F493849

General Info

Members Datasets Scaffolds Average Seq Length
1423 494 1206 188

Family's Representative Sequence

Representative Sequence 3300046542|Ga0495597_0034104|Ga0495597_0034104_1656_2249
Length 197
Sequence MRPREKNKMKRLLIMLFAGLVLAGCATSGQDPLAPKTANSVNLKRYQGTWYELARLPMYFQRDCAQSEAHYTLLPDGNVAVLNRCLTAQWQWEEVKGTAYPQVPGKTDKLWVEFDTWFSRLIPGVAKGEYWVLYVSDDYKTAIVGDPSRKYLWLLSRTPTVNGVVREELLSKARQQGYDTTRLIWRASDTQMAKTSN

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231010 Pseudomonas sp. GM25 Isolate Nodule
8 2511231011 Pseudomonas sp. GM30 Isolate Nodule
9 2511231012 Pseudomonas sp. GM33 Isolate Nodule
10 2511231014 Pseudomonas sp. GM48 Isolate Nodule
11 2511231015 Pseudomonas sp. GM49 Isolate Nodule
12 2511231016 Pseudomonas sp. GM50 Isolate Nodule
13 2511231017 Pseudomonas sp. GM55 Isolate Nodule
14 2511231020 Pseudomonas sp. GM74 Isolate Nodule
15 2511231021 Pseudomonas sp. GM78 Isolate Nodule
16 2511231022 Pseudomonas sp. GM79 Isolate Nodule
17 2511231023 Pseudomonas sp. GM80 Isolate Nodule
18 2511231031 Pseudomonas sp. GM16 Isolate Nodule
19 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
20 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
21 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
22 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
23 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
24 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
25 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
26 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
27 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
28 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
29 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
30 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
31 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
32 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
33 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
34 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
35 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
36 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
37 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
38 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
39 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
40 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
41 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
42 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
43 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
44 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
45 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
46 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
47 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
48 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
49 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
50 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
51 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
52 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
53 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
54 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
55 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
56 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
57 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
58 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
59 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
60 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
61 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
62 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
63 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
64 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
65 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
66 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
67 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
68 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
69 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
70 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
71 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
72 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
73 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
74 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
75 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
76 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
77 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
78 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
79 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
80 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
81 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
82 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
83 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
84 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
85 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
86 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
87 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
88 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
89 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
90 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
91 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
92 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
93 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
94 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
95 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
96 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
97 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
98 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
99 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
100 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
101 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
102 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
103 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
104 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
105 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
106 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
107 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
108 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
109 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
110 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
111 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
112 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
113 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
114 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
115 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
116 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
117 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
