacteria 262412
249 Ga0209563_100055 3300025230 Bacteria 314079
250 Ga0209563_101310 3300025230 Bacteria 6793
251 Ga0207427_100001 3300025231 Bacteria 1410763
252 Ga0207427_100004 3300025231 Bacteria 939600
253 Ga0209437_100003 3300025233 Bacteria 1517827
254 Ga0209437_100028 3300025233 Bacteria 540136
255 Ga0209437_110663 3300025233 Bacteria 1398
256 Ga0209258_100239 3300025242 Bacteria 101232
257 Ga0209646_1000206 3300025246 Bacteria 67844
258 Ga0209677_100033 3300025253 Bacteria 314079
259 Ga0209759_1004897 3300025256 Bacteria 4848
260 Ga0209233_1000007 3300025261 Bacteria 1411234
261 Ga0209233_1000008 3300025261 Bacteria 1356712
262 Ga0209675_1005466 3300025291 Bacteria 5313
263 Ga0209676_1000056 3300025292 Bacteria 361329
264 Ga0209676_1000078 3300025292 Bacteria 296293
265 Ga0209676_1000101 3300025292 Bacteria 227976
266 Ga0209676_1017914 3300025292 Bacteria 2487
267 Ga0209676_1025578 3300025292 Bacteria 1891
268 Ga0209676_1037940 3300025292 Bacteria 1384
269 Ga0209050_1000027 3300025298 Bacteria 483261
270 Ga0209050_1000041 3300025298 Bacteria 408004
271 Ga0209050_1000181 3300025298 Bacteria 142533
272 Ga0209050_1000560 3300025298 Bacteria 60894
273 Ga0209051_1000061 3300025303 Bacteria 253485
274 Ga0209051_1000085 3300025303 Bacteria 189973
275 Ga0209051_1000102 3300025303 Bacteria 162911
276 Ga0209257_1000105 3300025304 Bacteria 243729
277 Ga0209257_1005839 3300025304 Bacteria 8347
278 Ga0209257_1054801 3300025304 Bacteria 1108
279 Ga0207656_10000031 3300025321 Bacteria 68168
280 Ga0207696_1000032 3300025711 Bacteria 380071
281 Ga0207696_1000138 3300025711 Bacteria 127572
282 Ga0207696_1000220 3300025711 Bacteria 82790
283 Ga0207696_1013055 3300025711 Bacteria 2913
284 Ga0207696_1015991 3300025711 Bacteria 2524
285 Ga0207696_1018171 3300025711 Bacteria 2313
286 Ga0207696_1020710 3300025711 Bacteria 2115
287 Ga0207696_1020847 3300025711 Bacteria 2106
288 Ga0207696_1024229 3300025711 Bacteria 1905
289 Ga0207655_1000021 3300025728 Bacteria 518596
290 Ga0207655_1000257 3300025728 Bacteria 84213
291 Ga0207655_1001173 3300025728 Bacteria 25437
292 Ga0207655_1001258 3300025728 Bacteria 24186
293 Ga0207655_1002577 3300025728 Bacteria 14463
294 Ga0207655_1003032 3300025728 Bacteria 12823
295 Ga0207655_1003182 3300025728 Bacteria 12383
296 Ga0207655_1003932 3300025728 Bacteria 10773
297 Ga0207655_1007026 3300025728 Bacteria 7371
298 Ga0207655_1007453 3300025728 Bacteria 7095
299 Ga0207655_1019351 3300025728 Bacteria 3562
300 Ga0207655_1023307 3300025728 Bacteria 3075
301 Ga0207655_1025504 3300025728 Bacteria 2867
302 Ga0207655_1027034 3300025728 Bacteria 2742
303 Ga0207655_1040084 3300025728 Bacteria 2027
304 Ga0207655_1046627 3300025728 Bacteria 1797
305 Ga0207655_1060684 3300025728 Bacteria 1465
306 Ga0207655_1066750 3300025728 Bacteria 1358
307 Ga0207655_1227583 3300025728 Bacteria 540
308 Ga0207713_1000078 3300025735 Bacteria 175087
309 Ga0207713_1000080 3300025735 Bacteria 168403
310 Ga0207713_1000791 3300025735 Bacteria 29309
311 Ga0207713_1001157 3300025735 Bacteria 22282
312 Ga0207713_1001332 3300025735 Bacteria 20241
313 Ga0207713_1001521 3300025735 Bacteria 18287
314 Ga0207713_1001765 3300025735 Bacteria 16576
315 Ga0207713_1005019 3300025735 Bacteria 8425
316 Ga0207713_1008570 3300025735 Bacteria 5868
317 Ga0207713_1015520 3300025735 Bacteria 3904
318 Ga0207713_1023295 3300025735 Bacteria 2917
319 Ga0207713_1084689 3300025735 Bacteria 1131
320 Ga0207713_1095753 3300025735 Bacteria 1034
321 Ga0207713_1097646 3300025735 Bacteria 1020
322 Ga0207713_1136833 3300025735 Bacteria 804
323 Ga0207645_10196546 3300025907 Bacteria 1326
324 Ga0207671_10000034 3300025914 Bacteria 245048
325 Ga0207671_10482328 3300025914 Bacteria 988
326 Ga0207649_10000006 3300025920 Bacteria 349180
327 Ga0207681_10000095 3300025923 Bacteria 75012
328 Ga0207681_10000343 3300025923 Bacteria 33453
329 Ga0207650_10000472 3300025925 Bacteria 33733
330 Ga0207644_10682530 3300025931 Bacteria 856
331 Ga0207706_10000839 3300025933 Bacteria 31743
332 Ga0207706_10006334 3300025933 Bacteria 10992
333 Ga0207706_10653520 3300025933 Bacteria 900
334 Ga0207686_10000628 3300025934 Bacteria 21910
335 Ga0207709_10000067 3300025935 Bacteria 189188
336 Ga0207709_10001847 3300025935 Bacteria 14105
337 Ga0207709_10562874 3300025935 Bacteria 898
338 Ga0207711_10051287 3300025941 Bacteria 3533
339 Ga0207679_10000010 3300025945 Bacteria 349180
340 Ga0207679_10036552 3300025945 Bacteria 3484
341 Ga0207712_10027077 3300025961 Bacteria 3825
342 Ga0207640_10709441 3300025981 Bacteria 863
343 Ga0209281_1000013 3300027111 Bacteria 653449
344 Ga0209281_1000015 3300027111 Bacteria 590084
345 Ga0209281_1002154 3300027111 Bacteria 8638
346 Ga0209281_1012079 3300027111 Bacteria 1910
347 Ga0209281_1067716 3300027111 Bacteria 529
348 Ga0209371_1054876 3300027312 Bacteria 751
349 Ga0210002_1030864 3300027617 Bacteria 891
350 Ga0209974_10120420 3300027876 Bacteria 929
351 Ga0207428_10013466 3300027907 Bacteria 7146
352 Ga0207428_10045496 3300027907 Bacteria 3535
353 Ga0207428_10060355 3300027907 Bacteria 3005
354 Ga0207428_10060822 3300027907 Bacteria 2992
355 Ga0207428_10072910 3300027907 Bacteria 2694
356 Ga0207428_10115847 3300027907 Bacteria 2059
357 Ga0207428_10214376 3300027907 Bacteria 1446
358 Ga0207428_10252144 3300027907 Bacteria 1316
359 Ga0207428_10259865 3300027907 Bacteria 1293
360 Ga0207428_11310626 3300027907 Bacteria 502
361 Ga0268266_10017099 3300028379 Bacteria 6193
362 Ga0268266_10074015 3300028379 Bacteria 2957
363 Ga0268266_11123075 3300028379 Bacteria 760
364 Ga0307517_10267002 3300028786 Bacteria 988
365 Ga0307515_10675740 3300028794 Bacteria 647
366 Ga0268256_1061581 3300030500 Bacteria 751
367 Ga0307511_10015382 3300030521 Bacteria 7412
368 Ga0307511_10203545 3300030521 Bacteria 1023
369 Ga0307511_10374045 3300030521 Bacteria 599
370 Ga0316177_1148087 3300030731 Bacteria 1872
371 Ga0316179_1041814 3300030734 Bacteria 1920
372 Ga0316178_1023745 3300030735 Bacteria 38907
373 Ga0316183_1146492 3300030742 Bacteria 1342
374 Ga0316181_1098331 3300030744 Bacteria 7761
375 Ga0265316_10224998 3300031344 Bacteria 1383
376 Ga0307408_100000409 3300031548 Bacteria 38667
377 Ga0307408_100097276 3300031548 Bacteria 2235
378 Ga0307408_100127692 3300031548 Bacteria 1979
379 Ga0307408_100144911 3300031548 Bacteria 1868
380 Ga0307408_100230544 3300031548 Bacteria 1516
381 Ga0307408_100438334 3300031548 Bacteria 1130
382 Ga0307516_10226628 3300031730 Bacteria 1575
383 Ga0307516_10345090 3300031730 Bacteria 1155
384 Ga0307405_10000167 3300031731 Bacteria 24308
385 Ga0307405_10029583 3300031731 Bacteria 3203
386 Ga0307405_10061714 3300031731 Bacteria 2370
387 Ga0307405_10168002 3300031731 Bacteria 1561
388 Ga0307405_10260772 3300031731 Bacteria 1294
389 Ga0307405_10316329 3300031731 Bacteria 1190
390 Ga0307413_10082890 3300031824 Bacteria 2061
391 Ga0307413_10120977 3300031824 Bacteria 1773
392 Ga0307413_10187132 3300031824 Bacteria 1483
393 Ga0307410_11379774 3300031852 Bacteria 618
394 Ga0307406_10028388 3300031901 Bacteria 3380
395 Ga0307406_11409890 3300031901 Bacteria 611
396 Ga0307407_10021391 3300031903 Bacteria 3334
397 Ga0307407_10473370 3300031903 Bacteria 913
398 Ga0307412_10001543 3300031911 Bacteria 12735
399 Ga0307412_10002237 3300031911 Bacteria 10729
400 Ga0307412_10158067 3300031911 Bacteria 1680
401 Ga0307412_10176452 3300031911 Bacteria 1602
402 Ga0307412_10180181 3300031911 Bacteria 1588
403 Ga0307412_10400982 3300031911 Bacteria 1116
404 Ga0307412_10453089 3300031911 Bacteria 1057
405 Ga0307412_11105709 3300031911 Bacteria 705
406 Ga0307409_100013576 3300031995 Bacteria 5251
407 Ga0307409_100061063 3300031995 Bacteria 2943
408 Ga0307416_100149529 3300032002 Bacteria 2139
409 Ga0307416_101533133 3300032002 Bacteria 772
410 Ga0307416_102946916 3300032002 Bacteria 569
411 Ga0307414_10011732 3300032004 Bacteria 5153
412 Ga0307414_10041752 3300032004 Bacteria 3110
413 Ga0307414_10109734 3300032004 Bacteria 2097
414 Ga0307414_10123935 3300032004 Bacteria 1992
415 Ga0307414_10352612 3300032004 Bacteria 1263
416 Ga0307414_10988334 3300032004 Bacteria 774
417 Ga0307414_11040742 3300032004 Bacteria 754
418 Ga0307411_10027670 3300032005 Bacteria 3434
419 Ga0307411_10266351 3300032005 Bacteria 1356
420 Ga0307411_10953101 3300032005 Bacteria 765
421 Ga0307411_11150730 3300032005 Bacteria 701
422 Ga0307510_10000622 3300033180 Bacteria 35905
423 Ga0307510_10400910 3300033180 Bacteria 815
424 Ga0237819_13930 3300038705 Bacteria 957
425 Ga0439436_0002599 3300041404 Bacteria 5433
426 Ga0439438_001568 3300041405 Bacteria 10045
427 Ga0439438_002168 3300041405 Bacteria 8465
428 Ga0439438_003359 3300041405 Bacteria 6483
429 Ga0439438_003862 3300041405 Bacteria 5912
430 Ga0439438_006293 3300041405 Bacteria 4214
431 Ga0439438_009242 3300041405 Bacteria 3203
432 Ga0439438_009256 3300041405 Bacteria 3199
433 Ga0439438_010511 3300041405 Bacteria 2923
434 Ga0439438_012437 3300041405 Bacteria 2609
435 Ga0439438_017805 3300041405 Bacteria 2035
436 Ga0439447_000159 3300041407 Bacteria 23077
437 Ga0439447_002444 3300041407 Bacteria 6774
438 Ga0439447_002454 3300041407 Bacteria 6747
439 Ga0439447_002516 3300041407 Bacteria 6665
440 Ga0439447_002897 3300041407 Bacteria 6142
441 Ga0439447_008814 3300041407 Bacteria 3100
442 Ga0439447_009042 3300041407 Bacteria 3043
443 Ga0439447_022547 3300041407 Bacteria 1647
444 Ga0439447_023808 3300041407 Bacteria 1591
445 Ga0439447_041372 3300041407 Bacteria 1121
446 Ga0439447_041498 3300041407 Bacteria 1120
447 Ga0439447_059409 3300041407 Bacteria 901
448 Ga0439466_0000261 3300041411 Bacteria 20544
449 Ga0439466_0000898 3300041411 Bacteria 11342
450 Ga0439466_0001557 3300041411 Bacteria 8969
451 Ga0439466_0003475 3300041411 Bacteria 6106
452 Ga0439466_0004614 3300041411 Bacteria 5292
453 Ga0439466_0016184 3300041411 Bacteria 2699
454 Ga0439466_0024682 3300041411 Bacteria 2104
455 Ga0439466_0026643 3300041411 Bacteria 2007
456 Ga0439466_0044803 3300041411 Bacteria 1464
457 Ga0439466_0056722 3300041411 Bacteria 1270
458 Ga0439466_0107518 3300041411 Bacteria 866
459 Ga0439465_0032062 3300041413 Bacteria 1676
460 Ga0451837_0241277 3300041494 Bacteria 1465
461 Ga0451837_1405162 3300041494 Bacteria 523
462 Ga0451841_1463478 3300041498 Bacteria 530
463 Ga0439431_0032289 3300041997 Bacteria 1304
464 Ga0439431_0105426 3300041997 Bacteria 777
465 Ga0439445_0040012 3300042004 Bacteria 1244
466 Ga0439445_0278635 3300042004 Bacteria 502
467 Ga0439432_000956 3300042006 Bacteria 10911
468 Ga0439432_001905 3300042006 Bacteria 7869
469 Ga0439432_001918 3300042006 Bacteria 7853
470 Ga0439432_002283 3300042006 Bacteria 7224
471 Ga0439432_005740 3300042006 Bacteria 4459
472 Ga0439432_008751 3300042006 Bacteria 3545
473 Ga0439432_010291 3300042006 Bacteria 3244
474 Ga0439432_020136 3300042006 Bacteria 2219
475 Ga0439432_020756 3300042006 Bacteria 2180
476 Ga0439451_000925 3300042009 Bacteria 5649
477 Ga0439451_006434 3300042009 Bacteria 2402
478 Ga0439451_009564 3300042009 Bacteria 1961
479 Ga0439451_009805 3300042009 Bacteria 1933
480 Ga0439451_035017 3300042009 Bacteria 1009
481 Ga0439451_087952 3300042009 Bacteria 625
482 Ga0439452_000100 3300042010 Bacteria 72176
483 Ga0439452_000252 3300042010 Bacteria 36729
484 Ga0439452_000783 3300042010 Bacteria 15098
485 Ga0439452_001211 3300042010 Bacteria 11038
486 Ga0439452_003769 3300042010 Bacteria 5216
487 Ga0439452_004463 3300042010 Bacteria 4688
488 Ga0439452_007300 3300042010 Bacteria 3392
489 Ga0439452_010545 3300042010 Bacteria 2683
490 Ga0439452_046394 3300042010 Bacteria 1008
491 Ga0439456_000042 3300042013 Bacteria 46567
492 Ga0439456_001460 3300042013 Bacteria 4756
493 Ga0439456_026955 3300042013 Bacteria 1223
494 Ga0439456_039117 3300042013 Bacteria 1026
495 Ga0439463_000091 3300042016 Bacteria 21082
496 Ga0439463_017565 3300042016 Bacteria 1774
497 Ga0439463_063176 3300042016 Bacteria 946
498 Ga0439463_154274 3300042016 Bacteria 595
499 Ga0450911_000062 3300042115 Bacteria 43944
500 Ga0450911_002121 3300042115 Bacteria 4052
501 Ga0450911_003178 3300042115 Bacteria 2964
502 Ga0450919_002519 3300042121 Bacteria 2375
503 Ga0450919_012153 3300042121 Bacteria 976
504 Ga0450920_005318 3300042122 Bacteria 2283
505 Ga0450920_037932 3300042122 Bacteria 958
506 Ga0450922_000048 3300042124 Bacteria 10642
507 Ga0450922_007411 3300042124 Bacteria 1029
508 Ga0450923_001498 3300042125 Bacteria 3116
509 Ga0450923_117871 3300042125 Bacteria 624
510 Ga0450890_002451 3300042127 Bacteria 2554
511 Ga0450891_036773 3300042129 Bacteria 519
512 Ga0450896_073462 3300042133 Bacteria 569
513 Ga0450898_072843 3300042134 Bacteria 690
514 Ga0450902_013345 3300042137 Bacteria 1323
515 Ga0450903_001627 3300042138 Bacteria 4174
516 Ga0450903_002515 3300042138 Bacteria 3255
517 Ga0450903_015292 3300042138 Bacteria 1209
518 Ga0450904_001667 3300042139 Bacteria 2979
519 Ga0450904_009047 3300042139 Bacteria 982
520 Ga0450905_000027 3300042142 Bacteria 12030
521 Ga0450905_000950 3300042142 Bacteria 3634
522 Ga0450905_028629 3300042142 Bacteria 851
523 Ga0450905_051838 3300042142 Bacteria 671
524 Ga0450905_076634 3300042142 Bacteria 576
525 Ga0450906_000148 3300042145 Bacteria 12883
526 Ga0450906_000910 3300042145 Bacteria 6456
527 Ga0450906_001325 3300042145 Bacteria 5425
528 Ga0450906_010049 3300042145 Bacteria 1794
529 Ga0450907_000126 3300042146 Bacteria 28680
530 Ga0450907_001109 3300042146 Bacteria 6160
531 Ga0450907_001601 3300042146 Bacteria 4778
532 Ga0450910_000109 3300042147 Bacteria 8633
533 Ga0450910_013878 3300042147 Bacteria 1175
534 Ga0439446_0001959 3300042156 Bacteria 4857
535 Ga0439446_0008147 3300042156 Bacteria 2774
536 Ga0439446_0018855 3300042156 Bacteria 1937
537 Ga0450908_005028 3300042184 Bacteria 2537
538 Ga0450909_000619 3300042185 Bacteria 4706
539 Ga0450909_007390 3300042185 Bacteria 1590
540 Ga0450909_007870 3300042185 Bacteria 1545
541 Ga0450909_081655 3300042185 Bacteria 524
542 Ga0439434_0000110 3300042435 Bacteria 21329
543 Ga0439434_0000167 3300042435 Bacteria 17819
544 Ga0439460_0000354 3300042461 Bacteria 9662
545 Ga0439460_0001696 3300042461 Bacteria 5220
546 Ga0439460_0001746 3300042461 Bacteria 5163
547 Ga0450893_0004706 3300042532 Bacteria 2177
548 Ga0451577_0344748 3300042876 Bacteria 1351
549 Ga0439440_0006966 3300042993 Bacteria 2288
550 Ga0439440_0016414 3300042993 Bacteria 1620
551 Ga0495617_000922 3300046452 Bacteria 13672
552 Ga0495617_001045 3300046452 Bacteria 12663
553 Ga0495617_011843 3300046452 Bacteria 2974
554 Ga0495617_024613 3300046452 Bacteria 2031
555 Ga0495617_027961 3300046452 Bacteria 1896
556 Ga0495617_037859 3300046452 Bacteria 1614
557 Ga0495617_051930 3300046452 Bacteria 1362
558 Ga0495617_055242 3300046452 Bacteria 1317
559 Ga0495617_202974 3300046452 Bacteria 619
560 Ga0495627_000215 3300046453 Bacteria 62761
561 Ga0495627_000689 3300046453 Bacteria 25791
562 Ga0495627_003044 3300046453 Bacteria 7655
563 Ga0495627_011987 3300046453 Bacteria 3089
564 Ga0495627_023262 3300046453 Bacteria 2031
565 Ga0495627_058342 3300046453 Bacteria 1146
566 Ga0495627_082421 3300046453 Bacteria 931
567 Ga0495627_107420 3300046453 Bacteria 793
568 Ga0495592_0073545 3300046454 Bacteria 2485
569 Ga0495603_0001509 3300046455 Bacteria 13567
570 Ga0495603_0033530 3300046455 Bacteria 3089
571 Ga0495603_0046701 3300046455 Bacteria 2580
572 Ga0495603_0521425 3300046455 Bacteria 680
573 Ga0495590_0000464 3300046457 Bacteria 20031
574 Ga0495590_0000998 3300046457 Bacteria 12475
575 Ga0495590_0003084 3300046457 Bacteria 6818
576 Ga0495590_0029458 3300046457 Bacteria 1924
577 Ga0495591_000019 3300046458 Bacteria 223010
578 Ga0495591_000421 3300046458 Bacteria 35259
579 Ga0495591_000580 3300046458 Bacteria 27842
580 Ga0495591_001318 3300046458 Bacteria 15623
581 Ga0495591_004169 3300046458 Bacteria 7175
582 Ga0495591_005634 3300046458 Bacteria 5743
583 Ga0495591_012247 3300046458 Bacteria 3204
584 Ga0495591_014291 3300046458 Bacteria 2862
585 Ga0495591_015933 3300046458 Bacteria 2636
586 Ga0495591_019351 3300046458 Bacteria 2280
587 Ga0495591_020387 3300046458 Bacteria 2192
588 Ga0495591_025641 3300046458 Bacteria 1845
589 Ga0495591_031520 3300046458 Bacteria 1589
590 Ga0495591_043985 3300046458 Bacteria 1253
591 Ga0495591_065853 3300046458 Bacteria 952
592 Ga0495629_0041864 3300046459 Bacteria 3220
593 Ga0495638_0005873 3300046460 Bacteria 9027
594 Ga0495638_0020154 3300046460 Bacteria 4406
595 Ga0495638_0038209 3300046460 Bacteria 3052
596 Ga0495638_0044976 3300046460 Bacteria 2779
597 Ga0495638_0052625 3300046460 Bacteria 2535
598 Ga0495638_0061306 3300046460 Bacteria 2324
599 Ga0495638_0069202 3300046460 Bacteria 2163
600 Ga0495638_0086514 3300046460 Bacteria 1894
601 Ga0495638_0102254 3300046460 Bacteria 1712
602 Ga0495638_0273322 3300046460 Bacteria 921
603 Ga0495638_0578621 3300046460 Bacteria 554
604 Ga0495653_0000656 3300046463 Bacteria 26442
605 Ga0495653_0020411 3300046463 Bacteria 5371
606 Ga0495653_0054867 3300046463 Bacteria 3043
607 Ga0495653_0247856 3300046463 Bacteria 1183
608 Ga0495653_0282594 3300046463 Bacteria 1088
609 Ga0495650_0000392 3300046471 Bacteria 74545
610 Ga0495650_0002672 3300046471 Bacteria 13883
611 Ga0495650_0004382 3300046471 Bacteria 9706
612 Ga0495650_0008721 3300046471 Bacteria 5870
613 Ga0495650_0019729 3300046471 Bacteria 3307
614 Ga0495650_0036094 3300046471 Bacteria 2167
615 Ga0495650_0068850 3300046471 Bacteria 1394
616 Ga0495650_0106795 3300046471 Bacteria 1044
617 Ga0495582_0007143 3300046473 Bacteria 6203
618 Ga0495605_0000014 3300046474 Bacteria 305393
619 Ga0495605_0000030 3300046474 Bacteria 213339
620 Ga0495605_0000119 3300046474 Bacteria 102569
621 Ga0495605_0000326 3300046474 Bacteria 48354
622 Ga0495605_0001591 3300046474 Bacteria 14714
623 Ga0495605_0002239 3300046474 Bacteria 12079
624 Ga0495605_0005402 3300046474 Bacteria 7445
625 Ga0495605_0006000 3300046474 Bacteria 7021
626 Ga0495605_0013217 3300046474 Bacteria 4558
627 Ga0495605_0014717 3300046474 Bacteria 4275
628 Ga0495605_0030895 3300046474 Bacteria 2740
629 Ga0495605_0032047 3300046474 Bacteria 2680
630 Ga0495605_0036302 3300046474 Bacteria 2485
631 Ga0495605_0046040 3300046474 Bacteria 2146
632 Ga0495605_0046675 3300046474 Bacteria 2128
633 Ga0495605_0055681 3300046474 Bacteria 1909
634 Ga0495605_0070072 3300046474 Bacteria 1659
635 Ga0495605_0185770 3300046474 Bacteria 912
636 Ga0495605_0408647 3300046474 Bacteria 563
637 Ga0495605_0469261 3300046474 Bacteria 517
638 Ga0495639_0000008 3300046475 Bacteria 97096
639 Ga0495639_0207821 3300046475 Bacteria 960
640 Ga0495584_0001473 3300046491 Bacteria 14112
641 Ga0495584_0001655 3300046491 Bacteria 13112
642 Ga0495584_0002254 3300046491 Bacteria 10996
643 Ga0495584_0002578 3300046491 Bacteria 10220
644 Ga0495584_0005038 3300046491 Bacteria 7027
645 Ga0495584_0008956 3300046491 Bacteria 5173
646 Ga0495584_0009721 3300046491 Bacteria 4945
647 Ga0495584_0016014 3300046491 Bacteria 3826
648 Ga0495584_0022958 3300046491 Bacteria 3165
649 Ga0495584_0430927 3300046491 Bacteria 670
650 Ga0495585_0000440 3300046492 Bacteria 39788
651 Ga0495585_0002128 3300046492 Bacteria 14472
652 Ga0495585_0003760 3300046492 Bacteria 10131
653 Ga0495585_0012407 3300046492 Bacteria 5021
654 Ga0495585_0048750 3300046492 Bacteria 2354
655 Ga0495585_0052900 3300046492 Bacteria 2247
656 Ga0495585_0061157 3300046492 Bacteria 2071
657 Ga0495585_0118976 3300046492 Bacteria 1399
658 Ga0495585_0172322 3300046492 Bacteria 1117
659 Ga0495585_0202976 3300046492 Bacteria 1008
660 Ga0495585_0351950 3300046492 Bacteria 715
661 Ga0495585_0453089 3300046492 Bacteria 613
662 Ga0495594_0002001 3300046499 Bacteria 10618
663 Ga0495594_0074904 3300046499 Bacteria 1886
664 Ga0495596_0000306 3300046500 Bacteria 32460
665 Ga0495596_0024972 3300046500 Bacteria 2417
666 Ga0495596_0042045 3300046500 Bacteria 1801
667 Ga0495607_0000099 3300046501 Bacteria 91962
668 Ga0495607_0000238 3300046501 Bacteria 59031
669 Ga0495607_0000605 3300046501 Bacteria 34893
670 Ga0495607_0000897 3300046501 Bacteria 27725
671 Ga0495607_0000921 3300046501 Bacteria 27398
672 Ga0495607_0001674 3300046501 Bacteria 19171
673 Ga0495607_0004501 3300046501 Bacteria 10228
674 Ga0495607_0011823 3300046501 Bacteria 5787
675 Ga0495607_0013090 3300046501 Bacteria 5449
676 Ga0495607_0017322 3300046501 Bacteria 4627
677 Ga0495607_0017953 3300046501 Bacteria 4524
678 Ga0495607_0031050 3300046501 Bacteria 3273
679 Ga0495607_0039175 3300046501 Bacteria 2832
680 Ga0495607_0042013 3300046501 Bacteria 2712
681 Ga0495607_0043109 3300046501 Bacteria 2670
682 Ga0495607_0050152 3300046501 Bacteria 2431
683 Ga0495607_0063010 3300046501 Bacteria 2099
684 Ga0495607_0117177 3300046501 Bacteria 1403
685 Ga0495607_0145618 3300046501 Bacteria 1217
686 Ga0495607_0159419 3300046501 Bacteria 1147
687 Ga0495607_0160335 3300046501 Bacteria 1143
688 Ga0495607_0167676 3300046501 Bacteria 1111
689 Ga0495607_0182604 3300046501 Bacteria 1050
690 Ga0495607_0195360 3300046501 Bacteria 1005
691 Ga0495607_0222877 3300046501 Bacteria 921
692 Ga0495607_0246414 3300046501 Bacteria 862
693 Ga0495607_0530870 3300046501 Bacteria 519
694 Ga0495583_0000238 3300046506 Bacteria 91142
695 Ga0495583_0001843 3300046506 Bacteria 19779
696 Ga0495583_0002388 3300046506 Bacteria 16181
697 Ga0495583_0009469 3300046506 Bacteria 5814
698 Ga0495583_0021517 3300046506 Bacteria 3315
699 Ga0495583_0032908 3300046506 Bacteria 2498
700 Ga0495583_0042159 3300046506 Bacteria 2133
701 Ga0495583_0060088 3300046506 Bacteria 1700
702 Ga0495583_0066766 3300046506 Bacteria 1590
703 Ga0495583_0252811 3300046506 Bacteria 706
704 Ga0495583_0338431 3300046506 Bacteria 594
705 Ga0495606_0000086 3300046507 Bacteria 156764
706 Ga0495606_0000151 3300046507 Bacteria 119548
707 Ga0495606_0000398 3300046507 Bacteria 73352
708 Ga0495606_0005675 3300046507 Bacteria 11814
709 Ga0495606_0007938 3300046507 Bacteria 9349
710 Ga0495606_0009869 3300046507 Bacteria 8005
711 Ga0495606_0031703 3300046507 Bacteria 3670
712 Ga0495606_0040423 3300046507 Bacteria 3135
713 Ga0495606_0109550 3300046507 Bacteria 1667
714 Ga0495606_0141007 3300046507 Bacteria 1423
715 Ga0495606_0172493 3300046507 Bacteria 1253
716 Ga0495606_0356740 3300046507 Bacteria 774
717 Ga0495606_0366019 3300046507 Bacteria 760
718 Ga0495606_0401552 3300046507 Bacteria 713
719 Ga0495610_0000994 3300046512 Bacteria 26150
720 Ga0495610_0003490 3300046512 Bacteria 12224
721 Ga0495610_0004811 3300046512 Bacteria 9852
722 Ga0495610_0005423 3300046512 Bacteria 9074
723 Ga0495610_0007307 3300046512 Bacteria 7389
724 Ga0495610_0008264 3300046512 Bacteria 6765
725 Ga0495610_0014261 3300046512 Bacteria 4677
726 Ga0495610_0014347 3300046512 Bacteria 4657
727 Ga0495610_0015934 3300046512 Bacteria 4346
728 Ga0495610_0023027 3300046512 Bacteria 3393
729 Ga0495610_0030223 3300046512 Bacteria 2842
730 Ga0495610_0090106 3300046512 Bacteria 1391
731 Ga0495610_0095121 3300046512 Bacteria 1343
732 Ga0495610_0116833 3300046512 Bacteria 1174
733 Ga0495610_0182519 3300046512 Bacteria 871
734 Ga0495610_0245745 3300046512 Bacteria 711
735 Ga0495610_0267094 3300046512 Bacteria 671
736 Ga0495616_0000637 3300046513 Bacteria 26228
737 Ga0495616_0001151 3300046513 Bacteria 18698
738 Ga0495616_0003552 3300046513 Bacteria 9964
739 Ga0495616_0012464 3300046513 Bacteria 4826
740 Ga0495616_0042068 3300046513 Bacteria 2327
741 Ga0495616_0044509 3300046513 Bacteria 2250
742 Ga0495616_0044761 3300046513 Bacteria 2244
743 Ga0495616_0048301 3300046513 Bacteria 2139
744 Ga0495616_0064481 3300046513 Bacteria 1787
745 Ga0495616_0169214 3300046513 Bacteria 978
746 Ga0495616_0469306 3300046513 Bacteria 507
747 Ga0495620_0000094 3300046515 Bacteria 70534
748 Ga0495620_0000169 3300046515 Bacteria 51428
749 Ga0495620_0000173 3300046515 Bacteria 50969
750 Ga0495620_0000492 3300046515 Bacteria 25629
751 Ga0495620_0002937 3300046515 Bacteria 9798
752 Ga0495620_0003531 3300046515 Bacteria 8942
753 Ga0495620_0009430 3300046515 Bacteria 5192
754 Ga0495620_0022812 3300046515 Bacteria 3006
755 Ga0495620_0026854 3300046515 Bacteria 2702
756 Ga0495620_0029516 3300046515 Bacteria 2536
757 Ga0495620_0062757 3300046515 Bacteria 1542
758 Ga0495620_0097890 3300046515 Bacteria 1171
759 Ga0495620_0124792 3300046515 Bacteria 1013
760 Ga0495620_0285646 3300046515 Bacteria 627
761 Ga0495630_0002264 3300046517 Bacteria 13403
762 Ga0495630_0029594 3300046517 Bacteria 4071
763 Ga0495631_0000112 3300046518 Bacteria 54578
764 Ga0495631_0001057 3300046518 Bacteria 17098
765 Ga0495631_0003532 3300046518 Bacteria 8545
766 Ga0495631_0004090 3300046518 Bacteria 7834
767 Ga0495631_0007585 3300046518 Bacteria 5512
768 Ga0495631_0031833 3300046518 Bacteria 2380
769 Ga0495631_0041352 3300046518 Bacteria 2040
770 Ga0495631_0075723 3300046518 Bacteria 1452
771 Ga0495631_0168532 3300046518 Bacteria 939
772 Ga0495631_0237409 3300046518 Bacteria 777
773 Ga0495632_0000146 3300046519 Bacteria 72790
774 Ga0495632_0001185 3300046519 Bacteria 22182
775 Ga0495632_0002120 3300046519 Bacteria 15473
776 Ga0495632_0004556 3300046519 Bacteria 9393
777 Ga0495632_0008688 3300046519 Bacteria 6200
778 Ga0495632_0033898 3300046519 Bacteria 2617
779 Ga0495632_0049025 3300046519 Bacteria 2089
780 Ga0495632_0051066 3300046519 Bacteria 2036
781 Ga0495632_0053754 3300046519 Bacteria 1976
782 Ga0495632_0082530 3300046519 Bacteria 1531
783 Ga0495632_0092395 3300046519 Bacteria 1433
784 Ga0495632_0093403 3300046519 Bacteria 1424
785 Ga0495632_0165428 3300046519 Bacteria 1017
786 Ga0495632_0170351 3300046519 Bacteria 1000
787 Ga0495632_0189527 3300046519 Bacteria 939
788 Ga0495637_0000032 3300046520 Bacteria 128687
789 Ga0495637_0000090 3300046520 Bacteria 70678
790 Ga0495637_0001124 3300046520 Bacteria 16372
791 Ga0495637_0002443 3300046520 Bacteria 10265
792 Ga0495637_0003245 3300046520 Bacteria 8674
793 Ga0495637_0004373 3300046520 Bacteria 7328
794 Ga0495637_0005638 3300046520 Bacteria 6355
795 Ga0495637_0013888 3300046520 Bacteria 3813
796 Ga0495637_0015361 3300046520 Bacteria 3590
797 Ga0495637_0019356 3300046520 Bacteria 3149
798 Ga0495637_0023395 3300046520 Bacteria 2808
799 Ga0495637_0038602 3300046520 Bacteria 2066
800 Ga0495637_0046259 3300046520 Bacteria 1841
801 Ga0495637_0067479 3300046520 Bacteria 1451
802 Ga0495637_0151217 3300046520 Bacteria 875
803 Ga0495637_0189917 3300046520 Bacteria 758
804 Ga0495637_0193230 3300046520 Bacteria 750
805 Ga0495637_0235763 3300046520 Bacteria 662
806 Ga0495643_0016263 3300046522 Bacteria 4373
807 Ga0495643_0018338 3300046522 Bacteria 4069
808 Ga0495643_0023699 3300046522 Bacteria 3487
809 Ga0495643_0069720 3300046522 Bacteria 1847
810 Ga0495643_0070885 3300046522 Bacteria 1829
811 Ga0495643_0071220 3300046522 Bacteria 1825
812 Ga0495643_0110206 3300046522 Bacteria 1400
813 Ga0495643_0156061 3300046522 Bacteria 1126
814 Ga0495643_0206000 3300046522 Bacteria 941
815 Ga0495643_0494903 3300046522 Bacteria 527
816 Ga0495644_0001167 3300046523 Bacteria 10775
817 Ga0495644_0001577 3300046523 Bacteria 9294
818 Ga0495644_0008053 3300046523 Bacteria 4053
819 Ga0495644_0015460 3300046523 Bacteria 2922
820 Ga0495644_0060705 3300046523 Bacteria 1421
821 Ga0495648_0000882 3300046524 Bacteria 31571
822 Ga0495648_0003250 3300046524 Bacteria 14394
823 Ga0495648_0013303 3300046524 Bacteria 6092
824 Ga0495648_0023334 3300046524 Bacteria 4239
825 Ga0495648_0036314 3300046524 Bacteria 3181
826 Ga0495648_0061298 3300046524 Bacteria 2235
827 Ga0495648_0070799 3300046524 Bacteria 2024
828 Ga0495648_0083562 3300046524 Bacteria 1808
829 Ga0495648_0103514 3300046524 Bacteria 1565
830 Ga0495648_0139584 3300046524 Bacteria 1277
831 Ga0495648_0144079 3300046524 Bacteria 1250
832 Ga0495648_0179988 3300046524 Bacteria 1075
833 Ga0495648_0194477 3300046524 Bacteria 1020
834 Ga0495648_0299390 3300046524 Bacteria 754
835 Ga0495648_0397212 3300046524 Bacteria 617
836 Ga0495666_0000271 3300046526 Bacteria 22372
837 Ga0495666_0025350 3300046526 Bacteria 2927
838 Ga0495666_0046085 3300046526 Bacteria 2102
839 Ga0495666_0309622 3300046526 Bacteria 713
840 Ga0495642_0000394 3300046528 Bacteria 23462
841 Ga0495642_0011252 3300046528 Bacteria 3432
842 Ga0495654_0000160 3300046530 Bacteria 66818
843 Ga0495654_0000423 3300046530 Bacteria 35841
844 Ga0495654_0000787 3300046530 Bacteria 24391
845 Ga0495654_0003231 3300046530 Bacteria 10073
846 Ga0495654_0003622 3300046530 Bacteria 9396
847 Ga0495654_0005096 3300046530 Bacteria 7681
848 Ga0495654_0006806 3300046530 Bacteria 6454
849 Ga0495654_0021340 3300046530 Bacteria 3369
850 Ga0495654_0021811 3300046530 Bacteria 3330
851 Ga0495654_0024215 3300046530 Bacteria 3138
852 Ga0495654_0033085 3300046530 Bacteria 2617
853 Ga0495654_0037628 3300046530 Bacteria 2424
854 Ga0495654_0041994 3300046530 Bacteria 2272
855 Ga0495654_0044062 3300046530 Bacteria 2208
856 Ga0495654_0061299 3300046530 Bacteria 1806
857 Ga0495654_0079385 3300046530 Bacteria 1541
858 Ga0495654_0093489 3300046530 Bacteria 1392
859 Ga0495654_0097586 3300046530 Bacteria 1356
860 Ga0495654_0108443 3300046530 Bacteria 1269
861 Ga0495654_0156794 3300046530 Bacteria 1002
862 Ga0495654_0162220 3300046530 Bacteria 980
863 Ga0495654_0170899 3300046530 Bacteria 947
864 Ga0495654_0196191 3300046530 Bacteria 866
865 Ga0495654_0318436 3300046530 Bacteria 631
866 Ga0495586_0035507 3300046535 Bacteria 2678
867 Ga0495587_0001455 3300046536 Bacteria 15798
868 Ga0495587_0006391 3300046536 Bacteria 7686
869 Ga0495609_0000006 3300046538 Bacteria 431833
870 Ga0495609_0000024 3300046538 Bacteria 264100
871 Ga0495609_0000040 3300046538 Bacteria 177058
872 Ga0495609_0005389 3300046538 Bacteria 6740
873 Ga0495609_0108183 3300046538 Bacteria 1201
874 Ga0495609_0113136 3300046538 Bacteria 1170
875 Ga0495609_0178920 3300046538 Bacteria 893
876 Ga0495609_0294264 3300046538 Bacteria 662
877 Ga0495609_0300842 3300046538 Bacteria 653
878 Ga0495609_0310762 3300046538 Bacteria 640
879 Ga0495609_0341939 3300046538 Bacteria 604
880 Ga0495597_0000010 3300046542 Bacteria 222418
881 Ga0495597_0000843 3300046542 Bacteria 24106
882 Ga0495597_0001443 3300046542 Bacteria 17032
883 Ga0495597_0006682 3300046542 Bacteria 5939
884 Ga0495597_0018206 3300046542 Bacteria 3298
885 Ga0495597_0029092 3300046542 Bacteria 2524
886 Ga0495597_0076766 3300046542 Bacteria 1432
887 Ga0495597_0091905 3300046542 Bacteria 1287
888 Ga0495597_0096769 3300046542 Bacteria 1247
889 Ga0495597_0103209 3300046542 Bacteria 1200
890 Ga0495597_0149849 3300046542 Bacteria 957
891 Ga0495597_0192528 3300046542 Bacteria 820
892 Ga0495645_0668003 3300046543 Bacteria 633
893 Ga0495622_0000635 3300046557 Bacteria 20385
894 Ga0495622_0004490 3300046557 Bacteria 6466
895 Ga0495622_0016360 3300046557 Bacteria 3453
896 Ga0495622_0021481 3300046557 Bacteria 3004
897 Ga0495622_0032514 3300046557 Bacteria 2435
898 Ga0495633_0000118 3300046558 Bacteria 107914
899 Ga0495633_0001362 3300046558 Bacteria 19125
900 Ga0495633_0006963 3300046558 Bacteria 6609
901 Ga0495656_0354864 3300046615 Bacteria 760
902 Ga0495668_0001931 3300046616 Bacteria 18433
903 Ga0495668_0008042 3300046616 Bacteria 6640
904 Ga0495668_0026417 3300046616 Bacteria 3294
905 Ga0495668_0037670 3300046616 Bacteria 2705
906 Ga0495668_0206265 3300046616 Bacteria 1076
907 Ga0495634_0002365 3300046642 Bacteria 15709
908 Ga0495634_0050765 3300046642 Bacteria 2784
909 Ga0495611_0000262 3300046648 Bacteria 36226
910 Ga0495611_0001057 3300046648 Bacteria 14564
911 Ga0495611_0002522 3300046648 Bacteria 8329
912 Ga0495611_0009383 3300046648 Bacteria 4136
913 Ga0495611_0017050 3300046648 Bacteria 3105
914 Ga0495611_0105726 3300046648 Bacteria 1309
915 Ga0495611_0190802 3300046648 Bacteria 956
916 Ga0495625_0000247 3300046660 Bacteria 85241
917 Ga0495625_0005337 3300046660 Bacteria 11768
918 Ga0495625_0005545 3300046660 Bacteria 11458
919 Ga0495625_0010216 3300046660 Bacteria 7788
920 Ga0495625_0014149 3300046660 Bacteria 6383
921 Ga0495625_0047398 3300046660 Bacteria 3098
922 Ga0495625_0049817 3300046660 Bacteria 3008
923 Ga0495625_0065672 3300046660 Bacteria 2557
924 Ga0495625_0081306 3300046660 Bacteria 2255
925 Ga0495625_0083487 3300046660 Bacteria 2220
926 Ga0495625_0202195 3300046660 Bacteria 1310
927 Ga0495625_0257058 3300046660 Bacteria 1131
928 Ga0495625_0723362 3300046660 Bacteria 586
929 Ga0495635_0002391 3300046663 Bacteria 12787
930 Ga0495635_0008952 3300046663 Bacteria 6986
931 Ga0495659_0000164 3300046664 Bacteria 29695
932 Ga0495659_0092508 3300046664 Bacteria 1162
933 Ga0495661_0000019 3300046665 Bacteria 200606
934 Ga0495661_0000034 3300046665 Bacteria 165606
935 Ga0495661_0000054 3300046665 Bacteria 138979
936 Ga0495661_0003162 3300046665 Bacteria 12323
937 Ga0495661_0022737 3300046665 Bacteria 4076
938 Ga0495661_0028637 3300046665 Bacteria 3563
939 Ga0495661_0067050 3300046665 Bacteria 2109
940 Ga0495661_0075652 3300046665 Bacteria 1956
941 Ga0495661_0097743 3300046665 Bacteria 1658
942 Ga0495661_0104035 3300046665 Bacteria 1592
943 Ga0495661_0159615 3300046665 Bacteria 1211
944 Ga0495588_0001824 3300046674 Bacteria 9079
945 Ga0495646_0028616 3300046680 Bacteria 3487
946 Ga0495646_0057199 3300046680 Bacteria 2335
947 Ga0495669_0105094 3300046684 Bacteria 1314
948 Ga0495613_0081696 3300046689 Bacteria 2347
949 Ga0495613_0098099 3300046689 Bacteria 2117
950 Ga0495624_0003258 3300046690 Bacteria 12097
951 Ga0495670_0003629 3300046691 Bacteria 7583
952 Ga0495670_0007285 3300046691 Bacteria 5437
953 Ga0495670_0011541 3300046691 Bacteria 4346
954 Ga0495670_0025070 3300046691 Bacteria 2950
955 Ga0495670_0028066 3300046691 Bacteria 2790
956 Ga0495670_0048976 3300046691 Bacteria 2113
957 Ga0495670_0102178 3300046691 Bacteria 1477
958 Ga0495670_0107361 3300046691 Bacteria 1442
959 Ga0495670_0164587 3300046691 Bacteria 1166
960 Ga0495670_0247142 3300046691 Bacteria 950
961 Ga0495671_0000511 3300046692 Bacteria 29778
962 Ga0495671_0006290 3300046692 Bacteria 6872
963 Ga0495671_0006640 3300046692 Bacteria 6668
964 Ga0495671_0006890 3300046692 Bacteria 6519
965 Ga0495671_0008208 3300046692 Bacteria 5890
966 Ga0495671_0016742 3300046692 Bacteria 3908
967 Ga0495671_0026196 3300046692 Bacteria 3024
968 Ga0495671_0038972 3300046692 Bacteria 2400
969 Ga0495671_0049105 3300046692 Bacteria 2104
970 Ga0495671_0060387 3300046692 Bacteria 1871
971 Ga0495671_0062777 3300046692 Bacteria 1830
972 Ga0495671_0079452 3300046692 Bacteria 1607
973 Ga0495671_0081398 3300046692 Bacteria 1587
974 Ga0495671_0086091 3300046692 Bacteria 1539
975 Ga0495671_0099535 3300046692 Bacteria 1421
976 Ga0495671_0387539 3300046692 Bacteria 669
977 Ga0495671_0538032 3300046692 Bacteria 556
978 Ga0495649_0000342 3300046694 Bacteria 40143
979 Ga0495649_0002393 3300046694 Bacteria 13249
980 Ga0495649_0007428 3300046694 Bacteria 6678
981 Ga0495649_0013762 3300046694 Bacteria 4657
982 Ga0495649_0016036 3300046694 Bacteria 4253
983 Ga0495649_0026369 3300046694 Bacteria 3231
984 Ga0495649_0027849 3300046694 Bacteria 3133
985 Ga0495649_0042174 3300046694 Bacteria 2493
986 Ga0495649_0042506 3300046694 Bacteria 2483