118 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
119 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
120 2773857670 Pseudomonas sp. 478 Isolate Unclassified
121 2773857673 Pseudomonas sp. 443 Isolate Unclassified
122 2784132063 Pseudomonas sp. 424 Isolate Unclassified
123 2784132072 Pseudomonas sp. 460 Isolate Unclassified
124 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
125 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
126 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
127 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
128 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
129 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
130 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
131 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
132 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
133 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
134 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
135 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
136 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
137 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
138 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
139 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
140 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
141 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
142 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
143 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
144 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
145 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
146 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
147 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
148 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
149 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
150 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
151 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
152 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
153 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
154 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
155 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
156 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
157 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
158 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
159 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
160 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
161 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
162 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
163 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
164 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
165 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
166 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
167 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
168 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
169 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
170 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
171 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
172 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
173 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
174 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
175 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
176 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
177 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
178 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
179 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
180 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
181 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
182 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
183 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
184 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
185 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
186 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
187 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
188 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
189 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
190 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
191 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
192 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
193 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
194 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
195 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
196 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
197 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
198 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
199 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
200 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
201 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
202 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
203 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
204 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
205 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
206 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
207 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
208 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
209 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
210 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
211 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
212 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
213 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
214 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
215 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
216 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
217 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
218 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
219 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
220 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
221 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
222 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
223 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
224 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
225 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
226 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
227 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
228 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
229 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
230 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
231 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
232 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
233 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
234 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