987 Ga0495649_0111509 3300046694 Bacteria 1450
988 Ga0495649_0123265 3300046694 Bacteria 1369
989 Ga0495649_0128211 3300046694 Bacteria 1339
990 Ga0495649_0144817 3300046694 Bacteria 1249
991 Ga0495649_0205216 3300046694 Bacteria 1022
992 Ga0495649_0324714 3300046694 Bacteria 780
993 Ga0495649_0380314 3300046694 Bacteria 710
994 Ga0495649_0480881 3300046694 Bacteria 618
995 Ga0495649_0516151 3300046694 Bacteria 593
996 Ga0495649_0558365 3300046694 Bacteria 566
997 Ga0495589_0000493 3300046794 Bacteria 28238
998 Ga0495589_0000825 3300046794 Bacteria 19495
999 Ga0495589_0001847 3300046794 Bacteria 12011
1000 Ga0495589_0002949 3300046794 Bacteria 9378
1001 Ga0495589_0003862 3300046794 Bacteria 8055
1002 Ga0495589_0004792 3300046794 Bacteria 7188
1003 Ga0495589_0005561 3300046794 Bacteria 6648
1004 Ga0495589_0031849 3300046794 Bacteria 2653
1005 Ga0495589_0210212 3300046794 Bacteria 916
1006 Ga0495600_0035211 3300046809 Bacteria 3250
1007 Ga0495600_0050000 3300046809 Bacteria 2727
1008 Ga0495660_0001237 3300046810 Bacteria 17773
1009 Ga0495660_0001468 3300046810 Bacteria 16104
1010 Ga0495660_0001846 3300046810 Bacteria 13902
1011 Ga0495660_0003281 3300046810 Bacteria 10036
1012 Ga0495660_0004232 3300046810 Bacteria 8712
1013 Ga0495660_0009272 3300046810 Bacteria 5746
1014 Ga0495660_0011810 3300046810 Bacteria 5063
1015 Ga0495660_0015497 3300046810 Bacteria 4403
1016 Ga0495660_0019650 3300046810 Bacteria 3877
1017 Ga0495660_0029002 3300046810 Bacteria 3124
1018 Ga0495660_0040449 3300046810 Bacteria 2583
1019 Ga0495660_0046989 3300046810 Bacteria 2365
1020 Ga0495660_0064933 3300046810 Bacteria 1949
1021 Ga0495660_0077818 3300046810 Bacteria 1744
1022 Ga0495660_0089766 3300046810 Bacteria 1599
1023 Ga0495660_0125499 3300046810 Bacteria 1293
1024 Ga0495660_0282496 3300046810 Bacteria 759
1025 Ga0495660_0306884 3300046810 Bacteria 717
1026 Ga0495660_0401233 3300046810 Bacteria 600
1027 Ga0495660_0432911 3300046810 Bacteria 571
1028 Ga0495581_0002503 3300047315 Bacteria 10425
1029 Ga0495581_0044896 3300047315 Bacteria 2555
1030 Ga0495604_0045755 3300047317 Bacteria 3414
1031 Ga0495604_0055553 3300047317 Bacteria 3051
1032 Ga0495604_0073354 3300047317 Bacteria 2583
1033 Ga0495604_0101090 3300047317 Bacteria 2118
1034 Ga0495636_0000694 3300047318 Bacteria 12336
1035 Ga0495636_0028522 3300047318 Bacteria 2277
1036 Ga0495674_0016894 3300047319 Bacteria 6804
1037 Ga0495672_0000703 3300047320 Bacteria 36780
1038 Ga0495672_0001170 3300047320 Bacteria 26579
1039 Ga0495672_0003680 3300047320 Bacteria 12954
1040 Ga0495672_0003804 3300047320 Bacteria 12705
1041 Ga0495672_0004691 3300047320 Bacteria 11062
1042 Ga0495672_0005594 3300047320 Bacteria 9924
1043 Ga0495672_0005639 3300047320 Bacteria 9880
1044 Ga0495672_0010079 3300047320 Bacteria 6764
1045 Ga0495672_0016446 3300047320 Bacteria 4984
1046 Ga0495672_0034333 3300047320 Bacteria 3135
1047 Ga0495672_0035377 3300047320 Bacteria 3076
1048 Ga0495672_0036039 3300047320 Bacteria 3041
1049 Ga0495672_0038195 3300047320 Bacteria 2931
1050 Ga0495672_0038621 3300047320 Bacteria 2910
1051 Ga0495672_0074546 3300047320 Bacteria 1910
1052 Ga0495672_0078630 3300047320 Bacteria 1844
1053 Ga0495672_0292375 3300047320 Bacteria 774
1054 Ga0495676_0000010 3300047321 Bacteria 242637
1055 Ga0495676_0025937 3300047321 Bacteria 5051
1056 Ga0495676_0092514 3300047321 Bacteria 2257
1057 Ga0495680_0000801 3300047322 Bacteria 35054
1058 Ga0495680_0009169 3300047322 Bacteria 8928
1059 Ga0495680_0091612 3300047322 Bacteria 2278
1060 Ga0495680_0244468 3300047322 Bacteria 1273
1061 Ga0495683_0000066 3300047323 Bacteria 112097
1062 Ga0495683_0000143 3300047323 Bacteria 70181
1063 Ga0495683_0000539 3300047323 Bacteria 28759
1064 Ga0495683_0001519 3300047323 Bacteria 15033
1065 Ga0495683_0011874 3300047323 Bacteria 4577
1066 Ga0495683_0015699 3300047323 Bacteria 3934
1067 Ga0495683_0022781 3300047323 Bacteria 3220
1068 Ga0495683_0183081 3300047323 Bacteria 955
1069 Ga0495683_0365402 3300047323 Bacteria 606
1070 Ga0495687_001510 3300047443 Bacteria 21206
1071 Ga0495687_022643 3300047443 Bacteria 3012
1072 Ga0495687_199933 3300047443 Bacteria 635
1073 Ga0495675_0009120 3300047444 Bacteria 6166
1074 Ga0495675_0221259 3300047444 Bacteria 1145
1075 Ga0495679_000480 3300047446 Bacteria 28853
1076 Ga0495679_003089 3300047446 Bacteria 8164
1077 Ga0495679_007016 3300047446 Bacteria 4759
1078 Ga0495679_018965 3300047446 Bacteria 2428
1079 Ga0495679_035036 3300047446 Bacteria 1593
1080 Ga0495679_050431 3300047446 Bacteria 1251
1081 Ga0495679_076848 3300047446 Bacteria 954
1082 Ga0495679_091870 3300047446 Bacteria 851
1083 Ga0495679_101230 3300047446 Bacteria 800
1084 Ga0495673_0000250 3300047469 Bacteria 75058
1085 Ga0495673_0000274 3300047469 Bacteria 70070
1086 Ga0495673_0000744 3300047469 Bacteria 31024
1087 Ga0495673_0001425 3300047469 Bacteria 19150
1088 Ga0495673_0005658 3300047469 Bacteria 7509
1089 Ga0495673_0006652 3300047469 Bacteria 6769
1090 Ga0495673_0008428 3300047469 Bacteria 5806
1091 Ga0495673_0013214 3300047469 Bacteria 4347
1092 Ga0495673_0014053 3300047469 Bacteria 4177
1093 Ga0495673_0015531 3300047469 Bacteria 3921
1094 Ga0495673_0015761 3300047469 Bacteria 3884
1095 Ga0495673_0017362 3300047469 Bacteria 3658
1096 Ga0495673_0018288 3300047469 Bacteria 3537
1097 Ga0495673_0025863 3300047469 Bacteria 2813
1098 Ga0495673_0030234 3300047469 Bacteria 2546
1099 Ga0495673_0038115 3300047469 Bacteria 2189
1100 Ga0495673_0085331 3300047469 Bacteria 1299
1101 Ga0495673_0092771 3300047469 Bacteria 1231
1102 Ga0495673_0120741 3300047469 Bacteria 1038
1103 Ga0495673_0121313 3300047469 Bacteria 1035
1104 Ga0495673_0134491 3300047469 Bacteria 969
1105 Ga0495673_0149320 3300047469 Bacteria 905
1106 Ga0495673_0151689 3300047469 Bacteria 895
1107 Ga0495673_0178096 3300047469 Bacteria 806
1108 Ga0495681_0002653 3300047470 Bacteria 12683
1109 Ga0495681_0003045 3300047470 Bacteria 11782
1110 Ga0495681_0003897 3300047470 Bacteria 10287
1111 Ga0495681_0003995 3300047470 Bacteria 10153
1112 Ga0495681_0005408 3300047470 Bacteria 8552
1113 Ga0495681_0006062 3300047470 Bacteria 7991
1114 Ga0495681_0014213 3300047470 Bacteria 4578
1115 Ga0495681_0014519 3300047470 Bacteria 4507
1116 Ga0495681_0015329 3300047470 Bacteria 4340
1117 Ga0495681_0015344 3300047470 Bacteria 4337
1118 Ga0495681_0035761 3300047470 Bacteria 2463
1119 Ga0495681_0036942 3300047470 Bacteria 2411
1120 Ga0495681_0097904 3300047470 Bacteria 1286
1121 Ga0495681_0099466 3300047470 Bacteria 1273
1122 Ga0495681_0106013 3300047470 Bacteria 1222
1123 Ga0495681_0230786 3300047470 Bacteria 738
1124 Ga0495684_0090390 3300047471 Bacteria 2319
1125 Ga0495686_0005162 3300047472 Bacteria 10402
1126 Ga0495686_0006307 3300047472 Bacteria 9112
1127 Ga0495686_0013547 3300047472 Bacteria 5654
1128 Ga0495686_0149960 3300047472 Bacteria 1369
1129 Ga0495686_0252080 3300047472 Bacteria 991
1130 Ga0495686_0455018 3300047472 Bacteria 679
1131 Ga0495593_0037726 3300047673 Bacteria 2612
1132 Ga0495593_0050719 3300047673 Bacteria 2197
1133 Ga0495593_0052157 3300047673 Bacteria 2162
1134 Ga0495593_0146396 3300047673 Bacteria 1195
1135 Ga0495602_0015757 3300048088 Bacteria 7615
1136 Ga0495626_0000013 3300048091 Bacteria 248164
1137 Ga0495626_0000389 3300048091 Bacteria 45440
1138 Ga0495626_0000680 3300048091 Bacteria 32558
1139 Ga0495626_0001264 3300048091 Bacteria 20709
1140 Ga0495626_0003471 3300048091 Bacteria 10103
1141 Ga0495626_0006329 3300048091 Bacteria 6751
1142 Ga0495626_0020479 3300048091 Bacteria 3294
1143 Ga0495626_0020898 3300048091 Bacteria 3256
1144 Ga0495626_0026645 3300048091 Bacteria 2814
1145 Ga0495626_0066297 3300048091 Bacteria 1632
1146 Ga0495626_0085529 3300048091 Bacteria 1394
1147 Ga0495626_0128759 3300048091 Bacteria 1082
1148 Ga0495626_0189645 3300048091 Bacteria 848
1149 Ga0496102_0002591 3300048905 Bacteria 15424
1150 Ga0496102_0500466 3300048905 Bacteria 1137
1151 Ga0496110_0184682 3300048913 Bacteria 1893
1152 Ga0496110_0501785 3300048913 Bacteria 1105
1153 Ga0496111_0362278 3300048914 Bacteria 1073
1154 Ga0496111_0404496 3300048914 Bacteria 1009
1155 Ga0496112_0472818 3300048915 Bacteria 1190
1156 Ga0496113_0604819 3300048916 Bacteria 878
1157 Ga0496116_0000289 3300048919 Bacteria 85507
1158 Ga0496116_0000916 3300048919 Bacteria 36473
1159 Ga0496116_0010908 3300048919 Bacteria 7570
1160 Ga0496116_0054648 3300048919 Bacteria 2628
1161 Ga0496116_0110915 3300048919 Bacteria 1612
1162 Ga0496116_0140181 3300048919 Bacteria 1362
1163 Ga0496116_0331359 3300048919 Bacteria 707
1164 Ga0496117_0005304 3300048920 Bacteria 13639
1165 Ga0496117_0007381 3300048920 Bacteria 10760
1166 Ga0496117_0042049 3300048920 Bacteria 3340
1167 Ga0496117_0120727 3300048920 Bacteria 1610
1168 Ga0496117_0159516 3300048920 Bacteria 1323
1169 Ga0496117_0194479 3300048920 Bacteria 1151
1170 Ga0496117_0210464 3300048920 Bacteria 1090
1171 Ga0496118_0035287 3300048921 Bacteria 4063
1172 Ga0496118_0095553 3300048921 Bacteria 2028
1173 Ga0496118_0182983 3300048921 Bacteria 1263
1174 Ga0496118_0185349 3300048921 Bacteria 1251
1175 Ga0496118_0284842 3300048921 Bacteria 917
1176 Ga0496118_0389705 3300048921 Bacteria 728
1177 Ga0496119_0079134 3300048922 Bacteria 1899
1178 Ga0496119_0129401 3300048922 Bacteria 1377
1179 Ga0496120_0069996 3300048923 Bacteria 1930
1180 Ga0496120_0163038 3300048923 Bacteria 1109
1181 Ga0496121_0000422 3300048924 Bacteria 83552
1182 Ga0496121_0001439 3300048924 Bacteria 40227
1183 Ga0496121_0015727 3300048924 Bacteria 7889
1184 Ga0496121_0018770 3300048924 Bacteria 6950
1185 Ga0496121_0077283 3300048924 Bacteria 2651
1186 Ga0496121_0193818 3300048924 Bacteria 1454
1187 Ga0496121_0237160 3300048924 Bacteria 1273
1188 Ga0496122_0000297 3300048925 Bacteria 110041
1189 Ga0496122_0004526 3300048925 Bacteria 17162
1190 Ga0496122_0005158 3300048925 Bacteria 15744
1191 Ga0496122_0062391 3300048925 Bacteria 2728
1192 Ga0496122_0138082 3300048925 Bacteria 1531
1193 Ga0496122_0299407 3300048925 Bacteria 868
1194 Ga0496122_0540425 3300048925 Bacteria 557
1195 Ga0496123_0000165 3300048926 Bacteria 132234
1196 Ga0496123_0012193 3300048926 Bacteria 7356
1197 Ga0496123_0042015 3300048926 Bacteria 3162
1198 Ga0496123_0059567 3300048926 Bacteria 2467
1199 Ga0496123_0094428 3300048926 Bacteria 1762
1200 Ga0496123_0106654 3300048926 Bacteria 1613
1201 Ga0496123_0129368 3300048926 Bacteria 1402
1202 Ga0496123_0212357 3300048926 Bacteria 982
1203 Ga0496124_0000051 3300048927 Bacteria 255802
1204 Ga0496124_0001293 3300048927 Bacteria 37983
1205 Ga0496124_0002451 3300048927 Bacteria 24268
1206 Ga0496124_0007831 3300048927 Bacteria 11272
1207 Ga0496124_0008462 3300048927 Bacteria 10753
1208 Ga0496124_0021752 3300048927 Bacteria 5901
1209 Ga0496124_0071018 3300048927 Bacteria 2887
1210 Ga0496124_0145842 3300048927 Bacteria 1862
1211 Ga0496124_0181279 3300048927 Bacteria 1620
1212 Ga0496124_0244303 3300048927 Bacteria 1332
1213 Ga0496124_0322489 3300048927 Bacteria 1105
1214 Ga0496125_0004825 3300048928 Bacteria 15324
1215 Ga0496125_0007659 3300048928 Bacteria 11445
1216 Ga0496125_0008210 3300048928 Bacteria 10976
1217 Ga0496125_0107488 3300048928 Bacteria 2032
1218 Ga0496125_0155761 3300048928 Bacteria 1561
1219 Ga0496125_0189171 3300048928 Bacteria 1361
1220 Ga0496125_0191554 3300048928 Bacteria 1349
1221 Ga0496125_0235898 3300048928 Bacteria 1165
1222 Ga0496125_0258313 3300048928 Bacteria 1093
1223 Ga0496126_0340065 3300048929 Bacteria 1230
1224 Ga0496126_0676647 3300048929 Bacteria 804
1225 Ga0495678_000199 3300049459 Bacteria 70570
1226 Ga0495678_001007 3300049459 Bacteria 24122
1227 Ga0495678_001084 3300049459 Bacteria 22987
1228 Ga0495678_003336 3300049459 Bacteria 10002
1229 Ga0495678_006936 3300049459 Bacteria 5945
1230 Ga0495678_011875 3300049459 Bacteria 4152
1231 Ga0495678_016433 3300049459 Bacteria 3384
1232 Ga0495678_019801 3300049459 Bacteria 2992
1233 Ga0495678_020264 3300049459 Bacteria 2949
1234 Ga0495678_024762 3300049459 Bacteria 2586
1235 Ga0495678_034774 3300049459 Bacteria 2070
1236 Ga0495678_038984 3300049459 Bacteria 1918
1237 Ga0495678_054738 3300049459 Bacteria 1526
1238 Ga0495678_059889 3300049459 Bacteria 1434
1239 Ga0495678_142606 3300049459 Bacteria 782
1240 Ga0495678_156746 3300049459 Bacteria 731
1241 Ga0495682_0000083 3300049460 Bacteria 83129
1242 Ga0495682_0000396 3300049460 Bacteria 31422
1243 Ga0495682_0000838 3300049460 Bacteria 19283
1244 Ga0495682_0003518 3300049460 Bacteria 6943
1245 Ga0495682_0013481 3300049460 Bacteria 3111
1246 Ga0495682_0042887 3300049460 Bacteria 1657
1247 Ga0495682_0064061 3300049460 Bacteria 1325
1248 Ga0495682_0075511 3300049460 Bacteria 1212
1249 Ga0495682_0097485 3300049460 Bacteria 1055
1250 Ga0501032_0007420 3300049569 Bacteria 8010
1251 Ga0501034_0564611 3300049571 Bacteria 1046
1252 Ga0501036_1281984 3300049572 Bacteria 596
1253 Ga0501037_0551619 3300049573 Bacteria 778
1254 Ga0501037_0763130 3300049573 Bacteria 640
1255 Ga0501222_031874 3300049662 Bacteria 726
1256 Ga0501235_012819 3300049669 Bacteria 1845
1257 Ga0501241_000452 3300049758 Bacteria 8961
1258 nmdc:mga03683_23924_c2 3300050489 Bacteria 944
1259 nmdc:mga00v17_305884_c1 3300050491 Bacteria 1033
1260 nmdc:mga00v17_344592_c1 3300050491 Bacteria 969
1261 nmdc:mga00v17_941980_c1 3300050491 Bacteria 545
1262 nmdc:mga08x19_1134843_c1 3300050514 Bacteria 554
1263 nmdc:mga0sz30_253049_c1 3300050516 Bacteria 784
1264 Ga0500634_0060013 3300053161 Bacteria 2020

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025728 Ga0207655_1001173 Ga0207655_100117312 102
2 iso_pu_bacteria 2606217733 2608380988 107
3 iso_pu_bacteria 8011350971 8011351268 107
4 iso_pu_bacteria 2510065053 2510283915 108
5 iso_pu_bacteria 2510065055 2510293412 108
6 iso_pu_bacteria 2510065058 2510312904 108
7 iso_pu_bacteria 2511231004 2511255722 108
8 iso_pu_bacteria 2511231006 2511267639 108
9 iso_pu_bacteria 2511231007 2511274873 108
10 iso_pu_bacteria 2511231008 2511276848 108
11 iso_pu_bacteria 2511231010 2511291412 108
12 iso_pu_bacteria 2511231011 2511297785 108
13 iso_pu_bacteria 2511231012 2511299224 108
14 iso_pu_bacteria 2511231014 2511313913 108
15 iso_pu_bacteria 2511231015 2511321416 108
16 iso_pu_bacteria 2511231016 2511325684 108
17 iso_pu_bacteria 2511231017 2511335392 108
18 iso_pu_bacteria 2511231018 2511337344 108
19 iso_pu_bacteria 2511231019 2511342649 108
20 iso_pu_bacteria 2511231020 2511348252 108
21 iso_pu_bacteria 2511231021 2511353486 108
22 iso_pu_bacteria 2511231022 2511362364 108
23 iso_pu_bacteria 2511231023 2511370819 108
24 iso_pu_bacteria 2511231031 2511413656 108
25 iso_pu_bacteria 2511231156 2511826875 108
26 iso_pu_bacteria 2512047018 2512325829 108
27 iso_pu_bacteria 2554235341 2555667903 108
28 iso_pu_bacteria 2582580891 2583790360 108
29 iso_pu_bacteria 2597489887 2597856139 108
30 iso_pu_bacteria 2597489888 2597865903 108
31 iso_pu_bacteria 2597489889 2597871713 108
32 iso_pu_bacteria 2599185155 2599328123 108
33 iso_pu_bacteria 2599185160 2599354907 108
34 iso_pu_bacteria 2599185161 2599361268 108
35 iso_pu_bacteria 2599185162 2599367590 108
36 iso_pu_bacteria 2599185163 2599374380 108
37 iso_pu_bacteria 2599185164 2599380013 108
38 iso_pu_bacteria 2599185165 2599386460 108
39 iso_pu_bacteria 2599185166 2599393238 108
40 iso_pu_bacteria 2599185167 2599399732 108
41 iso_pu_bacteria 2599185168 2599405005 108
42 iso_pu_bacteria 2599185179 2599454430 108
43 iso_pu_bacteria 2599185181 2599461741 108
44 iso_pu_bacteria 2599185182 2599467215 108
45 iso_pu_bacteria 2599185185 2599483605 108
46 iso_pu_bacteria 2599185186 2599491166 108
47 iso_pu_bacteria 2599185188 2599502773 108
48 iso_pu_bacteria 2599185189 2599508382 108
49 iso_pu_bacteria 2599185190 2599515730 108
50 iso_pu_bacteria 2599185191 2599522028 108
51 iso_pu_bacteria 2599185212 2599614061 108
52 iso_pu_bacteria 2599185248 2599771400 108
53 iso_pu_bacteria 2599185257 2599805513 108
54 iso_pu_bacteria 2599185288 2599883419 108
55 iso_pu_bacteria 2599185289 2599888659 108
56 iso_pu_bacteria 2599185290 2599895108 108
57 iso_pu_bacteria 2599185291 2599900668 108
58 iso_pu_bacteria 2599185300 2599930197 108
59 iso_pu_bacteria 2599185302 2599943153 108
60 iso_pu_bacteria 2599185303 2599951276 108
61 iso_pu_bacteria 2599185304 2599953808 108
62 iso_pu_bacteria 2599185305 2599960912 108
63 iso_pu_bacteria 2599185306 2599966630 108
64 iso_pu_bacteria 2599185307 2599971765 108
65 iso_pu_bacteria 2599185308 2599977805 108
66 iso_pu_bacteria 2599185309 2599983354 108
67 iso_pu_bacteria 2599185310 2599987374 108
68 iso_pu_bacteria 2599185311 2599996305 108
69 iso_pu_bacteria 2599185312 2599999796 108
70 iso_pu_bacteria 2599185313 2600005794 108
71 iso_pu_bacteria 2599185314 2600011936 108
72 iso_pu_bacteria 2599185315 2600020562 108
73 iso_pu_bacteria 2599185316 2600024254 108
74 iso_pu_bacteria 2599185317 2600027943 108
75 iso_pu_bacteria 2599185318 2600033356 108
76 iso_pu_bacteria 2599185319 2600043386 108
77 iso_pu_bacteria 2599185320 2600045700 108
78 iso_pu_bacteria 2599185321 2600055247 108
79 iso_pu_bacteria 2599185322 2600060794 108
80 iso_pu_bacteria 2599185323 2600064155 108
81 iso_pu_bacteria 2599185324 2600071172 108
82 iso_pu_bacteria 2599185325 2600078714 108
83 iso_pu_bacteria 2599185356 2600214363 108
84 iso_pu_bacteria 2600254930 2600357110 108
85 iso_pu_bacteria 2600254931 2600366160 108
86 iso_pu_bacteria 2600255283 2601626062 108
87 iso_pu_bacteria 2600255296 2601692643 108
88 iso_pu_bacteria 2600255313 2601774932 108
89 iso_pu_bacteria 2600255318 2601800714 108
90 iso_pu_bacteria 2603880185 2606074778 108
91 iso_pu_bacteria 2603880199 2606127641 108
92 iso_pu_bacteria 2619619299 2621297583 108
93 iso_pu_bacteria 2623620443 2624478702 108
94 iso_pu_bacteria 2623620446 2624494234 108
95 iso_pu_bacteria 2643221565 2643844096 108
96 iso_pu_bacteria 2643221571 2643870046 108
97 iso_pu_bacteria 2643221589 2643957341 108
98 iso_pu_bacteria 2643221602 2644020934 108
99 iso_pu_bacteria 2643221633 2644187879 108
100 iso_pu_bacteria 2643221650 2644285881 108
101 iso_pu_bacteria 2643221713 2644623228 108
102 iso_pu_bacteria 2651869719 2652545005 108
103 iso_pu_bacteria 2667528170 2671092951 108
104 iso_pu_bacteria 2667528171 2671097509 108
105 iso_pu_bacteria 2667528176 2671125719 108
106 iso_pu_bacteria 2671180172 2671767751 108
107 iso_pu_bacteria 2675903420 2677898071 108
108 iso_pu_bacteria 2675903515 2678265247 108
109 iso_pu_bacteria 2713897148 2715750926 108
110 iso_pu_bacteria 2713897149 2715757420 108
111 iso_pu_bacteria 2718217725 2718632599 108
112 iso_pu_bacteria 2721755607 2723250641 108
113 iso_pu_bacteria 2738541265 2738671070 108
114 iso_pu_bacteria 2738541271 2738689421 108
115 iso_pu_bacteria 2738541282 2738749464 108
116 iso_pu_bacteria 2738541294 2738811750 108
117 iso_pu_bacteria 2738541303 2738858504 108
118 iso_pu_bacteria 2738541309 2738899110 108
119 iso_pu_bacteria 2738543004 2739200313 108
120 iso_pu_bacteria 2738543015 2739258261 108
121 iso_pu_bacteria 2738543016 2739265195 108
122 iso_pu_bacteria 2738543025 2739314769 108
123 iso_pu_bacteria 2740892503 2743735545 108
124 iso_pu_bacteria 2744054620 2745005704 108
125 iso_pu_bacteria 2773857670 2774120787 108
126 iso_pu_bacteria 2773857672 2774131856 108
127 iso_pu_bacteria 2773857673 2774136823 108
128 iso_pu_bacteria 2784132063 2784260574 108
129 iso_pu_bacteria 2784132072 2784313375 108
130 iso_pu_bacteria 2791355520 2794595455 108
131 iso_pu_bacteria 2808606361 2808853950 108
132 iso_pu_bacteria 2808606376 2808923243 108
133 iso_pu_bacteria 2808606377 2808928877 108
134 iso_pu_bacteria 2808606378 2808933982 108
135 iso_pu_bacteria 2808606380 2808945482 108
136 iso_pu_bacteria 2808606381 2808950998 108
137 iso_pu_bacteria 2808606382 2808956873 108
138 iso_pu_bacteria 2808606383 2808962617 108
139 iso_pu_bacteria 2808606385 2808980456 108
140 iso_pu_bacteria 2808606388 2808996177 108
141 iso_pu_bacteria 2808606389 2808997342 108
142 iso_pu_bacteria 2808606445 2809215647 108
143 iso_pu_bacteria 2811994881 2812370713 108
144 iso_pu_bacteria 2816332298 2817493289 108
145 iso_pu_bacteria 2818991456 2819658259 108
146 iso_pu_bacteria 2818991464 2819702592 108
147 iso_pu_bacteria 2825651385 2825655860 108
148 iso_pu_bacteria 2826581358 2826586765 108
149 iso_pu_bacteria 2834028612 2834034333 108
150 iso_pu_bacteria 2842815866 2842820970 108
151 iso_pu_bacteria 2842826826 2842829855 108
152 iso_pu_bacteria 2842832357 2842835821 108
153 iso_pu_bacteria 2842837860 2842841801 108
154 iso_pu_bacteria 2842843487 2842848051 108
155 iso_pu_bacteria 2842849001 2842853515 108
156 iso_pu_bacteria 2842854478 2842856265 108
157 iso_pu_bacteria 2844665904 2844668417 108
158 iso_pu_bacteria 2852612431 2852618723 108
159 iso_pu_bacteria 2852657418 2852661607 108
160 iso_pu_bacteria 2852667396 2852673781 108
161 iso_pu_bacteria 2860339153 2860343107 108
162 iso_pu_bacteria 2860867994 2860872325 108
163 iso_pu_bacteria 2878029506 2878030665 108
164 iso_pu_bacteria 2880230671 2880231577 108
165 iso_pu_bacteria 2904518522 2904523330 108
166 iso_pu_bacteria 2904550169 2904550948 108
167 iso_pu_bacteria 2908446538 2908451845 108
168 iso_pu_bacteria 2912963787 2912964606 108
169 iso_pu_bacteria 2913036834 2913037772 108
170 iso_pu_bacteria 2917070673 2917071665 108
171 iso_pu_bacteria 2917832318 2917833817 108
172 iso_pu_bacteria 2919063839 2919067392 108
173 iso_pu_bacteria 2919125081 2919128122 108
174 iso_pu_bacteria 2919385768 2919390845 108
175 iso_pu_bacteria 2919456309 2919458460 108
176 iso_pu_bacteria 2919481497 2919482647 108
177 iso_pu_bacteria 2919487758 2919492539 108
178 iso_pu_bacteria 2919697872 2919699850 108
179 iso_pu_bacteria 2923153595 2923154550 108
180 iso_pu_bacteria 2923519811 2923524816 108
181 iso_pu_bacteria 2923586266 2923590499 108
182 iso_pu_bacteria 2929144301 2929149169 108
183 iso_pu_bacteria 2929189879 2929194444 108
184 iso_pu_bacteria 2931369376 2931373418 108
185 iso_pu_bacteria 2931390751 2931395723 108
186 iso_pu_bacteria 2931396565 2931399351 108
187 iso_pu_bacteria 2935353572 2935353838 108
188 iso_pu_bacteria 2939636861 2939638272 108
189 iso_pu_bacteria 2939651529 2939652112 108
190 iso_pu_bacteria 2945928738 2945931605 108
191 iso_pu_bacteria 2945961074 2945961197 108
192 iso_pu_bacteria 2946006987 2946007690 108
193 iso_pu_bacteria 2947233263 2947233675 108
194 iso_pu_bacteria 2969304461 2969305492 108
195 iso_pu_bacteria 2974289157 2974292871 108
196 iso_pu_bacteria 2974298342 2974301285 108
197 iso_pu_bacteria 2984286254 2984291486 108
198 iso_pu_bacteria 2984499530 2984503762 108
199 iso_pu_bacteria 2984504281 2984507656 108
200 iso_pu_bacteria 2988728565 2988732733 108
201 iso_pu_bacteria 2990196909 2990197474 108
202 iso_pu_bacteria 2998139840 2998140935 108
203 iso_pu_bacteria 3007395558 3007400093 108
204 iso_pu_bacteria 3007419365 3007425035 108
205 iso_pu_bacteria 3007511990 3007512254 108
206 iso_pu_bacteria 3007614139 3007618611 108
207 iso_pu_bacteria 3007619802 3007623543 108
208 iso_pu_bacteria 3007718800 3007723941 108
209 iso_pu_bacteria 3007855910 3007860828 108
210 iso_pu_bacteria 3007861166 3007863845 108
211 iso_pu_bacteria 3007866637 3007867485 108
212 iso_pu_bacteria 637000220 637318286 108
213 iso_pu_bacteria 8015687852 8015688796 108
214 iso_pu_bacteria 8016728285 8016730204 108
215 iso_pu_bacteria 8019769354 8019772338 108
216 iso_pu_bacteria 8019775933 8019776516 108
217 iso_pu_bacteria 8029995093 8029999822 108
218 iso_pu_bacteria 8054285046 8054285343 108
219 iso_pu_bacteria 8054347763 8054351018 108
220 iso_pu_bacteria 8054503363 8054508228 108
221 iso_pu_bacteria 8055770955 8055771901 108
222 iso_pu_bacteria 8055817908 8055823173 108
223 iso_pu_bacteria 8055878733 8055881435 108
224 iso_pu_bacteria 8056115690 8056117157 108
225 iso_pu_bacteria 8056125926 8056126926 108
226 iso_pu_bacteria 8056131705 8056136585 108
227 iso_pu_bacteria 8056143049 8056144216 108
228 iso_pu_bacteria 8056148874 8056153361 108
229 iso_pu_bacteria 8056155041 8056161070 108
230 iso_pu_bacteria 8056161164 8056162872 108
231 iso_pu_bacteria 8056166840 8056170115 108
232 iso_pu_bacteria 8056172158 8056176250 108
233 iso_pu_bacteria 8056177738 8056180734 108
234 iso_pu_bacteria 8056569372 8056569588 108
235 iso_pu_bacteria 8057798959 8057803199 108
236 3300025292 Ga0209676_1025578 Ga0209676_10255782 111
237 3300048921 Ga0496118_0284842 Ga0496118_0284842_258_596 111
238 2124908027 MRS2a_Contig_375 MRS2a_00267820 112
239 2124908027 MRS2a_Contig_645 MRS2a_00507730 112
240 2124908027 MRS2a_Contig_64 MRS2a_00503020 112
241 2162886007 SwRhRL2b_contig_2334513 SwRhRL2b_0110.00004230 112
242 2162886007 SwRhRL2b_contig_2732885 SwRhRL2b_0535.00000420 112
243 3300002737 JGI25162J39368_1000101 JGI25162J39368_100010111 112
244 3300002737 JGI25162J39368_1000340 JGI25162J39368_100034032 112
245 3300002738 JGI25154J39366_1001925 JGI25154J39366_10019258 112
246 3300002771 JGI25163J39215_1001292 JGI25163J39215_10012923 112
247 3300002771 JGI25163J39215_1007976 JGI25163J39215_10079762 112
248 3300002771 JGI25163J39215_1008667 JGI25163J39215_10086672 112
249 3300002772 JGI25164J39214_1000097 JGI25164J39214_100009781 112
250 3300002772 JGI25164J39214_1000249 JGI25164J39214_100024932 112
251 3300003214 JGI25165J46597_1000184 JGI25165J46597_100018411 112
252 3300003214 JGI25165J46597_1000459 JGI25165J46597_100045932 112
253 3300003578 Ga0006562J51391_1109558 Ga0006562J51391_11095583 112
254 3300003751 Ga0055538_1000028 Ga0055538_1000028166 112
255 3300003752 Ga0055539_1000037 Ga0055539_1000037166 112
256 3300003756 Ga0055533_1000047 Ga0055533_1000047166 112
257 3300003758 Ga0055532_1000065 Ga0055532_100006550 112
258 3300003759 Ga0055525_1000176 Ga0055525_100017650 112
259 3300003761 Ga0055535_1003531 Ga0055535_10035315 112
260 3300003781 Ga0055536_1000172 Ga0055536_100017246 112
261 3300003781 Ga0055536_1000304 Ga0055536_10003046 112
262 3300003791 Ga0055530_10000300 Ga0055530_1000030011 112
263 3300003791 Ga0055530_10000403 Ga0055530_100004038 112
264 3300003791 Ga0055530_10001892 Ga0055530_1000189214 112
265 3300003792 Ga0055540_1000359 Ga0055540_10003598 112
266 3300003792 Ga0055540_1000376 Ga0055540_10003767 112
267 3300003792 Ga0055540_1000804 Ga0055540_100080423 112
268 3300003794 Ga0055531_10000346 Ga0055531_100003467 112
269 3300003794 Ga0055531_10004491 Ga0055531_100044914 112
270 3300003841 Ga0055541_1000025 Ga0055541_1000025166 112
271 3300005288 Ga0065714_10002230 Ga0065714_1000223039 112
272 3300005288 Ga0065714_10003116 Ga0065714_100031169 112
273 3300005288 Ga0065714_10007472 Ga0065714_100074721 112
274 3300005288 Ga0065714_10009326 Ga0065714_100093262 112
275 3300005288 Ga0065714_10016556 Ga0065714_100165564 112
276 3300005288 Ga0065714_10019691 Ga0065714_100196911 112
277 3300005288 Ga0065714_10045194 Ga0065714_100451941 112
278 3300005288 Ga0065714_10066201 Ga0065714_100662017 112
279 3300005288 Ga0065714_10086184 Ga0065714_100861842 112
280 3300005288 Ga0065714_10101026 Ga0065714_101010262 112
281 3300005288 Ga0065714_10102128 Ga0065714_101021282 112
282 3300005288 Ga0065714_10105471 Ga0065714_101054712 112
283 3300005288 Ga0065714_10127095 Ga0065714_101270953 112
284 3300005288 Ga0065714_10323357 Ga0065714_103233572 112
285 3300005289 Ga0065704_10084734 Ga0065704_100847345 112
286 3300005289 Ga0065704_10192074 Ga0065704_101920742 112
287 3300005289 Ga0065704_10265448 Ga0065704_102654482 112
288 3300005289 Ga0065704_10473984 Ga0065704_104739842 112
289 3300005289 Ga0065704_10488205 Ga0065704_104882051 112
290 3300005289 Ga0065704_10496400 Ga0065704_104964001 112
291 3300005290 Ga0065712_10067858 Ga0065712_100678582 112
292 3300005290 Ga0065712_10317748 Ga0065712_103177482 112
293 3300005293 Ga0065715_10007881 Ga0065715_100078815 112
294 3300005328 Ga0070676_10109649 Ga0070676_101096491 112
295 3300005331 Ga0070670_100000553 Ga0070670_1000005539 112
296 3300005344 Ga0070661_100000056 Ga0070661_10000005636 112
297 3300005353 Ga0070669_100000850 Ga0070669_10000085013 112
298 3300005353 Ga0070669_100000901 Ga0070669_10000090122 112
299 3300005355 Ga0070671_100959924 Ga0070671_1009599242 112
300 3300005367 Ga0070667_101368219 Ga0070667_1013682192 112
301 3300005457 Ga0070662_100000828 Ga0070662_10000082816 112
302 3300005457 Ga0070662_100064564 Ga0070662_1000645644 112
303 3300005457 Ga0070662_100817395 Ga0070662_1008173952 112
304 3300005535 Ga0070684_101944719 Ga0070684_1019447191 112
305 3300005548 Ga0070665_100047133 Ga0070665_1000471335 112
306 3300005548 Ga0070665_100058500 Ga0070665_1000585006 112
307 3300005548 Ga0070665_101590496 Ga0070665_1015904961 112
308 3300005564 Ga0070664_100000332 Ga0070664_10000033228 112
309 3300005564 Ga0070664_100069440 Ga0070664_1000694404 112
310 3300005578 Ga0068854_100003050 Ga0068854_10000305016 112
311 3300005834 Ga0068851_10000032 Ga0068851_1000003258 112
312 3300006051 Ga0075364_10015210 Ga0075364_100152102 112
313 3300006051 Ga0075364_10044770 Ga0075364_100447704 112
314 3300006051 Ga0075364_10324372 Ga0075364_103243721 112
315 3300006051 Ga0075364_10329171 Ga0075364_103291712 112
316 3300006051 Ga0075364_10543251 Ga0075364_105432512 112
317 3300006051 Ga0075364_10558476 Ga0075364_105584761 112
318 3300006058 Ga0075432_10003081 Ga0075432_100030815 112
319 3300006058 Ga0075432_10006882 Ga0075432_100068823 112
320 3300006058 Ga0075432_10080664 Ga0075432_100806642 112
321 3300006058 Ga0075432_10080986 Ga0075432_100809863 112
322 3300006058 Ga0075432_10356036 Ga0075432_103560362 112
323 3300006058 Ga0075432_10358811 Ga0075432_103588111 112
324 3300006177 Ga0075362_10096371 Ga0075362_100963714 112
325 3300006177 Ga0075362_10128112 Ga0075362_101281123 112
326 3300006186 Ga0075369_10068611 Ga0075369_100686113 112
327 3300006353 Ga0075370_10746931 Ga0075370_107469311 112
328 3300006914 Ga0075436_100218400 Ga0075436_1002184002 112
329 3300006914 Ga0075436_101070468 Ga0075436_1010704681 112
330 3300006946 Ga0079104_1000259 Ga0079104_100025913 112
331 3300006946 Ga0079104_1000332 Ga0079104_100033248 112
332 3300006946 Ga0079104_1005361 Ga0079104_10053618 112
333 3300006946 Ga0079104_1028715 Ga0079104_10287152 112
334 3300006946 Ga0079104_1055335 Ga0079104_10553352 112
335 3300006948 Ga0099826_10022026 Ga0099826_100220266 112
336 3300009011 Ga0105251_10000012 Ga0105251_1000001286 112
337 3300009011 Ga0105251_10000023 Ga0105251_1000002372 112
338 3300009011 Ga0105251_10000421 Ga0105251_100004213 112
339 3300009011 Ga0105251_10001064 Ga0105251_100010642 112
340 3300009011 Ga0105251_10004783 Ga0105251_100047837 112
341 3300009011 Ga0105251_10005326 Ga0105251_100053263 112
342 3300009011 Ga0105251_10005631 Ga0105251_1000563112 112
343 3300009011 Ga0105251_10045330 Ga0105251_100453303 112
344 3300009011 Ga0105251_10054519 Ga0105251_100545193 112
345 3300009011 Ga0105251_10098581 Ga0105251_100985812 112
346 3300009011 Ga0105251_10174683 Ga0105251_101746832 112
347 3300009011 Ga0105251_10338456 Ga0105251_103384562 112
348 3300009036 Ga0105244_10007748 Ga0105244_100077482 112
349 3300009036 Ga0105244_10010899 Ga0105244_100108992 112
350 3300009036 Ga0105244_10015058 Ga0105244_100150584 112
351 3300009036 Ga0105244_10015138 Ga0105244_100151388 112
352 3300009036 Ga0105244_10035142 Ga0105244_100351423 112
353 3300009036 Ga0105244_10071164 Ga0105244_100711644 112
354 3300009036 Ga0105244_10101422 Ga0105244_101014222 112
355 3300009036 Ga0105244_10126824 Ga0105244_101268243 112
356 3300009036 Ga0105244_10155536 Ga0105244_101555363 112
357 3300009036 Ga0105244_10171780 Ga0105244_101717802 112
358 3300009036 Ga0105244_10171842 Ga0105244_101718422 112
359 3300009036 Ga0105244_10193851 Ga0105244_101938512 112
360 3300009036 Ga0105244_10201216 Ga0105244_102012162 112
361 3300009036 Ga0105244_10268640 Ga0105244_102686401 112
362 3300009036 Ga0105244_10363162 Ga0105244_103631622 112
363 3300009036 Ga0105244_10384132 Ga0105244_103841321 112
364 3300009036 Ga0105244_10405845 Ga0105244_104058451 112
365 3300009036 Ga0105244_10536737 Ga0105244_105367371 112
366 3300009092 Ga0105250_10000366 Ga0105250_1000036629 112
367 3300009092 Ga0105250_10000494 Ga0105250_100004948 112
368 3300009092 Ga0105250_10000567 Ga0105250_100005672 112
369 3300009092 Ga0105250_10005062 Ga0105250_100050629 112
370 3300009092 Ga0105250_10021477 Ga0105250_100214775 112
371 3300009092 Ga0105250_10036837 Ga0105250_100368372 112
372 3300009092 Ga0105250_10048060 Ga0105250_100480602 112
373 3300009092 Ga0105250_10075508 Ga0105250_100755082 112
374 3300009148 Ga0105243_10000136 Ga0105243_100001367 112
375 3300009148 Ga0105243_10000821 Ga0105243_100008212 112
376 3300009148 Ga0105243_10005639 Ga0105243_100056395 112
377 3300009148 Ga0105243_10141922 Ga0105243_101419222 112
378 3300009148 Ga0105243_10457832 Ga0105243_104578323 112
379 3300009176 Ga0105242_10005336 Ga0105242_1000533615 112
380 3300009176 Ga0105242_10087991 Ga0105242_100879913 112
381 3300009177 Ga0105248_10076617 Ga0105248_100766172 112
382 3300009545 Ga0105237_10001335 Ga0105237_1000133510 112
383 3300009545 Ga0105237_10653049 Ga0105237_106530493 112
384 3300009553 Ga0105249_10034194 Ga0105249_100341945 112
385 3300010375 Ga0105239_11222763 Ga0105239_112227632 112
386 3300011119 Ga0105246_10000928 Ga0105246_100009281 112
387 3300011119 Ga0105246_10003502 Ga0105246_100035022 112
388 3300011119 Ga0105246_10005437 Ga0105246_100054374 112
389 3300011119 Ga0105246_10041202 Ga0105246_100412023 112
390 3300011119 Ga0105246_10367519 Ga0105246_103675191 112
391 3300011119 Ga0105246_11881466 Ga0105246_118814661 112
392 3300011119 Ga0105246_12521438 Ga0105246_125214382 112
393 3300012483 Ga0157337_1005319 Ga0157337_10053191 112
394 3300012498 Ga0157345_1000089 Ga0157345_100008922 112
395 3300012502 Ga0157347_1004780 Ga0157347_10047802 112
396 3300013100 Ga0157373_10000627 Ga0157373_1000062722 112
397 3300013100 Ga0157373_10074164 Ga0157373_100741643 112
398 3300013100 Ga0157373_10101055 Ga0157373_101010553 112
399 3300013100 Ga0157373_10122230 Ga0157373_101222302 112
400 3300013100 Ga0157373_10152943 Ga0157373_101529433 112
401 3300013100 Ga0157373_10155145 Ga0157373_101551452 112
402 3300013100 Ga0157373_10177562 Ga0157373_101775622 112
403 3300013100 Ga0157373_10326211 Ga0157373_103262112 112
404 3300013100 Ga0157373_10367551 Ga0157373_103675512 112
405 3300013102 Ga0157371_10000227 Ga0157371_1000022749 112
406 3300013102 Ga0157371_10000278 Ga0157371_1000027859 112
407 3300013102 Ga0157371_10001992 Ga0157371_100019923 112
408 3300013102 Ga0157371_10002027 Ga0157371_100020272 112
409 3300013102 Ga0157371_10233818 Ga0157371_102338182 112
410 3300013102 Ga0157371_10269450 Ga0157371_102694503 112
411 3300013102 Ga0157371_11226318 Ga0157371_112263182 112
412 3300013104 Ga0157370_10044973 Ga0157370_100449735 112
413 3300013104 Ga0157370_10157289 Ga0157370_101572891 112
414 3300013104 Ga0157370_10170726 Ga0157370_101707262 112
415 3300013104 Ga0157370_10291896 Ga0157370_102918964 112
416 3300013104 Ga0157370_10301531 Ga0157370_103015314 112
417 3300013104 Ga0157370_10341809 Ga0157370_103418093 112