235 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
236 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
237 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
238 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
239 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
240 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
241 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
242 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
243 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
244 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
245 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
246 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
247 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
248 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
249 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
250 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
251 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
252 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
253 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
254 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
255 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
256 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
257 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
258 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
259 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
260 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
261 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
262 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
263 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
264 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
270 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
271 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
273 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
275 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
276 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
277 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
278 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
279 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
301 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
302 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
303 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
304 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
305 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
307 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
308 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
309 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
310 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
311 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
312 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
313 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
314 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
315 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
316 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
317 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
318 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
319 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
320 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
321 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
322 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
323 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
324 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
325 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
326 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
327 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
328 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
329 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
330 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
331 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
332 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
333 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
334 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
335 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
336 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
337 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
338 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
339 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
340 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
341 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
342 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
343 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
344 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
345 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
346 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
347 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
348 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
349 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
350 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
351 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
352 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
353 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
354 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
355 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
356 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
357 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
358 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
359 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
360 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
361 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
362 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
363 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
364 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
365 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
366 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
367 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
368 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
369 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
370 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
371 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
372 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
373 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
374 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
375 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
376 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
377 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
378 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
379 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
380 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
381 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
382 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
383 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
384 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
385 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
386 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
387 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
388 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
389 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
390 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
391 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
392 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
393 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
394 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
395 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
396 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
397 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
398 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
399 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
400 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
401 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
402 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
403 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
404 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
405 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
406 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
407 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
408 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
409 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
410 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
411 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
412 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
413 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
414 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
415 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
416 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
417 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
418 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
419 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
420 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
421 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
422 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
423 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
424 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
425 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
426 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
427 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
428 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
429 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
430 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
431 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
432 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
433 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
434 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
435 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
436 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
437 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
438 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
439 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
440 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
441 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
442 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
443 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
444 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
445 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
446 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
447 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
448 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
449 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
450 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
451 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
452 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
453 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
454 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
455 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
456 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
457 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
458 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
459 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
460 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
465 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
466 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
467 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
468 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
469 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
470 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
471 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
472 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
473 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
474 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
475 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
476 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
477 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
478 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
479 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
480 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
481 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
482 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
483 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
484 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
485 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
486 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
487 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
488 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
489 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
490 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
491 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
492 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
493 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
494 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.61
Metatranscriptomes 0.14
Isolates 15.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.92
Nodule 1.62
Rhizoplane 5.55
Rhizosphere 78.85
Stem 0
Stem Tuber 0
Unclassified 9.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_1221 2124908027 Bacteria 2275
2 MRS2a_Contig_52 2124908027 Bacteria 34043