418 3300013104 Ga0157370_10640221 Ga0157370_106402212 112
419 3300013104 Ga0157370_10860737 Ga0157370_108607373 112
420 3300013104 Ga0157370_11408882 Ga0157370_114088822 112
421 3300013105 Ga0157369_10005304 Ga0157369_100053043 112
422 3300013105 Ga0157369_10005555 Ga0157369_100055553 112
423 3300013105 Ga0157369_10014083 Ga0157369_100140839 112
424 3300013105 Ga0157369_10070212 Ga0157369_100702122 112
425 3300013105 Ga0157369_10191307 Ga0157369_101913073 112
426 3300013105 Ga0157369_10366580 Ga0157369_103665802 112
427 3300013306 Ga0163162_10006260 Ga0163162_1000626016 112
428 3300013306 Ga0163162_10025982 Ga0163162_100259826 112
429 3300013306 Ga0163162_10369315 Ga0163162_103693154 112
430 3300013306 Ga0163162_11902043 Ga0163162_119020431 112
431 3300013307 Ga0157372_10022880 Ga0157372_100228802 112
432 3300013307 Ga0157372_11123987 Ga0157372_111239872 112
433 3300013308 Ga0157375_10001083 Ga0157375_1000108324 112
434 3300013308 Ga0157375_10273285 Ga0157375_102732852 112
435 3300013308 Ga0157375_10281417 Ga0157375_102814172 112
436 3300013308 Ga0157375_10986472 Ga0157375_109864722 112
437 3300014497 Ga0182008_10000305 Ga0182008_1000030531 112
438 3300014497 Ga0182008_10002373 Ga0182008_1000237311 112
439 3300014497 Ga0182008_10003708 Ga0182008_1000370812 112
440 3300014497 Ga0182008_10012970 Ga0182008_100129703 112
441 3300014497 Ga0182008_10020816 Ga0182008_100208164 112
442 3300014497 Ga0182008_10078160 Ga0182008_100781602 112
443 3300014497 Ga0182008_10083288 Ga0182008_100832883 112
444 3300014497 Ga0182008_10214141 Ga0182008_102141412 112
445 3300014497 Ga0182008_10471333 Ga0182008_104713332 112
446 3300014497 Ga0182008_10907932 Ga0182008_109079322 112
447 3300015261 Ga0182006_1000667 Ga0182006_100066717 112
448 3300015261 Ga0182006_1007434 Ga0182006_10074342 112
449 3300015261 Ga0182006_1008825 Ga0182006_10088252 112
450 3300015261 Ga0182006_1031205 Ga0182006_10312052 112
451 3300015261 Ga0182006_1088175 Ga0182006_10881752 112
452 3300015261 Ga0182006_1178246 Ga0182006_11782462 112
453 3300015261 Ga0182006_1180544 Ga0182006_11805442 112
454 3300015261 Ga0182006_1180546 Ga0182006_11805462 112
455 3300015261 Ga0182006_1308035 Ga0182006_13080352 112
456 3300015262 Ga0182007_10000462 Ga0182007_1000046217 112
457 3300015262 Ga0182007_10046924 Ga0182007_100469242 112
458 3300015262 Ga0182007_10080615 Ga0182007_100806152 112
459 3300015265 Ga0182005_1001060 Ga0182005_10010607 112
460 3300015265 Ga0182005_1001702 Ga0182005_10017028 112
461 3300015265 Ga0182005_1005551 Ga0182005_10055515 112
462 3300015265 Ga0182005_1006496 Ga0182005_10064963 112
463 3300015265 Ga0182005_1095910 Ga0182005_10959101 112
464 3300015265 Ga0182005_1100184 Ga0182005_11001842 112
465 3300015265 Ga0182005_1137146 Ga0182005_11371462 112
466 3300017792 Ga0163161_10040179 Ga0163161_100401793 112
467 3300017792 Ga0163161_10099695 Ga0163161_100996953 112
468 3300017792 Ga0163161_10112792 Ga0163161_101127924 112
469 3300017792 Ga0163161_10189551 Ga0163161_101895513 112
470 3300017792 Ga0163161_10209371 Ga0163161_102093712 112
471 3300017792 Ga0163161_10231181 Ga0163161_102311814 112
472 3300017792 Ga0163161_10275396 Ga0163161_102753963 112
473 3300017792 Ga0163161_10315422 Ga0163161_103154221 112
474 3300017792 Ga0163161_10345438 Ga0163161_103454381 112
475 3300017792 Ga0163161_10508162 Ga0163161_105081622 112
476 3300017792 Ga0163161_10625752 Ga0163161_106257522 112
477 3300017792 Ga0163161_11134202 Ga0163161_111342022 112
478 3300017792 Ga0163161_11136475 Ga0163161_111364752 112
479 3300025206 Ga0209435_104127 Ga0209435_1041271 112
480 3300025207 Ga0209760_100003 Ga0209760_100003215 112
481 3300025207 Ga0209760_100198 Ga0209760_1001981 112
482 3300025224 Ga0209784_100032 Ga0209784_10003252 112
483 3300025225 Ga0209566_100036 Ga0209566_10003652 112
484 3300025226 Ga0209674_100054 Ga0209674_10005452 112
485 3300025229 Ga0209147_100055 Ga0209147_10005552 112
486 3300025230 Ga0209563_100055 Ga0209563_100055254 112
487 3300025230 Ga0209563_101310 Ga0209563_1013105 112
488 3300025231 Ga0207427_100001 Ga0207427_100001107 112
489 3300025231 Ga0207427_100004 Ga0207427_100004489 112
490 3300025233 Ga0209437_100003 Ga0209437_1000031265 112
491 3300025233 Ga0209437_100028 Ga0209437_100028325 112
492 3300025233 Ga0209437_110663 Ga0209437_1106634 112
493 3300025242 Ga0209258_100239 Ga0209258_10023946 112
494 3300025246 Ga0209646_1000206 Ga0209646_100020668 112
495 3300025253 Ga0209677_100033 Ga0209677_10003352 112
496 3300025256 Ga0209759_1004897 Ga0209759_10048974 112
497 3300025261 Ga0209233_1000007 Ga0209233_1000007107 112
498 3300025261 Ga0209233_1000008 Ga0209233_10000081036 112
499 3300025291 Ga0209675_1005466 Ga0209675_10054665 112
500 3300025292 Ga0209676_1000056 Ga0209676_1000056227 112
501 3300025292 Ga0209676_1000078 Ga0209676_1000078132 112
502 3300025292 Ga0209676_1000101 Ga0209676_100010154 112
503 3300025292 Ga0209676_1017914 Ga0209676_10179142 112
504 3300025292 Ga0209676_1037940 Ga0209676_10379401 112
505 3300025298 Ga0209050_1000027 Ga0209050_1000027363 112
506 3300025298 Ga0209050_1000041 Ga0209050_1000041164 112
507 3300025298 Ga0209050_1000181 Ga0209050_1000181128 112
508 3300025298 Ga0209050_1000560 Ga0209050_100056015 112
509 3300025303 Ga0209051_1000061 Ga0209051_1000061227 112
510 3300025303 Ga0209051_1000085 Ga0209051_1000085164 112
511 3300025303 Ga0209051_1000102 Ga0209051_100010277 112
512 3300025304 Ga0209257_1000105 Ga0209257_1000105115 112
513 3300025304 Ga0209257_1005839 Ga0209257_10058393 112
514 3300025304 Ga0209257_1054801 Ga0209257_10548012 112
515 3300025321 Ga0207656_10000031 Ga0207656_1000003123 112
516 3300025711 Ga0207696_1000032 Ga0207696_100003234 112
517 3300025711 Ga0207696_1000138 Ga0207696_100013849 112
518 3300025711 Ga0207696_1000220 Ga0207696_100022026 112
519 3300025711 Ga0207696_1013055 Ga0207696_10130551 112
520 3300025711 Ga0207696_1015991 Ga0207696_10159913 112
521 3300025711 Ga0207696_1018171 Ga0207696_10181714 112
522 3300025711 Ga0207696_1020710 Ga0207696_10207102 112
523 3300025711 Ga0207696_1020847 Ga0207696_10208472 112
524 3300025711 Ga0207696_1024229 Ga0207696_10242292 112
525 3300025728 Ga0207655_1000021 Ga0207655_1000021150 112
526 3300025728 Ga0207655_1000257 Ga0207655_100025785 112
527 3300025728 Ga0207655_1001258 Ga0207655_100125817 112
528 3300025728 Ga0207655_1002577 Ga0207655_10025772 112
529 3300025728 Ga0207655_1003032 Ga0207655_100303213 112
530 3300025728 Ga0207655_1003182 Ga0207655_100318211 112
531 3300025728 Ga0207655_1003932 Ga0207655_10039325 112
532 3300025728 Ga0207655_1007026 Ga0207655_10070268 112
533 3300025728 Ga0207655_1007453 Ga0207655_10074532 112
534 3300025728 Ga0207655_1019351 Ga0207655_10193513 112
535 3300025728 Ga0207655_1023307 Ga0207655_10233074 112
536 3300025728 Ga0207655_1025504 Ga0207655_10255043 112
537 3300025728 Ga0207655_1027034 Ga0207655_10270342 112
538 3300025728 Ga0207655_1040084 Ga0207655_10400841 112
539 3300025728 Ga0207655_1046627 Ga0207655_10466272 112
540 3300025728 Ga0207655_1060684 Ga0207655_10606843 112
541 3300025728 Ga0207655_1066750 Ga0207655_10667503 112
542 3300025728 Ga0207655_1227583 Ga0207655_12275831 112
543 3300025735 Ga0207713_1000078 Ga0207713_1000078110 112
544 3300025735 Ga0207713_1000080 Ga0207713_100008087 112
545 3300025735 Ga0207713_1000791 Ga0207713_10007919 112
546 3300025735 Ga0207713_1001157 Ga0207713_100115711 112
547 3300025735 Ga0207713_1001332 Ga0207713_100133211 112
548 3300025735 Ga0207713_1001521 Ga0207713_100152118 112
549 3300025735 Ga0207713_1001765 Ga0207713_100176510 112
550 3300025735 Ga0207713_1005019 Ga0207713_10050192 112
551 3300025735 Ga0207713_1008570 Ga0207713_10085706 112
552 3300025735 Ga0207713_1015520 Ga0207713_10155202 112
553 3300025735 Ga0207713_1023295 Ga0207713_10232952 112
554 3300025735 Ga0207713_1084689 Ga0207713_10846892 112
555 3300025735 Ga0207713_1095753 Ga0207713_10957533 112
556 3300025735 Ga0207713_1097646 Ga0207713_10976462 112
557 3300025735 Ga0207713_1136833 Ga0207713_11368332 112
558 3300025907 Ga0207645_10196546 Ga0207645_101965464 112
559 3300025914 Ga0207671_10000034 Ga0207671_10000034204 112
560 3300025914 Ga0207671_10482328 Ga0207671_104823283 112
561 3300025920 Ga0207649_10000006 Ga0207649_1000000650 112
562 3300025923 Ga0207681_10000095 Ga0207681_1000009519 112
563 3300025923 Ga0207681_10000343 Ga0207681_1000034331 112
564 3300025925 Ga0207650_10000472 Ga0207650_100004729 112
565 3300025931 Ga0207644_10682530 Ga0207644_106825302 112
566 3300025933 Ga0207706_10000839 Ga0207706_1000083924 112
567 3300025933 Ga0207706_10006334 Ga0207706_100063344 112
568 3300025933 Ga0207706_10653520 Ga0207706_106535202 112
569 3300025934 Ga0207686_10000628 Ga0207686_1000062811 112
570 3300025935 Ga0207709_10000067 Ga0207709_10000067127 112
571 3300025935 Ga0207709_10001847 Ga0207709_100018475 112
572 3300025935 Ga0207709_10562874 Ga0207709_105628742 112
573 3300025941 Ga0207711_10051287 Ga0207711_100512876 112
574 3300025945 Ga0207679_10000010 Ga0207679_1000001050 112
575 3300025945 Ga0207679_10036552 Ga0207679_100365522 112
576 3300025961 Ga0207712_10027077 Ga0207712_100270775 112
577 3300025981 Ga0207640_10709441 Ga0207640_107094412 112
578 3300027111 Ga0209281_1000013 Ga0209281_100001375 112
579 3300027111 Ga0209281_1000015 Ga0209281_1000015221 112
580 3300027111 Ga0209281_1002154 Ga0209281_100215411 112
581 3300027111 Ga0209281_1012079 Ga0209281_10120792 112
582 3300027111 Ga0209281_1067716 Ga0209281_10677161 112
583 3300027312 Ga0209371_1054876 Ga0209371_10548762 112
584 3300027617 Ga0210002_1030864 Ga0210002_10308641 112
585 3300027876 Ga0209974_10120420 Ga0209974_101204202 112
586 3300027907 Ga0207428_10013466 Ga0207428_100134664 112
587 3300027907 Ga0207428_10045496 Ga0207428_100454964 112
588 3300027907 Ga0207428_10060355 Ga0207428_100603552 112
589 3300027907 Ga0207428_10060822 Ga0207428_100608223 112
590 3300027907 Ga0207428_10072910 Ga0207428_100729103 112
591 3300027907 Ga0207428_10115847 Ga0207428_101158472 112
592 3300027907 Ga0207428_10214376 Ga0207428_102143763 112
593 3300027907 Ga0207428_10252144 Ga0207428_102521441 112
594 3300027907 Ga0207428_10259865 Ga0207428_102598652 112
595 3300027907 Ga0207428_11310626 Ga0207428_113106261 112
596 3300028379 Ga0268266_10017099 Ga0268266_100170998 112
597 3300028379 Ga0268266_10074015 Ga0268266_100740154 112
598 3300028379 Ga0268266_11123075 Ga0268266_111230752 112
599 3300028786 Ga0307517_10267002 Ga0307517_102670022 112
600 3300028794 Ga0307515_10675740 Ga0307515_106757402 112
601 3300030500 Ga0268256_1061581 Ga0268256_10615812 112
602 3300030521 Ga0307511_10015382 Ga0307511_100153827 112
603 3300030521 Ga0307511_10203545 Ga0307511_102035451 112
604 3300030521 Ga0307511_10374045 Ga0307511_103740452 112
605 3300030731 Ga0316177_1148087 Ga0316177_11480874 112
606 3300030734 Ga0316179_1041814 Ga0316179_10418142 112
607 3300030735 Ga0316178_1023745 Ga0316178_102374522 112
608 3300030742 Ga0316183_1146492 Ga0316183_11464924 112
609 3300030744 Ga0316181_1098331 Ga0316181_10983313 112
610 3300031344 Ga0265316_10224998 Ga0265316_102249982 112
611 3300031548 Ga0307408_100000409 Ga0307408_1000004093 112
612 3300031548 Ga0307408_100097276 Ga0307408_1000972763 112
613 3300031548 Ga0307408_100127692 Ga0307408_1001276923 112
614 3300031548 Ga0307408_100144911 Ga0307408_1001449112 112
615 3300031548 Ga0307408_100230544 Ga0307408_1002305444 112
616 3300031548 Ga0307408_100438334 Ga0307408_1004383342 112
617 3300031730 Ga0307516_10226628 Ga0307516_102266282 112
618 3300031730 Ga0307516_10345090 Ga0307516_103450901 112
619 3300031731 Ga0307405_10000167 Ga0307405_1000016723 112
620 3300031731 Ga0307405_10029583 Ga0307405_100295834 112
621 3300031731 Ga0307405_10061714 Ga0307405_100617142 112
622 3300031731 Ga0307405_10168002 Ga0307405_101680024 112
623 3300031731 Ga0307405_10260772 Ga0307405_102607722 112
624 3300031731 Ga0307405_10316329 Ga0307405_103163293 112
625 3300031824 Ga0307413_10082890 Ga0307413_100828902 112
626 3300031824 Ga0307413_10120977 Ga0307413_101209772 112
627 3300031824 Ga0307413_10187132 Ga0307413_101871322 112
628 3300031852 Ga0307410_11379774 Ga0307410_113797742 112
629 3300031901 Ga0307406_10028388 Ga0307406_100283885 112
630 3300031901 Ga0307406_11409890 Ga0307406_114098901 112
631 3300031903 Ga0307407_10021391 Ga0307407_100213914 112
632 3300031903 Ga0307407_10473370 Ga0307407_104733701 112
633 3300031911 Ga0307412_10001543 Ga0307412_100015432 112
634 3300031911 Ga0307412_10002237 Ga0307412_100022373 112
635 3300031911 Ga0307412_10158067 Ga0307412_101580672 112
636 3300031911 Ga0307412_10176452 Ga0307412_101764522 112
637 3300031911 Ga0307412_10180181 Ga0307412_101801812 112
638 3300031911 Ga0307412_10400982 Ga0307412_104009822 112
639 3300031911 Ga0307412_10453089 Ga0307412_104530893 112
640 3300031911 Ga0307412_11105709 Ga0307412_111057092 112
641 3300031995 Ga0307409_100013576 Ga0307409_1000135764 112
642 3300031995 Ga0307409_100061063 Ga0307409_1000610632 112
643 3300032002 Ga0307416_100149529 Ga0307416_1001495292 112
644 3300032002 Ga0307416_101533133 Ga0307416_1015331332 112
645 3300032002 Ga0307416_102946916 Ga0307416_1029469161 112
646 3300032004 Ga0307414_10011732 Ga0307414_100117328 112
647 3300032004 Ga0307414_10041752 Ga0307414_100417523 112
648 3300032004 Ga0307414_10109734 Ga0307414_101097343 112
649 3300032004 Ga0307414_10123935 Ga0307414_101239352 112
650 3300032004 Ga0307414_10352612 Ga0307414_103526121 112
651 3300032004 Ga0307414_10988334 Ga0307414_109883341 112
652 3300032004 Ga0307414_11040742 Ga0307414_110407421 112
653 3300032005 Ga0307411_10027670 Ga0307411_100276704 112
654 3300032005 Ga0307411_10266351 Ga0307411_102663512 112
655 3300032005 Ga0307411_10953101 Ga0307411_109531012 112
656 3300032005 Ga0307411_11150730 Ga0307411_111507301 112
657 3300033180 Ga0307510_10000622 Ga0307510_1000062226 112
658 3300033180 Ga0307510_10400910 Ga0307510_104009102 112
659 3300038705 Ga0237819_13930 Ga0237819_13930_68_406 112
660 3300041404 Ga0439436_0002599 Ga0439436_0002599_1340_1681 112
661 3300041405 Ga0439438_001568 Ga0439438_001568_7425_7766 112
662 3300041405 Ga0439438_002168 Ga0439438_002168_519_857 112
663 3300041405 Ga0439438_003359 Ga0439438_003359_3810_4148 112
664 3300041405 Ga0439438_003862 Ga0439438_003862_5024_5362 112
665 3300041405 Ga0439438_006293 Ga0439438_006293_1947_2285 112
666 3300041405 Ga0439438_009242 Ga0439438_009242_2049_2387 112
667 3300041405 Ga0439438_009256 Ga0439438_009256_840_1178 112
668 3300041405 Ga0439438_010511 Ga0439438_010511_1866_2204 112
669 3300041405 Ga0439438_012437 Ga0439438_012437_79_417 112
670 3300041405 Ga0439438_017805 Ga0439438_017805_92_430 112
671 3300041407 Ga0439447_000159 Ga0439447_000159_12759_13097 112
672 3300041407 Ga0439447_002444 Ga0439447_002444_4277_4615 112
673 3300041407 Ga0439447_002454 Ga0439447_002454_4312_4650 112
674 3300041407 Ga0439447_002516 Ga0439447_002516_1819_2157 112
675 3300041407 Ga0439447_002897 Ga0439447_002897_2409_2747 112
676 3300041407 Ga0439447_008814 Ga0439447_008814_2317_2655 112
677 3300041407 Ga0439447_009042 Ga0439447_009042_14_355 112
678 3300041407 Ga0439447_022547 Ga0439447_022547_793_1131 112
679 3300041407 Ga0439447_023808 Ga0439447_023808_687_1025 112
680 3300041407 Ga0439447_041372 Ga0439447_041372_252_590 112
681 3300041407 Ga0439447_041498 Ga0439447_041498_484_825 112
682 3300041407 Ga0439447_059409 Ga0439447_059409_32_370 112
683 3300041411 Ga0439466_0000261 Ga0439466_0000261_19806_20144 112
684 3300041411 Ga0439466_0000898 Ga0439466_0000898_8252_8590 112
685 3300041411 Ga0439466_0001557 Ga0439466_0001557_1665_2003 112
686 3300041411 Ga0439466_0003475 Ga0439466_0003475_5631_5969 112
687 3300041411 Ga0439466_0004614 Ga0439466_0004614_590_928 112
688 3300041411 Ga0439466_0016184 Ga0439466_0016184_263_601 112
689 3300041411 Ga0439466_0024682 Ga0439466_0024682_1574_1912 112
690 3300041411 Ga0439466_0026643 Ga0439466_0026643_1633_1971 112
691 3300041411 Ga0439466_0044803 Ga0439466_0044803_523_861 112
692 3300041411 Ga0439466_0056722 Ga0439466_0056722_144_485 112
693 3300041411 Ga0439466_0107518 Ga0439466_0107518_460_798 112
694 3300041413 Ga0439465_0032062 Ga0439465_0032062_478_816 112
695 3300041494 Ga0451837_0241277 Ga0451837_0241277_238_582 112
696 3300041494 Ga0451837_1405162 Ga0451837_1405162_135_476 112
697 3300041498 Ga0451841_1463478 Ga0451841_1463478_177_515 112
698 3300041997 Ga0439431_0032289 Ga0439431_0032289_654_992 112
699 3300041997 Ga0439431_0105426 Ga0439431_0105426_326_667 112
700 3300042004 Ga0439445_0040012 Ga0439445_0040012_596_934 112
701 3300042004 Ga0439445_0278635 Ga0439445_0278635_62_403 112
702 3300042006 Ga0439432_000956 Ga0439432_000956_2385_2723 112
703 3300042006 Ga0439432_001905 Ga0439432_001905_824_1165 112
704 3300042006 Ga0439432_001918 Ga0439432_001918_6971_7309 112
705 3300042006 Ga0439432_002283 Ga0439432_002283_6308_6646 112
706 3300042006 Ga0439432_005740 Ga0439432_005740_352_690 112
707 3300042006 Ga0439432_008751 Ga0439432_008751_1459_1800 112
708 3300042006 Ga0439432_010291 Ga0439432_010291_500_838 112
709 3300042006 Ga0439432_020136 Ga0439432_020136_1620_1958 112
710 3300042006 Ga0439432_020756 Ga0439432_020756_1669_2007 112
711 3300042009 Ga0439451_000925 Ga0439451_000925_4624_4962 112
712 3300042009 Ga0439451_006434 Ga0439451_006434_2005_2343 112
713 3300042009 Ga0439451_009564 Ga0439451_009564_21_359 112
714 3300042009 Ga0439451_009805 Ga0439451_009805_1536_1874 112
715 3300042009 Ga0439451_035017 Ga0439451_035017_586_924 112
716 3300042009 Ga0439451_087952 Ga0439451_087952_173_511 112
717 3300042010 Ga0439452_000100 Ga0439452_000100_10596_10934 112
718 3300042010 Ga0439452_000252 Ga0439452_000252_24521_24859 112
719 3300042010 Ga0439452_000783 Ga0439452_000783_9575_9913 112
720 3300042010 Ga0439452_001211 Ga0439452_001211_6358_6696 112
721 3300042010 Ga0439452_003769 Ga0439452_003769_750_1088 112
722 3300042010 Ga0439452_004463 Ga0439452_004463_2130_2468 112
723 3300042010 Ga0439452_007300 Ga0439452_007300_1571_1912 112
724 3300042010 Ga0439452_010545 Ga0439452_010545_718_1056 112
725 3300042010 Ga0439452_046394 Ga0439452_046394_103_441 112
726 3300042013 Ga0439456_000042 Ga0439456_000042_26406_26747 112
727 3300042013 Ga0439456_001460 Ga0439456_001460_3986_4324 112
728 3300042013 Ga0439456_026955 Ga0439456_026955_640_978 112
729 3300042013 Ga0439456_039117 Ga0439456_039117_644_982 112
730 3300042016 Ga0439463_000091 Ga0439463_000091_69_410 112
731 3300042016 Ga0439463_017565 Ga0439463_017565_1202_1540 112
732 3300042016 Ga0439463_063176 Ga0439463_063176_490_831 112
733 3300042016 Ga0439463_154274 Ga0439463_154274_19_357 112
734 3300042115 Ga0450911_000062 Ga0450911_000062_10778_11116 112
735 3300042115 Ga0450911_002121 Ga0450911_002121_3083_3421 112
736 3300042115 Ga0450911_003178 Ga0450911_003178_2452_2790 112
737 3300042121 Ga0450919_002519 Ga0450919_002519_118_456 112
738 3300042121 Ga0450919_012153 Ga0450919_012153_132_473 112
739 3300042122 Ga0450920_005318 Ga0450920_005318_1338_1676 112
740 3300042122 Ga0450920_037932 Ga0450920_037932_253_594 112
741 3300042124 Ga0450922_000048 Ga0450922_000048_2076_2414 112
742 3300042124 Ga0450922_007411 Ga0450922_007411_54_392 112
743 3300042125 Ga0450923_001498 Ga0450923_001498_1825_2166 112
744 3300042125 Ga0450923_117871 Ga0450923_117871_214_552 112
745 3300042127 Ga0450890_002451 Ga0450890_002451_2170_2508 112
746 3300042129 Ga0450891_036773 Ga0450891_036773_59_397 112
747 3300042133 Ga0450896_073462 Ga0450896_073462_210_551 112
748 3300042134 Ga0450898_072843 Ga0450898_072843_227_568 112
749 3300042137 Ga0450902_013345 Ga0450902_013345_29_367 112
750 3300042138 Ga0450903_001627 Ga0450903_001627_1536_1874 112
751 3300042138 Ga0450903_002515 Ga0450903_002515_2502_2840 112
752 3300042138 Ga0450903_015292 Ga0450903_015292_160_498 112
753 3300042139 Ga0450904_001667 Ga0450904_001667_2229_2567 112
754 3300042139 Ga0450904_009047 Ga0450904_009047_419_757 112
755 3300042142 Ga0450905_000027 Ga0450905_000027_481_819 112
756 3300042142 Ga0450905_000950 Ga0450905_000950_3198_3536 112
757 3300042142 Ga0450905_028629 Ga0450905_028629_315_653 112
758 3300042142 Ga0450905_051838 Ga0450905_051838_237_575 112
759 3300042142 Ga0450905_076634 Ga0450905_076634_210_548 112
760 3300042145 Ga0450906_000148 Ga0450906_000148_1025_1363 112
761 3300042145 Ga0450906_000910 Ga0450906_000910_1645_1983 112
762 3300042145 Ga0450906_001325 Ga0450906_001325_4440_4778 112
763 3300042145 Ga0450906_010049 Ga0450906_010049_1443_1781 112
764 3300042146 Ga0450907_000126 Ga0450907_000126_13490_13828 112
765 3300042146 Ga0450907_001109 Ga0450907_001109_3626_3964 112
766 3300042146 Ga0450907_001601 Ga0450907_001601_90_428 112
767 3300042147 Ga0450910_000109 Ga0450910_000109_7570_7908 112
768 3300042147 Ga0450910_013878 Ga0450910_013878_142_480 112
769 3300042156 Ga0439446_0001959 Ga0439446_0001959_4436_4774 112
770 3300042156 Ga0439446_0008147 Ga0439446_0008147_271_609 112
771 3300042156 Ga0439446_0018855 Ga0439446_0018855_966_1307 112
772 3300042184 Ga0450908_005028 Ga0450908_005028_2133_2471 112
773 3300042185 Ga0450909_000619 Ga0450909_000619_3803_4141 112
774 3300042185 Ga0450909_007390 Ga0450909_007390_1121_1462 112
775 3300042185 Ga0450909_007870 Ga0450909_007870_49_387 112
776 3300042185 Ga0450909_081655 Ga0450909_081655_129_467 112
777 3300042435 Ga0439434_0000110 Ga0439434_0000110_14526_14864 112
778 3300042435 Ga0439434_0000167 Ga0439434_0000167_8605_8946 112
779 3300042461 Ga0439460_0000354 Ga0439460_0000354_7253_7591 112
780 3300042461 Ga0439460_0001696 Ga0439460_0001696_1715_2053 112
781 3300042461 Ga0439460_0001746 Ga0439460_0001746_1536_1874 112
782 3300042532 Ga0450893_0004706 Ga0450893_0004706_1605_1943 112
783 3300042876 Ga0451577_0344748 Ga0451577_0344748_69_410 112
784 3300042993 Ga0439440_0006966 Ga0439440_0006966_1937_2275 112
785 3300042993 Ga0439440_0016414 Ga0439440_0016414_567_905 112
786 3300046452 Ga0495617_000922 Ga0495617_000922_6765_7103 112
787 3300046452 Ga0495617_001045 Ga0495617_001045_2469_2807 112
788 3300046452 Ga0495617_011843 Ga0495617_011843_1260_1598 112
789 3300046452 Ga0495617_024613 Ga0495617_024613_869_1207 112
790 3300046452 Ga0495617_027961 Ga0495617_027961_1510_1848 112
791 3300046452 Ga0495617_037859 Ga0495617_037859_30_368 112
792 3300046452 Ga0495617_051930 Ga0495617_051930_319_657 112
793 3300046452 Ga0495617_055242 Ga0495617_055242_691_1029 112
794 3300046452 Ga0495617_202974 Ga0495617_202974_187_528 112
795 3300046453 Ga0495627_000215 Ga0495627_000215_29519_29860 112
796 3300046453 Ga0495627_000689 Ga0495627_000689_24143_24481 112
797 3300046453 Ga0495627_003044 Ga0495627_003044_4402_4740 112
798 3300046453 Ga0495627_011987 Ga0495627_011987_459_797 112
799 3300046453 Ga0495627_023262 Ga0495627_023262_945_1283 112
800 3300046453 Ga0495627_058342 Ga0495627_058342_91_429 112
801 3300046453 Ga0495627_082421 Ga0495627_082421_555_893 112
802 3300046453 Ga0495627_107420 Ga0495627_107420_31_369 112
803 3300046454 Ga0495592_0073545 Ga0495592_0073545_1537_1875 112
804 3300046455 Ga0495603_0001509 Ga0495603_0001509_11342_11680 112
805 3300046455 Ga0495603_0033530 Ga0495603_0033530_2322_2660 112
806 3300046455 Ga0495603_0046701 Ga0495603_0046701_162_500 112
807 3300046455 Ga0495603_0521425 Ga0495603_0521425_68_406 112
808 3300046457 Ga0495590_0000464 Ga0495590_0000464_7363_7701 112
809 3300046457 Ga0495590_0000998 Ga0495590_0000998_1428_1766 112
810 3300046457 Ga0495590_0003084 Ga0495590_0003084_5302_5640 112
811 3300046457 Ga0495590_0029458 Ga0495590_0029458_820_1158 112
812 3300046458 Ga0495591_000019 Ga0495591_000019_67969_68310 112
813 3300046458 Ga0495591_000421 Ga0495591_000421_26106_26447 112
814 3300046458 Ga0495591_000580 Ga0495591_000580_26073_26411 112
815 3300046458 Ga0495591_001318 Ga0495591_001318_7423_7761 112
816 3300046458 Ga0495591_004169 Ga0495591_004169_598_939 112
817 3300046458 Ga0495591_005634 Ga0495591_005634_1907_2248 112
818 3300046458 Ga0495591_012247 Ga0495591_012247_755_1093 112
819 3300046458 Ga0495591_014291 Ga0495591_014291_1737_2075 112
820 3300046458 Ga0495591_015933 Ga0495591_015933_594_932 112
821 3300046458 Ga0495591_019351 Ga0495591_019351_119_457 112
822 3300046458 Ga0495591_020387 Ga0495591_020387_1102_1440 112
823 3300046458 Ga0495591_025641 Ga0495591_025641_131_469 112
824 3300046458 Ga0495591_031520 Ga0495591_031520_532_870 112
825 3300046458 Ga0495591_043985 Ga0495591_043985_222_563 112
826 3300046458 Ga0495591_065853 Ga0495591_065853_448_786 112
827 3300046459 Ga0495629_0041864 Ga0495629_0041864_1045_1383 112
828 3300046460 Ga0495638_0005873 Ga0495638_0005873_7627_7965 112
829 3300046460 Ga0495638_0020154 Ga0495638_0020154_3245_3583 112
830 3300046460 Ga0495638_0038209 Ga0495638_0038209_1973_2311 112
831 3300046460 Ga0495638_0044976 Ga0495638_0044976_1631_1969 112
832 3300046460 Ga0495638_0052625 Ga0495638_0052625_705_1043 112
833 3300046460 Ga0495638_0061306 Ga0495638_0061306_1922_2260 112
834 3300046460 Ga0495638_0069202 Ga0495638_0069202_1794_2132 112
835 3300046460 Ga0495638_0086514 Ga0495638_0086514_27_365 112
836 3300046460 Ga0495638_0102254 Ga0495638_0102254_742_1080 112
837 3300046460 Ga0495638_0273322 Ga0495638_0273322_44_382 112
838 3300046460 Ga0495638_0578621 Ga0495638_0578621_168_506 112
839 3300046463 Ga0495653_0000656 Ga0495653_0000656_21158_21496 112
840 3300046463 Ga0495653_0020411 Ga0495653_0020411_3829_4167 112
841 3300046463 Ga0495653_0054867 Ga0495653_0054867_1305_1643 112
842 3300046463 Ga0495653_0247856 Ga0495653_0247856_681_1019 112
843 3300046463 Ga0495653_0282594 Ga0495653_0282594_29_367 112
844 3300046471 Ga0495650_0000392 Ga0495650_0000392_2741_3082 112
845 3300046471 Ga0495650_0002672 Ga0495650_0002672_5357_5695 112
846 3300046471 Ga0495650_0004382 Ga0495650_0004382_397_735 112
847 3300046471 Ga0495650_0008721 Ga0495650_0008721_2206_2547 112
848 3300046471 Ga0495650_0019729 Ga0495650_0019729_799_1137 112
849 3300046471 Ga0495650_0036094 Ga0495650_0036094_1102_1440 112
850 3300046471 Ga0495650_0068850 Ga0495650_0068850_284_622 112
851 3300046471 Ga0495650_0106795 Ga0495650_0106795_33_374 112
852 3300046473 Ga0495582_0007143 Ga0495582_0007143_4335_4673 112
853 3300046474 Ga0495605_0000014 Ga0495605_0000014_243901_244242 112
854 3300046474 Ga0495605_0000030 Ga0495605_0000030_109398_109742 112
855 3300046474 Ga0495605_0000119 Ga0495605_0000119_7279_7620 112
856 3300046474 Ga0495605_0000326 Ga0495605_0000326_22597_22938 112
857 3300046474 Ga0495605_0001591 Ga0495605_0001591_2601_2939 112
858 3300046474 Ga0495605_0002239 Ga0495605_0002239_7799_8137 112
859 3300046474 Ga0495605_0005402 Ga0495605_0005402_6260_6598 112
860 3300046474 Ga0495605_0006000 Ga0495605_0006000_457_798 112
861 3300046474 Ga0495605_0013217 Ga0495605_0013217_1469_1807 112
862 3300046474 Ga0495605_0014717 Ga0495605_0014717_3919_4257 112
863 3300046474 Ga0495605_0030895 Ga0495605_0030895_947_1288 112
864 3300046474 Ga0495605_0032047 Ga0495605_0032047_1598_1936 112
865 3300046474 Ga0495605_0036302 Ga0495605_0036302_2084_2422 112
866 3300046474 Ga0495605_0046040 Ga0495605_0046040_92_430 112
867 3300046474 Ga0495605_0046675 Ga0495605_0046675_1693_2034 112
868 3300046474 Ga0495605_0055681 Ga0495605_0055681_1058_1399 112
869 3300046474 Ga0495605_0070072 Ga0495605_0070072_756_1097 112
870 3300046474 Ga0495605_0185770 Ga0495605_0185770_162_500 112
871 3300046474 Ga0495605_0408647 Ga0495605_0408647_197_535 112
872 3300046474 Ga0495605_0469261 Ga0495605_0469261_161_502 112
873 3300046475 Ga0495639_0000008 Ga0495639_0000008_84558_84896 112
874 3300046475 Ga0495639_0207821 Ga0495639_0207821_202_540 112
875 3300046491 Ga0495584_0001473 Ga0495584_0001473_2971_3309 112
876 3300046491 Ga0495584_0001655 Ga0495584_0001655_10026_10364 112
877 3300046491 Ga0495584_0002254 Ga0495584_0002254_2475_2813 112
878 3300046491 Ga0495584_0002578 Ga0495584_0002578_2027_2365 112
879 3300046491 Ga0495584_0005038 Ga0495584_0005038_84_422 112
880 3300046491 Ga0495584_0008956 Ga0495584_0008956_1296_1637 112
881 3300046491 Ga0495584_0009721 Ga0495584_0009721_2733_3071 112
882 3300046491 Ga0495584_0016014 Ga0495584_0016014_2310_2648 112
883 3300046491 Ga0495584_0022958 Ga0495584_0022958_711_1049 112
884 3300046491 Ga0495584_0430927 Ga0495584_0430927_84_422 112
885 3300046492 Ga0495585_0000440 Ga0495585_0000440_27759_28097 112
886 3300046492 Ga0495585_0002128 Ga0495585_0002128_13707_14048 112
887 3300046492 Ga0495585_0003760 Ga0495585_0003760_7825_8163 112
888 3300046492 Ga0495585_0012407 Ga0495585_0012407_4410_4751 112
889 3300046492 Ga0495585_0048750 Ga0495585_0048750_1197_1535 112
890 3300046492 Ga0495585_0052900 Ga0495585_0052900_1177_1515 112
891 3300046492 Ga0495585_0061157 Ga0495585_0061157_28_366 112
892 3300046492 Ga0495585_0118976 Ga0495585_0118976_477_815 112
893 3300046492 Ga0495585_0172322 Ga0495585_0172322_105_443 112
894 3300046492 Ga0495585_0202976 Ga0495585_0202976_258_599 112
895 3300046492 Ga0495585_0351950 Ga0495585_0351950_223_561 112
896 3300046492 Ga0495585_0453089 Ga0495585_0453089_187_525 112
897 3300046499 Ga0495594_0002001 Ga0495594_0002001_4933_5274 112
898 3300046499 Ga0495594_0074904 Ga0495594_0074904_55_393 112
899 3300046500 Ga0495596_0000306 Ga0495596_0000306_19320_19658 112
900 3300046500 Ga0495596_0024972 Ga0495596_0024972_1524_1865 112
901 3300046500 Ga0495596_0042045 Ga0495596_0042045_577_915 112
902 3300046501 Ga0495607_0000099 Ga0495607_0000099_57074_57415 112
903 3300046501 Ga0495607_0000238 Ga0495607_0000238_2116_2457 112
904 3300046501 Ga0495607_0000605 Ga0495607_0000605_3140_3478 112
905 3300046501 Ga0495607_0000897 Ga0495607_0000897_5084_5425 112
906 3300046501 Ga0495607_0000921 Ga0495607_0000921_23426_23767 112
907 3300046501 Ga0495607_0001674 Ga0495607_0001674_18229_18570 112
908 3300046501 Ga0495607_0004501 Ga0495607_0004501_12_350 112
909 3300046501 Ga0495607_0011823 Ga0495607_0011823_2107_2445 112
910 3300046501 Ga0495607_0013090 Ga0495607_0013090_4504_4845 112
911 3300046501 Ga0495607_0017322 Ga0495607_0017322_3544_3885 112
912 3300046501 Ga0495607_0017953 Ga0495607_0017953_3716_4054 112
913 3300046501 Ga0495607_0031050 Ga0495607_0031050_241_579 112
914 3300046501 Ga0495607_0039175 Ga0495607_0039175_2019_2357 112
915 3300046501 Ga0495607_0042013 Ga0495607_0042013_674_1012 112
916 3300046501 Ga0495607_0043109 Ga0495607_0043109_2291_2632 112
917 3300046501 Ga0495607_0050152 Ga0495607_0050152_1409_1747 112
918 3300046501 Ga0495607_0063010 Ga0495607_0063010_678_1016 112
919 3300046501 Ga0495607_0117177 Ga0495607_0117177_289_627 112
920 3300046501 Ga0495607_0145618 Ga0495607_0145618_32_370 112
921 3300046501 Ga0495607_0159419 Ga0495607_0159419_640_981 112
922 3300046501 Ga0495607_0160335 Ga0495607_0160335_82_423 112
923 3300046501 Ga0495607_0167676 Ga0495607_0167676_340_681 112
924 3300046501 Ga0495607_0182604 Ga0495607_0182604_88_426 112
925 3300046501 Ga0495607_0195360 Ga0495607_0195360_567_908 112
926 3300046501 Ga0495607_0222877 Ga0495607_0222877_546_887 112
927 3300046501 Ga0495607_0246414 Ga0495607_0246414_141_482 112
928 3300046501 Ga0495607_0530870 Ga0495607_0530870_29_367 112
929 3300046506 Ga0495583_0000238 Ga0495583_0000238_29647_29988 112
930 3300046506 Ga0495583_0001843 Ga0495583_0001843_17663_18001 112
931 3300046506 Ga0495583_0002388 Ga0495583_0002388_605_946 112
932 3300046506 Ga0495583_0009469 Ga0495583_0009469_499_840 112
933 3300046506 Ga0495583_0021517 Ga0495583_0021517_947_1285 112
934 3300046506 Ga0495583_0032908 Ga0495583_0032908_1017_1358 112
935 3300046506 Ga0495583_0042159 Ga0495583_0042159_1551_1889 112
936 3300046506 Ga0495583_0060088 Ga0495583_0060088_811_1149 112
937 3300046506 Ga0495583_0066766 Ga0495583_0066766_702_1040 112
938 3300046506 Ga0495583_0252811 Ga0495583_0252811_303_644 112
939 3300046506 Ga0495583_0338431 Ga0495583_0338431_85_426 112
940 3300046507 Ga0495606_0000086 Ga0495606_0000086_65746_66087 112
941 3300046507 Ga0495606_0000151 Ga0495606_0000151_46789_47130 112
942 3300046507 Ga0495606_0000398 Ga0495606_0000398_31608_31949 112
943 3300046507 Ga0495606_0005675 Ga0495606_0005675_3172_3510 112
944 3300046507 Ga0495606_0007938 Ga0495606_0007938_852_1190 112
945 3300046507 Ga0495606_0009869 Ga0495606_0009869_4525_4863 112
946 3300046507 Ga0495606_0031703 Ga0495606_0031703_1151_1489 112
947 3300046507 Ga0495606_0040423 Ga0495606_0040423_524_862 112
948 3300046507 Ga0495606_0109550 Ga0495606_0109550_154_492 112
949 3300046507 Ga0495606_0141007 Ga0495606_0141007_519_860 112
950 3300046507 Ga0495606_0172493 Ga0495606_0172493_814_1152 112
951 3300046507 Ga0495606_0356740 Ga0495606_0356740_325_666 112
952 3300046507 Ga0495606_0366019 Ga0495606_0366019_135_473 112
953 3300046507 Ga0495606_0401552 Ga0495606_0401552_52_393 112
954 3300046512 Ga0495610_0000994 Ga0495610_0000994_1161_1499 112
955 3300046512 Ga0495610_0003490 Ga0495610_0003490_11644_11982 112
956 3300046512 Ga0495610_0004811 Ga0495610_0004811_7437_7775 112
957 3300046512 Ga0495610_0005423 Ga0495610_0005423_6872_7210 112
958 3300046512 Ga0495610_0007307 Ga0495610_0007307_20_358 112
959 3300046512 Ga0495610_0008264 Ga0495610_0008264_1960_2298 112
960 3300046512 Ga0495610_0014261 Ga0495610_0014261_3633_3974 112
961 3300046512 Ga0495610_0014347 Ga0495610_0014347_2138_2479 112
962 3300046512 Ga0495610_0015934 Ga0495610_0015934_1703_2041 112
963 3300046512 Ga0495610_0023027 Ga0495610_0023027_840_1178 112
964 3300046512 Ga0495610_0030223 Ga0495610_0030223_2463_2801 112
965 3300046512 Ga0495610_0090106 Ga0495610_0090106_454_795 112
966 3300046512 Ga0495610_0095121 Ga0495610_0095121_799_1137 112
967 3300046512 Ga0495610_0116833 Ga0495610_0116833_744_1082 112
968 3300046512 Ga0495610_0182519 Ga0495610_0182519_461_802 112
969 3300046512 Ga0495610_0245745 Ga0495610_0245745_317_658 112
970 3300046512 Ga0495610_0267094 Ga0495610_0267094_250_588 112
971 3300046513 Ga0495616_0000637 Ga0495616_0000637_25126_25464 112
972 3300046513 Ga0495616_0001151 Ga0495616_0001151_2264_2602 112
973 3300046513 Ga0495616_0003552 Ga0495616_0003552_3532_3870 112
974 3300046513 Ga0495616_0012464 Ga0495616_0012464_3167_3505 112
975 3300046513 Ga0495616_0042068 Ga0495616_0042068_811_1149 112
976 3300046513 Ga0495616_0044509 Ga0495616_0044509_783_1121 112
977 3300046513 Ga0495616_0044761 Ga0495616_0044761_1527_1865 112
978 3300046513 Ga0495616_0048301 Ga0495616_0048301_625_963 112
979 3300046513 Ga0495616_0064481 Ga0495616_0064481_365_706 112
980 3300046513 Ga0495616_0169214 Ga0495616_0169214_297_638 112
981 3300046513 Ga0495616_0469306 Ga0495616_0469306_97_435 112
982 3300046515 Ga0495620_0000094 Ga0495620_0000094_9060_9401 112
983 3300046515 Ga0495620_0000169 Ga0495620_0000169_22076_22417 112
984 3300046515 Ga0495620_0000173 Ga0495620_0000173_47932_48273 112
985 3300046515 Ga0495620_0000492 Ga0495620_0000492_8677_9015 112
986 3300046515 Ga0495620_0002937 Ga0495620_0002937_84_422 112
987 3300046515 Ga0495620_0003531 Ga0495620_0003531_552_890 112
988 3300046515 Ga0495620_0009430 Ga0495620_0009430_84_422 112
989 3300046515 Ga0495620_0022812 Ga0495620_0022812_2039_2377 112