3 MRS2a_Contig_7587 2124908027 Bacteria 2035
4 MRS2a_Contig_7777 2124908027 Bacteria 1900
5 MRS2a_Contig_8444 2124908027 Bacteria 1871
6 MRS2a_Contig_8608 2124908027 Bacteria 1879
7 MRS2a_Contig_9578 2124908027 Bacteria 1762
8 SwRhRL2b_contig_1469690 2162886007 Bacteria 3197
9 SwRhRL2b_contig_2969190 2162886007 Bacteria 1474
10 JGI24741J21665_1002858 3300001915 Bacteria 4341
11 JGI25162J39368_1000129 3300002737 Bacteria 83712
12 JGI25163J39215_1001029 3300002771 Bacteria 6020
13 JGI25163J39215_1001444 3300002771 Bacteria 3909
14 JGI25164J39214_1000076 3300002772 Bacteria 95821
15 JGI25164J39214_1000101 3300002772 Bacteria 83715
16 JGI25165J46597_1000150 3300003214 Bacteria 115430
17 JGI25165J46597_1000180 3300003214 Bacteria 95821
18 Ga0006562J51391_1014806 3300003578 Bacteria 911
19 Ga0055538_1000115 3300003751 Bacteria 61470
20 Ga0055539_1000162 3300003752 Bacteria 61470
21 Ga0055533_1000164 3300003756 Bacteria 61470
22 Ga0055532_1000153 3300003758 Bacteria 61470
23 Ga0055525_1000224 3300003759 Bacteria 61470
24 Ga0055535_1012559 3300003761 Bacteria 1288
25 Ga0055536_1000312 3300003781 Bacteria 36538
26 Ga0055536_1003306 3300003781 Bacteria 8724
27 Ga0055536_1003395 3300003781 Bacteria 8572
28 Ga0055530_10000404 3300003791 Bacteria 38699
29 Ga0055530_10003582 3300003791 Bacteria 8724
30 Ga0055530_10003672 3300003791 Bacteria 8572
31 Ga0055540_1000339 3300003792 Bacteria 40092
32 Ga0055540_1002883 3300003792 Bacteria 8724
33 Ga0055540_1002945 3300003792 Bacteria 8563
34 Ga0055540_1029894 3300003792 Bacteria 1270
35 Ga0055531_10000238 3300003794 Bacteria 60414
36 Ga0055541_1000107 3300003841 Bacteria 61470
37 Ga0065714_10000416 3300005288 Bacteria 8583
38 Ga0065714_10002970 3300005288 Bacteria 9705
39 Ga0065714_10003157 3300005288 Bacteria 8325
40 Ga0065714_10018725 3300005288 Bacteria 1662
41 Ga0065714_10019685 3300005288 Bacteria 1809
42 Ga0065714_10019913 3300005288 Bacteria 2222
43 Ga0065714_10044865 3300005288 Bacteria 984
44 Ga0065714_10089224 3300005288 Bacteria 1987
45 Ga0065714_10128246 3300005288 Bacteria 1275
46 Ga0065714_10236192 3300005288 Bacteria 802
47 Ga0065714_10243303 3300005288 Bacteria 781
48 Ga0065714_10267826 3300005288 Bacteria 744
49 Ga0065704_10003425 3300005289 Bacteria 4225
50 Ga0065704_10007980 3300005289 Bacteria 2555
51 Ga0065704_10071105 3300005289 Bacteria 13156
52 Ga0065704_10099524 3300005289 Bacteria 2307
53 Ga0065704_10174034 3300005289 Bacteria 1274
54 Ga0065704_10285287 3300005289 Bacteria 914
55 Ga0065704_10387747 3300005289 Bacteria 766
56 Ga0065704_10398946 3300005289 Bacteria 754
57 Ga0065712_10002657 3300005290 Bacteria 4286
58 Ga0065712_10107268 3300005290 Bacteria 1897
59 Ga0065715_10228515 3300005293 Bacteria 1243
60 Ga0070670_100000321 3300005331 Bacteria 40888
61 Ga0070661_100001439 3300005344 Bacteria 16550
62 Ga0070669_100000233 3300005353 Bacteria 46639
63 Ga0070669_100000265 3300005353 Bacteria 42842
64 Ga0070671_100393414 3300005355 Bacteria 1185
65 Ga0070659_100143101 3300005366 Bacteria 1947
66 Ga0070705_100566726 3300005440 Bacteria 873
67 Ga0070662_100001331 3300005457 Bacteria 15188
68 Ga0070662_100024057 3300005457 Bacteria 4192
69 Ga0068853_100000029 3300005539 Bacteria 121775
70 Ga0070665_100026744 3300005548 Bacteria 5811
71 Ga0070665_100168996 3300005548 Bacteria 2188
72 Ga0070664_100000531 3300005564 Bacteria 29123
73 Ga0068854_100020969 3300005578 Bacteria 4428
74 Ga0068851_10000035 3300005834 Bacteria 106588
75 Ga0075363_100201989 3300006048 Bacteria 1136
76 Ga0075363_100363670 3300006048 Bacteria 846
77 Ga0075364_10171824 3300006051 Bacteria 1465
78 Ga0075364_10239692 3300006051 Bacteria 1232
79 Ga0075364_10259335 3300006051 Bacteria 1182
80 Ga0075364_10392110 3300006051 Bacteria 947
81 Ga0075432_10001952 3300006058 Bacteria 6850
82 Ga0075432_10003404 3300006058 Bacteria 5384
83 Ga0075432_10013439 3300006058 Bacteria 2780
84 Ga0075432_10013492 3300006058 Bacteria 2776
85 Ga0075432_10025972 3300006058 Bacteria 2010
86 Ga0075432_10072442 3300006058 Bacteria 1239
87 Ga0075362_10015908 3300006177 Bacteria 3069
88 Ga0075362_10090263 3300006177 Bacteria 1421
89 Ga0075362_10142259 3300006177 Bacteria 1147
90 Ga0075362_10232408 3300006177 Bacteria 903
91 Ga0075362_10450667 3300006177 Bacteria 653
92 Ga0075436_100161149 3300006914 Bacteria 1581
93 Ga0075436_100244917 3300006914 Bacteria 1276
94 Ga0075436_100561674 3300006914 Bacteria 838
95 Ga0079104_1000423 3300006946 Bacteria 48297
96 Ga0079104_1001202 3300006946 Bacteria 18420
97 Ga0099826_10031348 3300006948 Bacteria 3847
98 Ga0105251_10000118 3300009011 Bacteria 79165
99 Ga0105251_10001252 3300009011 Bacteria 21984
100 Ga0105251_10001477 3300009011 Bacteria 20175
101 Ga0105251_10008261 3300009011 Bacteria 6291
102 Ga0105251_10009813 3300009011 Bacteria 5612
103 Ga0105251_10014226 3300009011 Bacteria 4413
104 Ga0105251_10032440 3300009011 Bacteria 2603
105 Ga0105251_10038137 3300009011 Bacteria 2355
106 Ga0105251_10045690 3300009011 Bacteria 2110
107 Ga0105251_10050491 3300009011 Bacteria 1987
108 Ga0105251_10051096 3300009011 Bacteria 1973
109 Ga0105244_10000969 3300009036 Bacteria 24124
110 Ga0105244_10001341 3300009036 Bacteria 20090
111 Ga0105244_10008644 3300009036 Bacteria 6342
112 Ga0105244_10009952 3300009036 Bacteria 5797
113 Ga0105244_10011044 3300009036 Bacteria 5442
114 Ga0105244_10045280 3300009036 Bacteria 2264
115 Ga0105244_10047706 3300009036 Bacteria 2195
116 Ga0105244_10048978 3300009036 Bacteria 2161
117 Ga0105244_10067010 3300009036 Bacteria 1796
118 Ga0105244_10091767 3300009036 Bacteria 1493
119 Ga0105244_10158620 3300009036 Bacteria 1081
120 Ga0105244_10178771 3300009036 Bacteria 1007
121 Ga0105250_10000251 3300009092 Bacteria 44435
122 Ga0105250_10000651 3300009092 Bacteria 22012
123 Ga0105250_10001638 3300009092 Bacteria 11927
124 Ga0105250_10017202 3300009092 Bacteria 2938
125 Ga0105250_10025506 3300009092 Bacteria 2382
126 Ga0105250_10095206 3300009092 Bacteria 1213
127 Ga0105250_10162459 3300009092 Bacteria 933
128 Ga0111539_11234771 3300009094 Bacteria 868
129 Ga0105243_10000299 3300009148 Bacteria 54796
130 Ga0105243_10001887 3300009148 Bacteria 17864
131 Ga0105243_10003109 3300009148 Bacteria 13648
132 Ga0105243_10105552 3300009148 Bacteria 2347
133 Ga0105243_10358176 3300009148 Bacteria 1342
134 Ga0105243_10424395 3300009148 Bacteria 1241
135 Ga0105242_10019973 3300009176 Bacteria 5249
136 Ga0105242_11564114 3300009176 Bacteria 692
137 Ga0105248_10062512 3300009177 Bacteria 4180
138 Ga0105237_10002856 3300009545 Bacteria 21007
139 Ga0105237_10117460 3300009545 Bacteria 2654
140 Ga0105249_10029972 3300009553 Bacteria 4915
141 Ga0105246_10000445 3300011119 Bacteria 22189
142 Ga0105246_10002004 3300011119 Bacteria 12297
143 Ga0105246_10234818 3300011119 Bacteria 1446
144 Ga0157336_1002792 3300012477 Bacteria 1012
145 Ga0157345_1000390 3300012498 Bacteria 4739
146 Ga0157345_1001327 3300012498 Bacteria 1748
147 Ga0157373_10000945 3300013100 Bacteria 22511
148 Ga0157373_10008664 3300013100 Bacteria 7547
149 Ga0157373_10066360 3300013100 Bacteria 2553
150 Ga0157373_10093854 3300013100 Bacteria 2113
151 Ga0157373_10128672 3300013100 Bacteria 1781
152 Ga0157373_10455059 3300013100 Bacteria 921
153 Ga0157373_10784105 3300013100 Bacteria 702
154 Ga0157371_10000238 3300013102 Bacteria 78535
155 Ga0157371_10004002 3300013102 Bacteria 13059
156 Ga0157371_10012849 3300013102 Bacteria 6377
157 Ga0157371_10140972 3300013102 Bacteria 1717
158 Ga0157371_10179654 3300013102 Bacteria 1513
159 Ga0157371_10293092 3300013102 Bacteria 1177
160 Ga0157370_10000085 3300013104 Bacteria 103847
161 Ga0157370_10023954 3300013104 Bacteria 6052
162 Ga0157370_10060146 3300013104 Bacteria 3608
163 Ga0157370_10062944 3300013104 Bacteria 3516
164 Ga0157370_10084229 3300013104 Bacteria 2989
165 Ga0157370_10102145 3300013104 Bacteria 2685
166 Ga0157370_10182238 3300013104 Bacteria 1951
167 Ga0157369_10020219 3300013105 Bacteria 7443
168 Ga0157369_10135729 3300013105 Bacteria 2605
169 Ga0157369_10163890 3300013105 Bacteria 2345
170 Ga0157369_10173309 3300013105 Bacteria 2272
171 Ga0157369_10251541 3300013105 Bacteria 1844
172 Ga0163162_10023363 3300013306 Bacteria 6102
173 Ga0163162_10178864 3300013306 Bacteria 2247
174 Ga0163162_10230509 3300013306 Bacteria 1982
175 Ga0163162_10560585 3300013306 Bacteria 1270
176 Ga0163162_10811585 3300013306 Bacteria 1052
177 Ga0157372_10092387 3300013307 Bacteria 3442
178 Ga0157375_10124390 3300013308 Bacteria 2692
179 Ga0157375_10221082 3300013308 Bacteria 2052
180 Ga0157375_10872717 3300013308 Bacteria 1045
181 Ga0182008_10003739 3300014497 Bacteria 9067
182 Ga0182008_10007470 3300014497 Bacteria 6031
183 Ga0182008_10008836 3300014497 Bacteria 5468
184 Ga0182008_10013087 3300014497 Bacteria 4364
185 Ga0182008_10016701 3300014497 Bacteria 3810
186 Ga0182008_10020397 3300014497 Bacteria 3414
187 Ga0182008_10025522 3300014497 Bacteria 3000
188 Ga0182008_10135796 3300014497 Bacteria 1228
189 Ga0182008_10345879 3300014497 Bacteria 787
190 Ga0182008_10469539 3300014497 Bacteria 687
191 Ga0182006_1000753 3300015261 Bacteria 22122
192 Ga0182006_1002780 3300015261 Bacteria 9350
193 Ga0182006_1005124 3300015261 Bacteria 6297
194 Ga0182006_1009250 3300015261 Bacteria 4426
195 Ga0182006_1014550 3300015261 Bacteria 3388
196 Ga0182006_1020209 3300015261 Bacteria 2793
197 Ga0182006_1022012 3300015261 Bacteria 2654
198 Ga0182006_1026996 3300015261 Bacteria 2347
199 Ga0182006_1033571 3300015261 Bacteria 2056
200 Ga0182006_1211361 3300015261 Bacteria 641
201 Ga0182007_10001061 3300015262 Bacteria 14989
202 Ga0182007_10014024 3300015262 Bacteria 3036
203 Ga0182005_1002918 3300015265 Bacteria 5939
204 Ga0182005_1003752 3300015265 Bacteria 5059
205 Ga0182005_1019012 3300015265 Bacteria 1896
206 Ga0182005_1034903 3300015265 Bacteria 1368
207 Ga0182005_1043009 3300015265 Bacteria 1228
208 Ga0182005_1073120 3300015265 Bacteria 942
209 Ga0182005_1120249 3300015265 Bacteria 747
210 Ga0163161_10028382 3300017792 Bacteria 3974
211 Ga0163161_10036066 3300017792 Bacteria 3541
212 Ga0163161_10076136 3300017792 Bacteria 2463
213 Ga0163161_10084006 3300017792 Bacteria 2347
214 Ga0163161_10093078 3300017792 Bacteria 2233
215 Ga0163161_10109392 3300017792 Bacteria 2064
216 Ga0163161_10457703 3300017792 Bacteria 1032
217 Ga0209435_102659 3300025206 Bacteria 2078
218 Ga0209760_100080 3300025207 Bacteria 77279
219 Ga0209760_100159 3300025207 Bacteria 40609
220 Ga0209784_100087 3300025224 Bacteria 122062
221 Ga0209566_100106 3300025225 Bacteria 122062
222 Ga0209674_100128 3300025226 Bacteria 122062
223 Ga0209147_100129 3300025229 Bacteria 122062
224 Ga0209563_100122 3300025230 Bacteria 122062
225 Ga0207427_100014 3300025231 Bacteria 561361
226 Ga0207427_100016 3300025231 Bacteria 538697
227 Ga0209437_100011 3300025233 Bacteria 818520
228 Ga0209437_100016 3300025233 Bacteria 710118
229 Ga0209258_100352 3300025242 Bacteria 64206
230 Ga0209646_1004290 3300025246 Bacteria 2619
231 Ga0209677_100078 3300025253 Bacteria 122062
232 Ga0209759_1013188 3300025256 Bacteria 2249
233 Ga0209759_1013881 3300025256 Bacteria 2159
234 Ga0209233_1000019 3300025261 Bacteria 818520
235 Ga0209233_1000036 3300025261 Bacteria 561361
236 Ga0209675_1002039 3300025291 Bacteria 10782
237 Ga0209676_1000025 3300025292 Bacteria 577569
238 Ga0209676_1000032 3300025292 Bacteria 469558
239 Ga0209676_1000208 3300025292 Bacteria 130879
240 Ga0209676_1008844 3300025292 Bacteria 4430
241 Ga0209050_1000025 3300025298 Bacteria 528225
242 Ga0209050_1000028 3300025298 Bacteria 477133
243 Ga0209050_1000381 3300025298 Bacteria 83623
244 Ga0209050_1004298 3300025298 Bacteria 9733
245 Ga0209051_1000026 3300025303 Bacteria 413311
246 Ga0209051_1000080 3300025303 Bacteria 199694
247 Ga0209051_1000299 3300025303 Bacteria 78310
248 Ga0209051_1007210 3300025303 Bacteria 6114
249 Ga0209257_1000034 3300025304 Bacteria 662719
250 Ga0207656_10000008 3300025321 Bacteria 275365
251 Ga0207696_1000020 3300025711 Bacteria 434998
252 Ga0207696_1000057 3300025711 Bacteria 249404
253 Ga0207696_1000084 3300025711 Bacteria 196086
254 Ga0207696_1001618 3300025711 Bacteria 11910
255 Ga0207696_1001785 3300025711 Bacteria 11107
256 Ga0207696_1015745 3300025711 Bacteria 2553
257 Ga0207696_1019215 3300025711 Bacteria 2230
258 Ga0207655_1000014 3300025728 Bacteria 607124
259 Ga0207655_1000904 3300025728 Bacteria 30971
260 Ga0207655_1001055 3300025728 Bacteria 27513
261 Ga0207655_1001190 3300025728 Bacteria 25175
262 Ga0207655_1002635 3300025728 Bacteria 14206
263 Ga0207655_1008767 3300025728 Bacteria 6367
264 Ga0207655_1008839 3300025728 Bacteria 6333
265 Ga0207655_1008967 3300025728 Bacteria 6273
266 Ga0207655_1014494 3300025728 Bacteria 4451
267 Ga0207655_1016259 3300025728 Bacteria 4081
268 Ga0207655_1019073 3300025728 Bacteria 3606
269 Ga0207655_1021200 3300025728 Bacteria 3308
270 Ga0207655_1032022 3300025728 Bacteria 2411
271 Ga0207655_1060432 3300025728 Bacteria 1469
272 Ga0207655_1170742 3300025728 Bacteria 672
273 Ga0207713_1000031 3300025735 Bacteria 283971
274 Ga0207713_1000114 3300025735 Bacteria 132170
275 Ga0207713_1000537 3300025735 Bacteria 38140
276 Ga0207713_1000814 3300025735 Bacteria 28848
277 Ga0207713_1000823 3300025735 Bacteria 28708
278 Ga0207713_1002650 3300025735 Bacteria 12853
279 Ga0207713_1009755 3300025735 Bacteria 5377
280 Ga0207713_1012347 3300025735 Bacteria 4576
281 Ga0207713_1029279 3300025735 Bacteria 2469
282 Ga0207713_1036246 3300025735 Bacteria 2118
283 Ga0207713_1052298 3300025735 Bacteria 1618
284 Ga0207713_1059722 3300025735 Bacteria 1462
285 Ga0207713_1087237 3300025735 Bacteria 1106