990 3300046515 Ga0495620_0026854 Ga0495620_0026854_1642_1980 112
991 3300046515 Ga0495620_0029516 Ga0495620_0029516_1453_1794 112
992 3300046515 Ga0495620_0062757 Ga0495620_0062757_1138_1479 112
993 3300046515 Ga0495620_0097890 Ga0495620_0097890_518_856 112
994 3300046515 Ga0495620_0124792 Ga0495620_0124792_298_636 112
995 3300046515 Ga0495620_0285646 Ga0495620_0285646_86_424 112
996 3300046517 Ga0495630_0002264 Ga0495630_0002264_9750_10088 112
997 3300046517 Ga0495630_0029594 Ga0495630_0029594_716_1054 112
998 3300046518 Ga0495631_0000112 Ga0495631_0000112_16548_16886 112
999 3300046518 Ga0495631_0001057 Ga0495631_0001057_16315_16656 112
1000 3300046518 Ga0495631_0003532 Ga0495631_0003532_83_424 112
1001 3300046518 Ga0495631_0004090 Ga0495631_0004090_6842_7180 112
1002 3300046518 Ga0495631_0007585 Ga0495631_0007585_3056_3394 112
1003 3300046518 Ga0495631_0031833 Ga0495631_0031833_1002_1343 112
1004 3300046518 Ga0495631_0041352 Ga0495631_0041352_964_1302 112
1005 3300046518 Ga0495631_0075723 Ga0495631_0075723_819_1157 112
1006 3300046518 Ga0495631_0168532 Ga0495631_0168532_552_890 112
1007 3300046518 Ga0495631_0237409 Ga0495631_0237409_57_395 112
1008 3300046519 Ga0495632_0000146 Ga0495632_0000146_44483_44824 112
1009 3300046519 Ga0495632_0001185 Ga0495632_0001185_16683_17024 112
1010 3300046519 Ga0495632_0002120 Ga0495632_0002120_3193_3531 112
1011 3300046519 Ga0495632_0004556 Ga0495632_0004556_654_992 112
1012 3300046519 Ga0495632_0008688 Ga0495632_0008688_5173_5511 112
1013 3300046519 Ga0495632_0033898 Ga0495632_0033898_1469_1807 112
1014 3300046519 Ga0495632_0049025 Ga0495632_0049025_1700_2038 112
1015 3300046519 Ga0495632_0051066 Ga0495632_0051066_717_1058 112
1016 3300046519 Ga0495632_0053754 Ga0495632_0053754_583_924 112
1017 3300046519 Ga0495632_0082530 Ga0495632_0082530_542_883 112
1018 3300046519 Ga0495632_0092395 Ga0495632_0092395_343_681 112
1019 3300046519 Ga0495632_0093403 Ga0495632_0093403_90_428 112
1020 3300046519 Ga0495632_0165428 Ga0495632_0165428_424_762 112
1021 3300046519 Ga0495632_0170351 Ga0495632_0170351_79_417 112
1022 3300046519 Ga0495632_0189527 Ga0495632_0189527_132_470 112
1023 3300046520 Ga0495637_0000032 Ga0495637_0000032_62923_63264 112
1024 3300046520 Ga0495637_0000090 Ga0495637_0000090_65943_66284 112
1025 3300046520 Ga0495637_0001124 Ga0495637_0001124_3253_3591 112
1026 3300046520 Ga0495637_0002443 Ga0495637_0002443_8459_8797 112
1027 3300046520 Ga0495637_0003245 Ga0495637_0003245_111_449 112
1028 3300046520 Ga0495637_0004373 Ga0495637_0004373_6942_7280 112
1029 3300046520 Ga0495637_0005638 Ga0495637_0005638_2531_2869 112
1030 3300046520 Ga0495637_0013888 Ga0495637_0013888_51_392 112
1031 3300046520 Ga0495637_0015361 Ga0495637_0015361_2775_3113 112
1032 3300046520 Ga0495637_0019356 Ga0495637_0019356_2324_2665 112
1033 3300046520 Ga0495637_0023395 Ga0495637_0023395_613_951 112
1034 3300046520 Ga0495637_0038602 Ga0495637_0038602_1418_1756 112
1035 3300046520 Ga0495637_0046259 Ga0495637_0046259_225_602 112
1036 3300046520 Ga0495637_0067479 Ga0495637_0067479_42_380 112
1037 3300046520 Ga0495637_0151217 Ga0495637_0151217_30_368 112
1038 3300046520 Ga0495637_0189917 Ga0495637_0189917_282_620 112
1039 3300046520 Ga0495637_0193230 Ga0495637_0193230_263_601 112
1040 3300046520 Ga0495637_0235763 Ga0495637_0235763_72_410 112
1041 3300046522 Ga0495643_0016263 Ga0495643_0016263_2528_2866 112
1042 3300046522 Ga0495643_0018338 Ga0495643_0018338_205_546 112
1043 3300046522 Ga0495643_0023699 Ga0495643_0023699_1298_1636 112
1044 3300046522 Ga0495643_0069720 Ga0495643_0069720_83_421 112
1045 3300046522 Ga0495643_0070885 Ga0495643_0070885_1122_1460 112
1046 3300046522 Ga0495643_0071220 Ga0495643_0071220_269_607 112
1047 3300046522 Ga0495643_0110206 Ga0495643_0110206_267_605 112
1048 3300046522 Ga0495643_0156061 Ga0495643_0156061_291_629 112
1049 3300046522 Ga0495643_0206000 Ga0495643_0206000_50_388 112
1050 3300046522 Ga0495643_0494903 Ga0495643_0494903_107_445 112
1051 3300046523 Ga0495644_0001167 Ga0495644_0001167_7637_7975 112
1052 3300046523 Ga0495644_0001577 Ga0495644_0001577_1151_1489 112
1053 3300046523 Ga0495644_0008053 Ga0495644_0008053_652_990 112
1054 3300046523 Ga0495644_0015460 Ga0495644_0015460_467_808 112
1055 3300046523 Ga0495644_0060705 Ga0495644_0060705_36_374 112
1056 3300046524 Ga0495648_0000882 Ga0495648_0000882_10082_10420 112
1057 3300046524 Ga0495648_0003250 Ga0495648_0003250_6017_6358 112
1058 3300046524 Ga0495648_0013303 Ga0495648_0013303_2262_2600 112
1059 3300046524 Ga0495648_0023334 Ga0495648_0023334_2278_2616 112
1060 3300046524 Ga0495648_0036314 Ga0495648_0036314_1665_2003 112
1061 3300046524 Ga0495648_0061298 Ga0495648_0061298_1878_2216 112
1062 3300046524 Ga0495648_0070799 Ga0495648_0070799_1652_1990 112
1063 3300046524 Ga0495648_0083562 Ga0495648_0083562_208_546 112
1064 3300046524 Ga0495648_0103514 Ga0495648_0103514_647_985 112
1065 3300046524 Ga0495648_0139584 Ga0495648_0139584_618_956 112
1066 3300046524 Ga0495648_0144079 Ga0495648_0144079_499_840 112
1067 3300046524 Ga0495648_0179988 Ga0495648_0179988_605_946 112
1068 3300046524 Ga0495648_0194477 Ga0495648_0194477_390_728 112
1069 3300046524 Ga0495648_0299390 Ga0495648_0299390_321_659 112
1070 3300046524 Ga0495648_0397212 Ga0495648_0397212_267_605 112
1071 3300046526 Ga0495666_0000271 Ga0495666_0000271_19886_20224 112
1072 3300046526 Ga0495666_0025350 Ga0495666_0025350_2103_2441 112
1073 3300046526 Ga0495666_0046085 Ga0495666_0046085_1748_2086 112
1074 3300046526 Ga0495666_0309622 Ga0495666_0309622_84_422 112
1075 3300046528 Ga0495642_0000394 Ga0495642_0000394_6748_7086 112
1076 3300046528 Ga0495642_0011252 Ga0495642_0011252_2997_3335 112
1077 3300046530 Ga0495654_0000160 Ga0495654_0000160_36638_36979 112
1078 3300046530 Ga0495654_0000423 Ga0495654_0000423_6328_6669 112
1079 3300046530 Ga0495654_0000787 Ga0495654_0000787_8068_8409 112
1080 3300046530 Ga0495654_0003231 Ga0495654_0003231_7906_8244 112
1081 3300046530 Ga0495654_0003622 Ga0495654_0003622_8002_8340 112
1082 3300046530 Ga0495654_0005096 Ga0495654_0005096_605_946 112
1083 3300046530 Ga0495654_0006806 Ga0495654_0006806_5313_5651 112
1084 3300046530 Ga0495654_0021340 Ga0495654_0021340_2850_3188 112
1085 3300046530 Ga0495654_0021811 Ga0495654_0021811_552_890 112
1086 3300046530 Ga0495654_0024215 Ga0495654_0024215_845_1183 112
1087 3300046530 Ga0495654_0033085 Ga0495654_0033085_1469_1807 112
1088 3300046530 Ga0495654_0037628 Ga0495654_0037628_1907_2245 112
1089 3300046530 Ga0495654_0041994 Ga0495654_0041994_1838_2176 112
1090 3300046530 Ga0495654_0044062 Ga0495654_0044062_816_1154 112
1091 3300046530 Ga0495654_0061299 Ga0495654_0061299_690_1028 112
1092 3300046530 Ga0495654_0079385 Ga0495654_0079385_929_1267 112
1093 3300046530 Ga0495654_0093489 Ga0495654_0093489_644_982 112
1094 3300046530 Ga0495654_0097586 Ga0495654_0097586_388_726 112
1095 3300046530 Ga0495654_0108443 Ga0495654_0108443_881_1222 112
1096 3300046530 Ga0495654_0156794 Ga0495654_0156794_118_456 112
1097 3300046530 Ga0495654_0162220 Ga0495654_0162220_211_549 112
1098 3300046530 Ga0495654_0170899 Ga0495654_0170899_286_624 112
1099 3300046530 Ga0495654_0196191 Ga0495654_0196191_468_809 112
1100 3300046530 Ga0495654_0318436 Ga0495654_0318436_281_619 112
1101 3300046535 Ga0495586_0035507 Ga0495586_0035507_2147_2485 112
1102 3300046536 Ga0495587_0001455 Ga0495587_0001455_11380_11718 112
1103 3300046536 Ga0495587_0006391 Ga0495587_0006391_5253_5591 112
1104 3300046538 Ga0495609_0000006 Ga0495609_0000006_106146_106487 112
1105 3300046538 Ga0495609_0000024 Ga0495609_0000024_59289_59630 112
1106 3300046538 Ga0495609_0000040 Ga0495609_0000040_73609_73950 112
1107 3300046538 Ga0495609_0005389 Ga0495609_0005389_393_731 112
1108 3300046538 Ga0495609_0108183 Ga0495609_0108183_327_665 112
1109 3300046538 Ga0495609_0113136 Ga0495609_0113136_108_446 112
1110 3300046538 Ga0495609_0178920 Ga0495609_0178920_371_712 112
1111 3300046538 Ga0495609_0294264 Ga0495609_0294264_230_568 112
1112 3300046538 Ga0495609_0300842 Ga0495609_0300842_262_600 112
1113 3300046538 Ga0495609_0310762 Ga0495609_0310762_60_398 112
1114 3300046538 Ga0495609_0341939 Ga0495609_0341939_60_398 112
1115 3300046542 Ga0495597_0000010 Ga0495597_0000010_67851_68192 112
1116 3300046542 Ga0495597_0000843 Ga0495597_0000843_23034_23372 112
1117 3300046542 Ga0495597_0001443 Ga0495597_0001443_8100_8441 112
1118 3300046542 Ga0495597_0006682 Ga0495597_0006682_1506_1844 112
1119 3300046542 Ga0495597_0018206 Ga0495597_0018206_751_1089 112
1120 3300046542 Ga0495597_0029092 Ga0495597_0029092_1967_2305 112
1121 3300046542 Ga0495597_0076766 Ga0495597_0076766_258_596 112
1122 3300046542 Ga0495597_0091905 Ga0495597_0091905_676_1014 112
1123 3300046542 Ga0495597_0096769 Ga0495597_0096769_786_1124 112
1124 3300046542 Ga0495597_0103209 Ga0495597_0103209_83_421 112
1125 3300046542 Ga0495597_0149849 Ga0495597_0149849_25_363 112
1126 3300046542 Ga0495597_0192528 Ga0495597_0192528_123_461 112
1127 3300046543 Ga0495645_0668003 Ga0495645_0668003_37_378 112
1128 3300046557 Ga0495622_0000635 Ga0495622_0000635_4704_5042 112
1129 3300046557 Ga0495622_0004490 Ga0495622_0004490_2236_2574 112
1130 3300046557 Ga0495622_0016360 Ga0495622_0016360_1692_2030 112
1131 3300046557 Ga0495622_0021481 Ga0495622_0021481_1923_2261 112
1132 3300046557 Ga0495622_0032514 Ga0495622_0032514_1529_1867 112
1133 3300046558 Ga0495633_0000118 Ga0495633_0000118_48238_48579 112
1134 3300046558 Ga0495633_0001362 Ga0495633_0001362_712_1050 112
1135 3300046558 Ga0495633_0006963 Ga0495633_0006963_1261_1599 112
1136 3300046615 Ga0495656_0354864 Ga0495656_0354864_107_445 112
1137 3300046616 Ga0495668_0001931 Ga0495668_0001931_7917_8255 112
1138 3300046616 Ga0495668_0008042 Ga0495668_0008042_5695_6036 112
1139 3300046616 Ga0495668_0026417 Ga0495668_0026417_731_1069 112
1140 3300046616 Ga0495668_0037670 Ga0495668_0037670_499_840 112
1141 3300046616 Ga0495668_0206265 Ga0495668_0206265_21_362 112
1142 3300046642 Ga0495634_0002365 Ga0495634_0002365_303_641 112
1143 3300046642 Ga0495634_0050765 Ga0495634_0050765_1563_1901 112
1144 3300046648 Ga0495611_0000262 Ga0495611_0000262_10763_11101 112
1145 3300046648 Ga0495611_0001057 Ga0495611_0001057_5575_5916 112
1146 3300046648 Ga0495611_0002522 Ga0495611_0002522_2321_2662 112
1147 3300046648 Ga0495611_0009383 Ga0495611_0009383_3707_4048 112
1148 3300046648 Ga0495611_0017050 Ga0495611_0017050_1994_2332 112
1149 3300046648 Ga0495611_0105726 Ga0495611_0105726_849_1187 112
1150 3300046648 Ga0495611_0190802 Ga0495611_0190802_50_388 112
1151 3300046660 Ga0495625_0000247 Ga0495625_0000247_39722_40063 112
1152 3300046660 Ga0495625_0005337 Ga0495625_0005337_1674_2015 112
1153 3300046660 Ga0495625_0005545 Ga0495625_0005545_8228_8566 112
1154 3300046660 Ga0495625_0010216 Ga0495625_0010216_5628_5966 112
1155 3300046660 Ga0495625_0014149 Ga0495625_0014149_5990_6328 112
1156 3300046660 Ga0495625_0047398 Ga0495625_0047398_695_1033 112
1157 3300046660 Ga0495625_0049817 Ga0495625_0049817_185_523 112
1158 3300046660 Ga0495625_0065672 Ga0495625_0065672_1563_1901 112
1159 3300046660 Ga0495625_0081306 Ga0495625_0081306_19_357 112
1160 3300046660 Ga0495625_0083487 Ga0495625_0083487_747_1085 112
1161 3300046660 Ga0495625_0202195 Ga0495625_0202195_946_1284 112
1162 3300046660 Ga0495625_0257058 Ga0495625_0257058_102_440 112
1163 3300046660 Ga0495625_0723362 Ga0495625_0723362_140_478 112
1164 3300046663 Ga0495635_0002391 Ga0495635_0002391_36_374 112
1165 3300046663 Ga0495635_0008952 Ga0495635_0008952_3416_3754 112
1166 3300046664 Ga0495659_0000164 Ga0495659_0000164_9198_9536 112
1167 3300046664 Ga0495659_0092508 Ga0495659_0092508_772_1110 112
1168 3300046665 Ga0495661_0000019 Ga0495661_0000019_66142_66483 112
1169 3300046665 Ga0495661_0000034 Ga0495661_0000034_79857_80198 112
1170 3300046665 Ga0495661_0000054 Ga0495661_0000054_88551_88892 112
1171 3300046665 Ga0495661_0003162 Ga0495661_0003162_2941_3282 112
1172 3300046665 Ga0495661_0022737 Ga0495661_0022737_3628_3969 112
1173 3300046665 Ga0495661_0028637 Ga0495661_0028637_553_891 112
1174 3300046665 Ga0495661_0067050 Ga0495661_0067050_1218_1559 112
1175 3300046665 Ga0495661_0075652 Ga0495661_0075652_1498_1836 112
1176 3300046665 Ga0495661_0097743 Ga0495661_0097743_472_813 112
1177 3300046665 Ga0495661_0104035 Ga0495661_0104035_522_860 112
1178 3300046665 Ga0495661_0159615 Ga0495661_0159615_141_479 112
1179 3300046674 Ga0495588_0001824 Ga0495588_0001824_2040_2378 112
1180 3300046680 Ga0495646_0028616 Ga0495646_0028616_991_1329 112
1181 3300046680 Ga0495646_0057199 Ga0495646_0057199_676_1014 112
1182 3300046684 Ga0495669_0105094 Ga0495669_0105094_82_420 112
1183 3300046689 Ga0495613_0081696 Ga0495613_0081696_1644_1982 112
1184 3300046689 Ga0495613_0098099 Ga0495613_0098099_1511_1849 112
1185 3300046690 Ga0495624_0003258 Ga0495624_0003258_677_1015 112
1186 3300046691 Ga0495670_0003629 Ga0495670_0003629_728_1066 112
1187 3300046691 Ga0495670_0007285 Ga0495670_0007285_1939_2277 112
1188 3300046691 Ga0495670_0011541 Ga0495670_0011541_1410_1748 112
1189 3300046691 Ga0495670_0025070 Ga0495670_0025070_1714_2052 112
1190 3300046691 Ga0495670_0028066 Ga0495670_0028066_166_504 112
1191 3300046691 Ga0495670_0048976 Ga0495670_0048976_1386_1727 112
1192 3300046691 Ga0495670_0102178 Ga0495670_0102178_1102_1440 112
1193 3300046691 Ga0495670_0107361 Ga0495670_0107361_835_1173 112
1194 3300046691 Ga0495670_0164587 Ga0495670_0164587_538_876 112
1195 3300046691 Ga0495670_0247142 Ga0495670_0247142_52_390 112
1196 3300046692 Ga0495671_0000511 Ga0495671_0000511_20125_20463 112
1197 3300046692 Ga0495671_0006290 Ga0495671_0006290_5066_5404 112
1198 3300046692 Ga0495671_0006640 Ga0495671_0006640_605_946 112
1199 3300046692 Ga0495671_0006890 Ga0495671_0006890_5297_5635 112
1200 3300046692 Ga0495671_0008208 Ga0495671_0008208_814_1155 112
1201 3300046692 Ga0495671_0016742 Ga0495671_0016742_2012_2350 112
1202 3300046692 Ga0495671_0026196 Ga0495671_0026196_1781_2119 112
1203 3300046692 Ga0495671_0038972 Ga0495671_0038972_721_1059 112
1204 3300046692 Ga0495671_0049105 Ga0495671_0049105_1084_1425 112
1205 3300046692 Ga0495671_0060387 Ga0495671_0060387_810_1148 112
1206 3300046692 Ga0495671_0062777 Ga0495671_0062777_314_652 112
1207 3300046692 Ga0495671_0079452 Ga0495671_0079452_1064_1405 112
1208 3300046692 Ga0495671_0081398 Ga0495671_0081398_803_1141 112
1209 3300046692 Ga0495671_0086091 Ga0495671_0086091_609_947 112
1210 3300046692 Ga0495671_0099535 Ga0495671_0099535_690_1028 112
1211 3300046692 Ga0495671_0387539 Ga0495671_0387539_90_428 112
1212 3300046692 Ga0495671_0538032 Ga0495671_0538032_106_444 112
1213 3300046694 Ga0495649_0000342 Ga0495649_0000342_7364_7705 112
1214 3300046694 Ga0495649_0002393 Ga0495649_0002393_10925_11263 112
1215 3300046694 Ga0495649_0007428 Ga0495649_0007428_1936_2274 112
1216 3300046694 Ga0495649_0013762 Ga0495649_0013762_2704_3042 112
1217 3300046694 Ga0495649_0016036 Ga0495649_0016036_3025_3363 112
1218 3300046694 Ga0495649_0026369 Ga0495649_0026369_1469_1807 112
1219 3300046694 Ga0495649_0027849 Ga0495649_0027849_1483_1821 112
1220 3300046694 Ga0495649_0042174 Ga0495649_0042174_231_569 112
1221 3300046694 Ga0495649_0042506 Ga0495649_0042506_340_678 112
1222 3300046694 Ga0495649_0111509 Ga0495649_0111509_473_811 112
1223 3300046694 Ga0495649_0123265 Ga0495649_0123265_743_1081 112
1224 3300046694 Ga0495649_0128211 Ga0495649_0128211_683_1021 112
1225 3300046694 Ga0495649_0144817 Ga0495649_0144817_314_655 112
1226 3300046694 Ga0495649_0205216 Ga0495649_0205216_644_982 112
1227 3300046694 Ga0495649_0324714 Ga0495649_0324714_213_551 112
1228 3300046694 Ga0495649_0380314 Ga0495649_0380314_337_675 112
1229 3300046694 Ga0495649_0480881 Ga0495649_0480881_231_569 112
1230 3300046694 Ga0495649_0516151 Ga0495649_0516151_239_577 112
1231 3300046694 Ga0495649_0558365 Ga0495649_0558365_59_397 112
1232 3300046794 Ga0495589_0000493 Ga0495589_0000493_10520_10858 112
1233 3300046794 Ga0495589_0000825 Ga0495589_0000825_4044_4382 112
1234 3300046794 Ga0495589_0001847 Ga0495589_0001847_3202_3543 112
1235 3300046794 Ga0495589_0002949 Ga0495589_0002949_7862_8200 112
1236 3300046794 Ga0495589_0003862 Ga0495589_0003862_725_1063 112
1237 3300046794 Ga0495589_0004792 Ga0495589_0004792_919_1257 112
1238 3300046794 Ga0495589_0005561 Ga0495589_0005561_1927_2265 112
1239 3300046794 Ga0495589_0031849 Ga0495589_0031849_2066_2404 112
1240 3300046794 Ga0495589_0210212 Ga0495589_0210212_565_903 112
1241 3300046809 Ga0495600_0035211 Ga0495600_0035211_2712_3050 112
1242 3300046809 Ga0495600_0050000 Ga0495600_0050000_673_1011 112
1243 3300046810 Ga0495660_0001237 Ga0495660_0001237_7080_7421 112
1244 3300046810 Ga0495660_0001468 Ga0495660_0001468_4293_4634 112
1245 3300046810 Ga0495660_0001846 Ga0495660_0001846_13308_13649 112
1246 3300046810 Ga0495660_0003281 Ga0495660_0003281_8580_8918 112
1247 3300046810 Ga0495660_0004232 Ga0495660_0004232_7619_7957 112
1248 3300046810 Ga0495660_0009272 Ga0495660_0009272_3135_3476 112
1249 3300046810 Ga0495660_0011810 Ga0495660_0011810_3411_3749 112
1250 3300046810 Ga0495660_0015497 Ga0495660_0015497_104_442 112
1251 3300046810 Ga0495660_0019650 Ga0495660_0019650_3457_3795 112
1252 3300046810 Ga0495660_0029002 Ga0495660_0029002_87_428 112
1253 3300046810 Ga0495660_0040449 Ga0495660_0040449_688_1026 112
1254 3300046810 Ga0495660_0046989 Ga0495660_0046989_1308_1646 112
1255 3300046810 Ga0495660_0064933 Ga0495660_0064933_1281_1619 112
1256 3300046810 Ga0495660_0077818 Ga0495660_0077818_745_1083 112