286 Ga0207671_10000015 3300025914 Bacteria 439607
287 Ga0207649_10000001 3300025920 Bacteria 537851
288 Ga0207681_10003730 3300025923 Bacteria 9469
289 Ga0207650_10000239 3300025925 Bacteria 60879
290 Ga0207650_10000329 3300025925 Bacteria 46145
291 Ga0207644_10242954 3300025931 Bacteria 1434
292 Ga0207690_10114470 3300025932 Bacteria 1948
293 Ga0207706_10000885 3300025933 Bacteria 30776
294 Ga0207706_10023197 3300025933 Bacteria 5573
295 Ga0207686_10004530 3300025934 Bacteria 7446
296 Ga0207686_11083749 3300025934 Bacteria 653
297 Ga0207709_10000451 3300025935 Bacteria 38328
298 Ga0207709_10001143 3300025935 Bacteria 19344
299 Ga0207709_10023633 3300025935 Bacteria 3500
300 Ga0207709_10118321 3300025935 Bacteria 1784
301 Ga0207709_10282213 3300025935 Bacteria 1227
302 Ga0207669_10538028 3300025937 Bacteria 941
303 Ga0207711_10051129 3300025941 Bacteria 3538
304 Ga0207679_10000009 3300025945 Bacteria 357262
305 Ga0207679_10844412 3300025945 Bacteria 836
306 Ga0207712_10015979 3300025961 Bacteria 4851
307 Ga0207640_10270882 3300025981 Bacteria 1328
308 Ga0207639_10000090 3300026041 Bacteria 76134
309 Ga0209281_1000026 3300027111 Bacteria 465877
310 Ga0209281_1000033 3300027111 Bacteria 383539
311 Ga0209999_1021528 3300027543 Bacteria 1184
312 Ga0209282_1053453 3300027666 Bacteria 2299
313 Ga0209974_10036493 3300027876 Bacteria 1632
314 Ga0207428_10049095 3300027907 Bacteria 3383
315 Ga0207428_10066966 3300027907 Bacteria 2829
316 Ga0207428_10095968 3300027907 Bacteria 2297
317 Ga0207428_10118080 3300027907 Bacteria 2036
318 Ga0207428_10144919 3300027907 Bacteria 1811
319 Ga0207428_10147461 3300027907 Bacteria 1793
320 Ga0207428_10232651 3300027907 Bacteria 1379
321 Ga0207428_10250272 3300027907 Bacteria 1322
322 Ga0207428_10270798 3300027907 Bacteria 1262
323 Ga0207428_10340233 3300027907 Bacteria 1105
324 Ga0207428_10378057 3300027907 Bacteria 1039
325 Ga0268266_10010145 3300028379 Bacteria 8256
326 Ga0268266_10398129 3300028379 Bacteria 1301
327 Ga0268266_10502825 3300028379 Bacteria 1157
328 Ga0268266_10856734 3300028379 Bacteria 878
329 Ga0307511_10053758 3300030521 Bacteria 3186
330 Ga0316177_1177268 3300030731 Bacteria 1569
331 Ga0314311_1075429 3300030733 Bacteria 7772
332 Ga0316179_1006263 3300030734 Bacteria 7142
333 Ga0316178_1102168 3300030735 Bacteria 42019
334 Ga0316181_1002693 3300030744 Bacteria 2163
335 Ga0316181_1121023 3300030744 Bacteria 6205
336 Ga0307408_100012498 3300031548 Bacteria 5627
337 Ga0307408_100032358 3300031548 Bacteria 3645
338 Ga0307408_100037404 3300031548 Bacteria 3418
339 Ga0307408_100064408 3300031548 Bacteria 2684
340 Ga0307408_100365380 3300031548 Bacteria 1229
341 Ga0307408_100792034 3300031548 Bacteria 859
342 Ga0307516_10375404 3300031730 Bacteria 1084
343 Ga0307516_10413951 3300031730 Bacteria 1006
344 Ga0307516_10663563 3300031730 Bacteria 698
345 Ga0307516_10682850 3300031730 Bacteria 683
346 Ga0307405_10007313 3300031731 Bacteria 5508
347 Ga0307405_10008242 3300031731 Bacteria 5270
348 Ga0307405_10192149 3300031731 Bacteria 1475
349 Ga0307413_10009156 3300031824 Bacteria 4723
350 Ga0307413_10351581 3300031824 Bacteria 1137
351 Ga0307406_10063345 3300031901 Bacteria 2395
352 Ga0307406_10064223 3300031901 Bacteria 2381
353 Ga0307406_10075363 3300031901 Bacteria 2225
354 Ga0307407_10022269 3300031903 Bacteria 3283
355 Ga0307407_10181792 3300031903 Bacteria 1394
356 Ga0307407_10211307 3300031903 Bacteria 1306
357 Ga0307412_10004350 3300031911 Bacteria 7896
358 Ga0307412_10016014 3300031911 Bacteria 4455
359 Ga0307412_10046924 3300031911 Bacteria 2833
360 Ga0307412_10079810 3300031911 Bacteria 2258
361 Ga0307409_100024465 3300031995 Bacteria 4212
362 Ga0307409_100059172 3300031995 Bacteria 2980
363 Ga0307416_100238636 3300032002 Bacteria 1759
364 Ga0307414_10018336 3300032004 Bacteria 4306
365 Ga0307414_10035341 3300032004 Bacteria 3324
366 Ga0307414_10141088 3300032004 Bacteria 1886
367 Ga0307414_10783747 3300032004 Bacteria 868
368 Ga0307411_10022884 3300032005 Bacteria 3689
369 Ga0307411_10028510 3300032005 Bacteria 3395
370 Ga0307510_10255860 3300033180 Bacteria 1235
371 Ga0307510_10278147 3300033180 Bacteria 1146
372 Ga0237819_01489 3300038705 Bacteria 6005
373 Ga0439438_003654 3300041405 Bacteria 6145
374 Ga0439438_004828 3300041405 Bacteria 5080
375 Ga0439438_005738 3300041405 Bacteria 4514
376 Ga0439438_008517 3300041405 Bacteria 3393
377 Ga0439438_009720 3300041405 Bacteria 3094
378 Ga0439438_011790 3300041405 Bacteria 2705
379 Ga0439438_012563 3300041405 Bacteria 2592
380 Ga0439438_020043 3300041405 Bacteria 1881
381 Ga0439438_021687 3300041405 Bacteria 1788
382 Ga0439438_109455 3300041405 Bacteria 667
383 Ga0439447_001162 3300041407 Bacteria 9597
384 Ga0439447_002676 3300041407 Bacteria 6451
385 Ga0439447_003145 3300041407 Bacteria 5885
386 Ga0439447_009907 3300041407 Bacteria 2858
387 Ga0439447_013534 3300041407 Bacteria 2311
388 Ga0439447_019669 3300041407 Bacteria 1797
389 Ga0439447_037941 3300041407 Bacteria 1185
390 Ga0439447_041274 3300041407 Bacteria 1123
391 Ga0439461_0012965 3300041410 Bacteria 1566
392 Ga0439466_0002609 3300041411 Bacteria 7054
393 Ga0439466_0010095 3300041411 Bacteria 3511
394 Ga0439466_0015149 3300041411 Bacteria 2802
395 Ga0439466_0023349 3300041411 Bacteria 2176
396 Ga0439466_0024797 3300041411 Bacteria 2098
397 Ga0439466_0041874 3300041411 Bacteria 1526
398 Ga0439466_0042655 3300041411 Bacteria 1509
399 Ga0439466_0065398 3300041411 Bacteria 1165
400 Ga0439466_0102254 3300041411 Bacteria 892
401 Ga0439466_0123004 3300041411 Bacteria 800
402 Ga0439466_0166073 3300041411 Bacteria 674
403 Ga0439466_0197879 3300041411 Bacteria 611
404 Ga0439465_0021499 3300041413 Bacteria 2023
405 Ga0439465_0181168 3300041413 Bacteria 762
406 Ga0439431_0036057 3300041997 Bacteria 1244
407 Ga0439445_0034593 3300042004 Bacteria 1324
408 Ga0439445_0083072 3300042004 Bacteria 896
409 Ga0439432_007470 3300042006 Bacteria 3873
410 Ga0439432_010854 3300042006 Bacteria 3146
411 Ga0439432_010861 3300042006 Bacteria 3145
412 Ga0439432_013727 3300042006 Bacteria 2750
413 Ga0439432_018291 3300042006 Bacteria 2342
414 Ga0439432_037859 3300042006 Bacteria 1537
415 Ga0439432_049827 3300042006 Bacteria 1308
416 Ga0439451_000219 3300042009 Bacteria 10960
417 Ga0439451_003423 3300042009 Bacteria 3216
418 Ga0439451_009673 3300042009 Bacteria 1949
419 Ga0439451_012251 3300042009 Bacteria 1730
420 Ga0439452_000786 3300042010 Bacteria 15052
421 Ga0439452_000858 3300042010 Bacteria 14069
422 Ga0439452_000882 3300042010 Bacteria 13826
423 Ga0439452_007512 3300042010 Bacteria 3337
424 Ga0439452_017937 3300042010 Bacteria 1892
425 Ga0439452_019221 3300042010 Bacteria 1809
426 Ga0439452_101407 3300042010 Bacteria 618
427 Ga0439456_001434 3300042013 Bacteria 4790