1257 3300046810 Ga0495660_0089766 Ga0495660_0089766_165_503 112
1258 3300046810 Ga0495660_0125499 Ga0495660_0125499_381_719 112
1259 3300046810 Ga0495660_0282496 Ga0495660_0282496_38_376 112
1260 3300046810 Ga0495660_0306884 Ga0495660_0306884_351_689 112
1261 3300046810 Ga0495660_0401233 Ga0495660_0401233_67_405 112
1262 3300046810 Ga0495660_0432911 Ga0495660_0432911_193_531 112
1263 3300047315 Ga0495581_0002503 Ga0495581_0002503_9184_9522 112
1264 3300047315 Ga0495581_0044896 Ga0495581_0044896_519_857 112
1265 3300047317 Ga0495604_0045755 Ga0495604_0045755_722_1060 112
1266 3300047317 Ga0495604_0055553 Ga0495604_0055553_1553_1891 112
1267 3300047317 Ga0495604_0073354 Ga0495604_0073354_666_1004 112
1268 3300047317 Ga0495604_0101090 Ga0495604_0101090_1510_1848 112
1269 3300047318 Ga0495636_0000694 Ga0495636_0000694_8910_9248 112
1270 3300047318 Ga0495636_0028522 Ga0495636_0028522_556_894 112
1271 3300047319 Ga0495674_0016894 Ga0495674_0016894_6436_6774 112
1272 3300047320 Ga0495672_0000703 Ga0495672_0000703_6741_7079 112
1273 3300047320 Ga0495672_0001170 Ga0495672_0001170_2440_2778 112
1274 3300047320 Ga0495672_0003680 Ga0495672_0003680_12352_12690 112
1275 3300047320 Ga0495672_0003804 Ga0495672_0003804_10024_10365 112
1276 3300047320 Ga0495672_0004691 Ga0495672_0004691_3107_3445 112
1277 3300047320 Ga0495672_0005594 Ga0495672_0005594_8905_9243 112
1278 3300047320 Ga0495672_0005639 Ga0495672_0005639_265_603 112
1279 3300047320 Ga0495672_0010079 Ga0495672_0010079_1413_1754 112
1280 3300047320 Ga0495672_0016446 Ga0495672_0016446_179_517 112
1281 3300047320 Ga0495672_0034333 Ga0495672_0034333_1849_2187 112
1282 3300047320 Ga0495672_0035377 Ga0495672_0035377_1093_1431 112
1283 3300047320 Ga0495672_0036039 Ga0495672_0036039_2272_2610 112
1284 3300047320 Ga0495672_0038195 Ga0495672_0038195_1819_2160 112
1285 3300047320 Ga0495672_0038621 Ga0495672_0038621_709_1050 112
1286 3300047320 Ga0495672_0074546 Ga0495672_0074546_29_367 112
1287 3300047320 Ga0495672_0078630 Ga0495672_0078630_817_1155 112
1288 3300047320 Ga0495672_0292375 Ga0495672_0292375_94_435 112
1289 3300047321 Ga0495676_0000010 Ga0495676_0000010_169028_169369 112
1290 3300047321 Ga0495676_0025937 Ga0495676_0025937_3999_4337 112
1291 3300047321 Ga0495676_0092514 Ga0495676_0092514_612_950 112
1292 3300047322 Ga0495680_0000801 Ga0495680_0000801_11573_11911 112
1293 3300047322 Ga0495680_0009169 Ga0495680_0009169_2493_2831 112
1294 3300047322 Ga0495680_0091612 Ga0495680_0091612_1655_1993 112
1295 3300047322 Ga0495680_0244468 Ga0495680_0244468_263_601 112
1296 3300047323 Ga0495683_0000066 Ga0495683_0000066_52461_52802 112
1297 3300047323 Ga0495683_0000143 Ga0495683_0000143_16399_16737 112
1298 3300047323 Ga0495683_0000539 Ga0495683_0000539_7574_7915 112
1299 3300047323 Ga0495683_0001519 Ga0495683_0001519_6492_6830 112
1300 3300047323 Ga0495683_0011874 Ga0495683_0011874_707_1045 112
1301 3300047323 Ga0495683_0015699 Ga0495683_0015699_1616_1954 112
1302 3300047323 Ga0495683_0022781 Ga0495683_0022781_831_1169 112
1303 3300047323 Ga0495683_0183081 Ga0495683_0183081_564_902 112
1304 3300047323 Ga0495683_0365402 Ga0495683_0365402_233_571 112
1305 3300047443 Ga0495687_001510 Ga0495687_001510_2648_2986 112
1306 3300047443 Ga0495687_022643 Ga0495687_022643_393_731 112
1307 3300047443 Ga0495687_199933 Ga0495687_199933_265_603 112
1308 3300047444 Ga0495675_0009120 Ga0495675_0009120_3669_4007 112
1309 3300047444 Ga0495675_0221259 Ga0495675_0221259_242_580 112
1310 3300047446 Ga0495679_000480 Ga0495679_000480_28126_28467 112
1311 3300047446 Ga0495679_003089 Ga0495679_003089_6538_6879 112
1312 3300047446 Ga0495679_007016 Ga0495679_007016_2271_2612 112
1313 3300047446 Ga0495679_018965 Ga0495679_018965_1305_1643 112
1314 3300047446 Ga0495679_035036 Ga0495679_035036_709_1047 112
1315 3300047446 Ga0495679_050431 Ga0495679_050431_346_684 112
1316 3300047446 Ga0495679_076848 Ga0495679_076848_481_819 112
1317 3300047446 Ga0495679_091870 Ga0495679_091870_334_672 112
1318 3300047446 Ga0495679_101230 Ga0495679_101230_120_458 112
1319 3300047469 Ga0495673_0000250 Ga0495673_0000250_517_858 112
1320 3300047469 Ga0495673_0000274 Ga0495673_0000274_28688_29029 112
1321 3300047469 Ga0495673_0000744 Ga0495673_0000744_212_550 112
1322 3300047469 Ga0495673_0001425 Ga0495673_0001425_12735_13073 112
1323 3300047469 Ga0495673_0005658 Ga0495673_0005658_5911_6252 112
1324 3300047469 Ga0495673_0006652 Ga0495673_0006652_6191_6529 112
1325 3300047469 Ga0495673_0008428 Ga0495673_0008428_15_353 112
1326 3300047469 Ga0495673_0013214 Ga0495673_0013214_3174_3512 112
1327 3300047469 Ga0495673_0014053 Ga0495673_0014053_775_1113 112
1328 3300047469 Ga0495673_0015531 Ga0495673_0015531_778_1116 112
1329 3300047469 Ga0495673_0015761 Ga0495673_0015761_3249_3587 112
1330 3300047469 Ga0495673_0017362 Ga0495673_0017362_2182_2523 112
1331 3300047469 Ga0495673_0018288 Ga0495673_0018288_2939_3277 112
1332 3300047469 Ga0495673_0025863 Ga0495673_0025863_66_404 112
1333 3300047469 Ga0495673_0030234 Ga0495673_0030234_1473_1814 112
1334 3300047469 Ga0495673_0038115 Ga0495673_0038115_227_565 112
1335 3300047469 Ga0495673_0085331 Ga0495673_0085331_175_513 112
1336 3300047469 Ga0495673_0092771 Ga0495673_0092771_202_540 112
1337 3300047469 Ga0495673_0120741 Ga0495673_0120741_99_437 112
1338 3300047469 Ga0495673_0121313 Ga0495673_0121313_460_801 112
1339 3300047469 Ga0495673_0134491 Ga0495673_0134491_437_778 112
1340 3300047469 Ga0495673_0149320 Ga0495673_0149320_152_490 112
1341 3300047469 Ga0495673_0151689 Ga0495673_0151689_476_817 112
1342 3300047469 Ga0495673_0178096 Ga0495673_0178096_211_552 112
1343 3300047470 Ga0495681_0002653 Ga0495681_0002653_843_1181 112
1344 3300047470 Ga0495681_0003045 Ga0495681_0003045_3368_3706 112
1345 3300047470 Ga0495681_0003897 Ga0495681_0003897_1498_1836 112
1346 3300047470 Ga0495681_0003995 Ga0495681_0003995_1910_2248 112
1347 3300047470 Ga0495681_0005408 Ga0495681_0005408_7332_7670 112
1348 3300047470 Ga0495681_0006062 Ga0495681_0006062_762_1100 112
1349 3300047470 Ga0495681_0014213 Ga0495681_0014213_45_383 112
1350 3300047470 Ga0495681_0014519 Ga0495681_0014519_2004_2342 112
1351 3300047470 Ga0495681_0015329 Ga0495681_0015329_1158_1496 112
1352 3300047470 Ga0495681_0015344 Ga0495681_0015344_1760_2101 112
1353 3300047470 Ga0495681_0035761 Ga0495681_0035761_1304_1642 112
1354 3300047470 Ga0495681_0036942 Ga0495681_0036942_57_395 112
1355 3300047470 Ga0495681_0097904 Ga0495681_0097904_229_570 112
1356 3300047470 Ga0495681_0099466 Ga0495681_0099466_320_658 112
1357 3300047470 Ga0495681_0106013 Ga0495681_0106013_49_387 112
1358 3300047470 Ga0495681_0230786 Ga0495681_0230786_297_635 112
1359 3300047471 Ga0495684_0090390 Ga0495684_0090390_1951_2289 112
1360 3300047472 Ga0495686_0005162 Ga0495686_0005162_2262_2600 112
1361 3300047472 Ga0495686_0006307 Ga0495686_0006307_1452_1790 112
1362 3300047472 Ga0495686_0013547 Ga0495686_0013547_1548_1886 112
1363 3300047472 Ga0495686_0149960 Ga0495686_0149960_275_613 112
1364 3300047472 Ga0495686_0252080 Ga0495686_0252080_207_548 112
1365 3300047472 Ga0495686_0455018 Ga0495686_0455018_18_356 112
1366 3300047673 Ga0495593_0037726 Ga0495593_0037726_1957_2295 112
1367 3300047673 Ga0495593_0050719 Ga0495593_0050719_1702_2040 112
1368 3300047673 Ga0495593_0052157 Ga0495593_0052157_1289_1627 112
1369 3300047673 Ga0495593_0146396 Ga0495593_0146396_80_418 112
1370 3300048088 Ga0495602_0015757 Ga0495602_0015757_680_1018 112
1371 3300048091 Ga0495626_0000013 Ga0495626_0000013_174572_174913 112
1372 3300048091 Ga0495626_0000389 Ga0495626_0000389_12767_13105 112
1373 3300048091 Ga0495626_0000680 Ga0495626_0000680_23830_24168 112
1374 3300048091 Ga0495626_0001264 Ga0495626_0001264_8369_8707 112
1375 3300048091 Ga0495626_0003471 Ga0495626_0003471_7679_8017 112
1376 3300048091 Ga0495626_0006329 Ga0495626_0006329_767_1105 112
1377 3300048091 Ga0495626_0020479 Ga0495626_0020479_1769_2107 112
1378 3300048091 Ga0495626_0020898 Ga0495626_0020898_2648_2986 112
1379 3300048091 Ga0495626_0026645 Ga0495626_0026645_2206_2544 112
1380 3300048091 Ga0495626_0066297 Ga0495626_0066297_870_1208 112
1381 3300048091 Ga0495626_0085529 Ga0495626_0085529_572_910 112
1382 3300048091 Ga0495626_0128759 Ga0495626_0128759_722_1060 112
1383 3300048091 Ga0495626_0189645 Ga0495626_0189645_487_825 112
1384 3300048905 Ga0496102_0002591 Ga0496102_0002591_296_634 112
1385 3300048905 Ga0496102_0500466 Ga0496102_0500466_532_873 112
1386 3300048913 Ga0496110_0184682 Ga0496110_0184682_779_1117 112
1387 3300048913 Ga0496110_0501785 Ga0496110_0501785_24_365 112
1388 3300048914 Ga0496111_0362278 Ga0496111_0362278_712_1050 112
1389 3300048914 Ga0496111_0404496 Ga0496111_0404496_472_810 112
1390 3300048915 Ga0496112_0472818 Ga0496112_0472818_681_1019 112
1391 3300048916 Ga0496113_0604819 Ga0496113_0604819_81_422 112
1392 3300048919 Ga0496116_0000289 Ga0496116_0000289_10834_11172 112
1393 3300048919 Ga0496116_0000916 Ga0496116_0000916_9197_9535 112
1394 3300048919 Ga0496116_0010908 Ga0496116_0010908_742_1080 112
1395 3300048919 Ga0496116_0054648 Ga0496116_0054648_1557_1895 112
1396 3300048919 Ga0496116_0110915 Ga0496116_0110915_598_936 112
1397 3300048919 Ga0496116_0140181 Ga0496116_0140181_707_1045 112
1398 3300048919 Ga0496116_0331359 Ga0496116_0331359_259_600 112
1399 3300048920 Ga0496117_0005304 Ga0496117_0005304_10774_11112 112
1400 3300048920 Ga0496117_0007381 Ga0496117_0007381_9603_9944 112
1401 3300048920 Ga0496117_0042049 Ga0496117_0042049_1607_1945 112
1402 3300048920 Ga0496117_0120727 Ga0496117_0120727_610_948 112
1403 3300048920 Ga0496117_0159516 Ga0496117_0159516_406_747 112
1404 3300048920 Ga0496117_0194479 Ga0496117_0194479_435_773 112
1405 3300048920 Ga0496117_0210464 Ga0496117_0210464_476_817 112
1406 3300048921 Ga0496118_0035287 Ga0496118_0035287_758_1096 112
1407 3300048921 Ga0496118_0095553 Ga0496118_0095553_1653_1991 112
1408 3300048921 Ga0496118_0182983 Ga0496118_0182983_488_829 112
1409 3300048921 Ga0496118_0185349 Ga0496118_0185349_155_496 112
1410 3300048921 Ga0496118_0389705 Ga0496118_0389705_305_646 112
1411 3300048922 Ga0496119_0079134 Ga0496119_0079134_791_1129 112
1412 3300048922 Ga0496119_0129401 Ga0496119_0129401_745_1083 112
1413 3300048923 Ga0496120_0069996 Ga0496120_0069996_845_1183 112
1414 3300048923 Ga0496120_0163038 Ga0496120_0163038_703_1041 112
1415 3300048924 Ga0496121_0000422 Ga0496121_0000422_72449_72787 112
1416 3300048924 Ga0496121_0001439 Ga0496121_0001439_20981_21322 112
1417 3300048924 Ga0496121_0015727 Ga0496121_0015727_2285_2623 112
1418 3300048924 Ga0496121_0018770 Ga0496121_0018770_3287_3625 112
1419 3300048924 Ga0496121_0077283 Ga0496121_0077283_1556_1894 112
1420 3300048924 Ga0496121_0193818 Ga0496121_0193818_476_817 112
1421 3300048924 Ga0496121_0237160 Ga0496121_0237160_443_784 112
1422 3300048925 Ga0496122_0000297 Ga0496122_0000297_12767_13108 112
1423 3300048925 Ga0496122_0004526 Ga0496122_0004526_10367_10705 112
1424 3300048925 Ga0496122_0005158 Ga0496122_0005158_5765_6106 112
1425 3300048925 Ga0496122_0062391 Ga0496122_0062391_573_911 112
1426 3300048925 Ga0496122_0138082 Ga0496122_0138082_667_1005 112
1427 3300048925 Ga0496122_0299407 Ga0496122_0299407_485_826 112
1428 3300048925 Ga0496122_0540425 Ga0496122_0540425_92_430 112
1429 3300048926 Ga0496123_0000165 Ga0496123_0000165_62710_63051 112
1430 3300048926 Ga0496123_0012193 Ga0496123_0012193_4271_4612 112
1431 3300048926 Ga0496123_0042015 Ga0496123_0042015_2288_2629 112
1432 3300048926 Ga0496123_0059567 Ga0496123_0059567_1436_1774 112
1433 3300048926 Ga0496123_0094428 Ga0496123_0094428_641_982 112
1434 3300048926 Ga0496123_0106654 Ga0496123_0106654_679_1017 112
1435 3300048926 Ga0496123_0129368 Ga0496123_0129368_937_1275 112
1436 3300048926 Ga0496123_0212357 Ga0496123_0212357_478_819 112
1437 3300048927 Ga0496124_0000051 Ga0496124_0000051_113260_113601 112
1438 3300048927 Ga0496124_0001293 Ga0496124_0001293_1936_2277 112
1439 3300048927 Ga0496124_0002451 Ga0496124_0002451_10863_11204 112
1440 3300048927 Ga0496124_0007831 Ga0496124_0007831_3248_3586 112
1441 3300048927 Ga0496124_0008462 Ga0496124_0008462_9568_9906 112
1442 3300048927 Ga0496124_0021752 Ga0496124_0021752_3400_3738 112
1443 3300048927 Ga0496124_0071018 Ga0496124_0071018_833_1171 112
1444 3300048927 Ga0496124_0145842 Ga0496124_0145842_737_1078 112
1445 3300048927 Ga0496124_0181279 Ga0496124_0181279_670_1008 112
1446 3300048927 Ga0496124_0244303 Ga0496124_0244303_556_897 112
1447 3300048927 Ga0496124_0322489 Ga0496124_0322489_329_670 112
1448 3300048928 Ga0496125_0004825 Ga0496125_0004825_8633_8971 112
1449 3300048928 Ga0496125_0007659 Ga0496125_0007659_10449_10790 112
1450 3300048928 Ga0496125_0008210 Ga0496125_0008210_9792_10130 112
1451 3300048928 Ga0496125_0107488 Ga0496125_0107488_1036_1377 112
1452 3300048928 Ga0496125_0155761 Ga0496125_0155761_507_845 112
1453 3300048928 Ga0496125_0189171 Ga0496125_0189171_606_947 112
1454 3300048928 Ga0496125_0191554 Ga0496125_0191554_969_1307 112
1455 3300048928 Ga0496125_0235898 Ga0496125_0235898_425_766 112
1456 3300048928 Ga0496125_0258313 Ga0496125_0258313_479_820 112
1457 3300048929 Ga0496126_0340065 Ga0496126_0340065_413_754 112
1458 3300048929 Ga0496126_0676647 Ga0496126_0676647_59_397 112
1459 3300049459 Ga0495678_000199 Ga0495678_000199_61155_61496 112
1460 3300049459 Ga0495678_001007 Ga0495678_001007_11919_12257 112
1461 3300049459 Ga0495678_001084 Ga0495678_001084_725_1063 112
1462 3300049459 Ga0495678_003336 Ga0495678_003336_8196_8534 112
1463 3300049459 Ga0495678_006936 Ga0495678_006936_438_776 112
1464 3300049459 Ga0495678_011875 Ga0495678_011875_3277_3618 112
1465 3300049459 Ga0495678_016433 Ga0495678_016433_243_581 112
1466 3300049459 Ga0495678_019801 Ga0495678_019801_2604_2942 112
1467 3300049459 Ga0495678_020264 Ga0495678_020264_1136_1477 112
1468 3300049459 Ga0495678_024762 Ga0495678_024762_1508_1846 112
1469 3300049459 Ga0495678_034774 Ga0495678_034774_1040_1378 112
1470 3300049459 Ga0495678_038984 Ga0495678_038984_1474_1815 112
1471 3300049459 Ga0495678_054738 Ga0495678_054738_100_438 112
1472 3300049459 Ga0495678_059889 Ga0495678_059889_406_744 112
1473 3300049459 Ga0495678_142606 Ga0495678_142606_77_415 112
1474 3300049459 Ga0495678_156746 Ga0495678_156746_51_389 112
1475 3300049460 Ga0495682_0000083 Ga0495682_0000083_30743_31084 112
1476 3300049460 Ga0495682_0000396 Ga0495682_0000396_5311_5652 112
1477 3300049460 Ga0495682_0000838 Ga0495682_0000838_749_1087 112
1478 3300049460 Ga0495682_0003518 Ga0495682_0003518_30_368 112
1479 3300049460 Ga0495682_0013481 Ga0495682_0013481_2380_2718 112
1480 3300049460 Ga0495682_0042887 Ga0495682_0042887_15_353 112
1481 3300049460 Ga0495682_0064061 Ga0495682_0064061_855_1193 112
1482 3300049460 Ga0495682_0075511 Ga0495682_0075511_131_469 112
1483 3300049460 Ga0495682_0097485 Ga0495682_0097485_457_795 112
1484 3300049569 Ga0501032_0007420 Ga0501032_0007420_5519_5860 112
1485 3300049571 Ga0501034_0564611 Ga0501034_0564611_546_887 112
1486 3300049572 Ga0501036_1281984 Ga0501036_1281984_46_387 112
1487 3300049573 Ga0501037_0551619 Ga0501037_0551619_119_460 112
1488 3300049573 Ga0501037_0763130 Ga0501037_0763130_109_450 112
1489 3300049662 Ga0501222_031874 Ga0501222_031874_350_688 112
1490 3300049669 Ga0501235_012819 Ga0501235_012819_37_375 112
1491 3300049758 Ga0501241_000452 Ga0501241_000452_7950_8288 112
1492 3300050489 nmdc:mga03683_23924_c2 nmdc:mga03683_23924_c2_454_792 112
1493 3300050491 nmdc:mga00v17_305884_c1 nmdc:mga00v17_305884_c1_216_554 112
1494 3300050491 nmdc:mga00v17_344592_c1 nmdc:mga00v17_344592_c1_49_387 112
1495 3300050491 nmdc:mga00v17_941980_c1 nmdc:mga00v17_941980_c1_125_466 112
1496 3300050514 nmdc:mga08x19_1134843_c1 nmdc:mga08x19_1134843_c1_92_430 112
1497 3300050516 nmdc:mga0sz30_253049_c1 nmdc:mga0sz30_253049_c1_355_693 112
1498 3300053161 Ga0500634_0060013 Ga0500634_0060013_546_887 112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08888

HopJ

HopJ type III effector protein

17

122

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qhq-assembly1.cif.gz_A crystal structure of unknown function protein vpa0580 0.9405 3 112
2qhq-assembly1.cif.gz_A crystal structure of unknown function protein vpa0580 0.9165 3 112
8dhi-assembly2.cif.gz_B crystal structure of clostridioides difficile protein tyrosine phosphatase at ph 8.5 0.3926 44 99
6d36-assembly3.cif.gz_A structure of human arh3 bound to adp-ribose and magnesium 0.3102 7 88
8suk-assembly2.cif.gz_B structure of rhodococcus sp. usk13 darr-c-di-amp complex 0.3002 7 96
ID Description Score Start End Superfamily
2qhqA00 Alpha Beta;Alpha-Beta Barrel;pseudo Tubby roll;vpa0580 domain like 0.9024 1 110 3.20.160.10
2qhqA00 Alpha Beta;Alpha-Beta Barrel;pseudo Tubby roll;vpa0580 domain like 0.8716 1 110 3.20.160.10
af_A0A1D6EPF0_1_212_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5062 47 100 1.25.40.10
af_A0A1D6FEM7_69_324_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4858 49 100 1.25.40.10
af_Q54MS1_7_156_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.463 44 86 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A2V4JNA9-F1-model_v4 deleted 0.9993 2 112
AF-V4QGM4-F1-model_v4 Type III effector 0.9992 22 112
AF-A0A553H118-F1-model_v4 DUF1244 domain-containing protein 0.9961 4 112
AF-A0A2S6IYZ2-F1-model_v4 deleted 0.9958 1 86
AF-A0A661F312-F1-model_v4 Type III effector 0.9918 16 112

Feature Viewer

pLDDT pTM Quality
96.32 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map