428 Ga0439456_003499 3300042013 Bacteria 3184
429 Ga0439456_004040 3300042013 Bacteria 2977
430 Ga0439456_013673 3300042013 Bacteria 1690
431 Ga0439456_034785 3300042013 Bacteria 1085
432 Ga0439463_000059 3300042016 Bacteria 23483
433 Ga0439463_001280 3300042016 Bacteria 6714
434 Ga0439463_002011 3300042016 Bacteria 5283
435 Ga0439463_007735 3300042016 Bacteria 2654
436 Ga0450911_000355 3300042115 Bacteria 15573
437 Ga0450911_001787 3300042115 Bacteria 4617
438 Ga0450911_020729 3300042115 Bacteria 858
439 Ga0450919_002716 3300042121 Bacteria 2279
440 Ga0450919_005971 3300042121 Bacteria 1451
441 Ga0450920_003893 3300042122 Bacteria 2603
442 Ga0450922_001766 3300042124 Bacteria 2090
443 Ga0450922_002275 3300042124 Bacteria 1817
444 Ga0450890_002796 3300042127 Bacteria 2365
445 Ga0450902_002664 3300042137 Bacteria 2542
446 Ga0450902_006480 3300042137 Bacteria 1793
447 Ga0450902_007764 3300042137 Bacteria 1665
448 Ga0450902_015368 3300042137 Bacteria 1241
449 Ga0450902_022188 3300042137 Bacteria 1050
450 Ga0450903_003286 3300042138 Bacteria 2807
451 Ga0450903_005488 3300042138 Bacteria 2123
452 Ga0450903_005831 3300042138 Bacteria 2054
453 Ga0450903_010751 3300042138 Bacteria 1479
454 Ga0450903_031479 3300042138 Bacteria 800
455 Ga0450904_004131 3300042139 Bacteria 1521
456 Ga0450904_005098 3300042139 Bacteria 1342
457 Ga0450904_016033 3300042139 Bacteria 750
458 Ga0450905_015875 3300042142 Bacteria 1082
459 Ga0450905_027645 3300042142 Bacteria 862
460 Ga0450906_001300 3300042145 Bacteria 5479
461 Ga0450906_003092 3300042145 Bacteria 3601
462 Ga0450906_004459 3300042145 Bacteria 2937
463 Ga0450906_015452 3300042145 Bacteria 1387
464 Ga0450907_000751 3300042146 Bacteria 8228
465 Ga0450907_001928 3300042146 Bacteria 4193
466 Ga0450907_008730 3300042146 Bacteria 1680
467 Ga0450907_015168 3300042146 Bacteria 1285
468 Ga0450910_001148 3300042147 Bacteria 3275
469 Ga0450910_001197 3300042147 Bacteria 3228
470 Ga0439446_0005785 3300042156 Bacteria 3196
471 Ga0439446_0021796 3300042156 Bacteria 1812
472 Ga0439446_0166510 3300042156 Bacteria 731
473 Ga0450908_002052 3300042184 Bacteria 3933
474 Ga0450908_015740 3300042184 Bacteria 1352
475 Ga0450909_000194 3300042185 Bacteria 6967
476 Ga0450909_004815 3300042185 Bacteria 1932
477 Ga0450909_006031 3300042185 Bacteria 1747
478 Ga0450909_017250 3300042185 Bacteria 1069
479 Ga0450909_027573 3300042185 Bacteria 857
480 Ga0439434_0007561 3300042435 Bacteria 3184
481 Ga0439434_0019121 3300042435 Bacteria 2053
482 Ga0439464_0017084 3300042439 Bacteria 1964
483 Ga0439460_0000931 3300042461 Bacteria 6688
484 Ga0439460_0005366 3300042461 Bacteria 3143
485 Ga0439460_0043704 3300042461 Bacteria 1324
486 Ga0450918_004836 3300042531 Bacteria 2436
487 Ga0450893_0008146 3300042532 Bacteria 1705
488 Ga0450893_0015623 3300042532 Bacteria 1281
489 Ga0450901_001538 3300042533 Bacteria 2620
490 Ga0439440_0002263 3300042993 Bacteria 3612
491 Ga0439440_0004511 3300042993 Bacteria 2736
492 Ga0439440_0042963 3300042993 Bacteria 1107
493 Ga0495617_000455 3300046452 Bacteria 22035
494 Ga0495617_016968 3300046452 Bacteria 2461
495 Ga0495617_020572 3300046452 Bacteria 2229
496 Ga0495617_023097 3300046452 Bacteria 2101
497 Ga0495617_032429 3300046452 Bacteria 1753
498 Ga0495617_042487 3300046452 Bacteria 1519
499 Ga0495617_079982 3300046452 Bacteria 1071
500 Ga0495617_122407 3300046452 Bacteria 837
501 Ga0495617_166455 3300046452 Bacteria 697
502 Ga0495627_000774 3300046453 Bacteria 23729
503 Ga0495627_002889 3300046453 Bacteria 7913
504 Ga0495627_004710 3300046453 Bacteria 5639
505 Ga0495627_005252 3300046453 Bacteria 5252
506 Ga0495627_005394 3300046453 Bacteria 5160
507 Ga0495627_024536 3300046453 Bacteria 1964
508 Ga0495603_0019755 3300046455 Bacteria 4078
509 Ga0495603_0021930 3300046455 Bacteria 3866
510 Ga0495603_0032367 3300046455 Bacteria 3146
511 Ga0495603_0127178 3300046455 Bacteria 1485
512 Ga0495590_0005324 3300046457 Bacteria 5109
513 Ga0495590_0005345 3300046457 Bacteria 5096
514 Ga0495590_0006976 3300046457 Bacteria 4381
515 Ga0495590_0010131 3300046457 Bacteria 3555
516 Ga0495590_0067163 3300046457 Bacteria 1256
517 Ga0495590_0137570 3300046457 Bacteria 880
518 Ga0495590_0213544 3300046457 Bacteria 711
519 Ga0495590_0219809 3300046457 Bacteria 701
520 Ga0495591_001374 3300046458 Bacteria 15248
521 Ga0495591_002443 3300046458 Bacteria 10336
522 Ga0495591_004511 3300046458 Bacteria 6779
523 Ga0495591_007579 3300046458 Bacteria 4589
524 Ga0495591_011222 3300046458 Bacteria 3408
525 Ga0495591_011767 3300046458 Bacteria 3290
526 Ga0495591_013401 3300046458 Bacteria 3001
527 Ga0495591_020900 3300046458 Bacteria 2149
528 Ga0495591_021315 3300046458 Bacteria 2117
529 Ga0495591_022568 3300046458 Bacteria 2031
530 Ga0495591_023376 3300046458 Bacteria 1982
531 Ga0495591_023901 3300046458 Bacteria 1948
532 Ga0495591_027487 3300046458 Bacteria 1753
533 Ga0495629_0041841 3300046459 Bacteria 3221
534 Ga0495629_0489478 3300046459 Bacteria 830
535 Ga0495638_0012439 3300046460 Bacteria 5834
536 Ga0495638_0012494 3300046460 Bacteria 5817
537 Ga0495638_0040709 3300046460 Bacteria 2943
538 Ga0495638_0042708 3300046460 Bacteria 2863
539 Ga0495638_0066208 3300046460 Bacteria 2221
540 Ga0495638_0083955 3300046460 Bacteria 1928
541 Ga0495638_0085550 3300046460 Bacteria 1906
542 Ga0495638_0102268 3300046460 Bacteria 1712
543 Ga0495638_0142455 3300046460 Bacteria 1397
544 Ga0495638_0146968 3300046460 Bacteria 1370
545 Ga0495638_0151961 3300046460 Bacteria 1342
546 Ga0495638_0170600 3300046460 Bacteria 1248
547 Ga0495638_0172172 3300046460 Bacteria 1241
548 Ga0495638_0264652 3300046460 Bacteria 941
549 Ga0495638_0352668 3300046460 Bacteria 776
550 Ga0495653_0012803 3300046463 Bacteria 6848
551 Ga0495653_0028107 3300046463 Bacteria 4500
552 Ga0495653_0031214 3300046463 Bacteria 4236
553 Ga0495653_0114074 3300046463 Bacteria 1936
554 Ga0495653_0123821 3300046463 Bacteria 1838
555 Ga0495653_0150220 3300046463 Bacteria 1628
556 Ga0495650_0000718 3300046471 Bacteria 42025
557 Ga0495650_0005047 3300046471 Bacteria 8743
558 Ga0495650_0009711 3300046471 Bacteria 5451
559 Ga0495650_0016359 3300046471 Bacteria 3761
560 Ga0495650_0023485 3300046471 Bacteria 2935
561 Ga0495650_0027069 3300046471 Bacteria 2656
562 Ga0495650_0028337 3300046471 Bacteria 2573
563 Ga0495650_0030367 3300046471 Bacteria 2449
564 Ga0495650_0041241 3300046471 Bacteria 1975
565 Ga0495650_0063363 3300046471 Bacteria 1474
566 Ga0495650_0078816 3300046471 Bacteria 1274
567 Ga0495650_0081303 3300046471 Bacteria 1248
568 Ga0495580_0372099 3300046472 Bacteria 966
569 Ga0495582_0017643 3300046473 Bacteria 3905
570 Ga0495605_0000095 3300046474 Bacteria 112622
571 Ga0495605_0000210 3300046474 Bacteria 71875
572 Ga0495605_0000677 3300046474 Bacteria 25677
573 Ga0495605_0005176 3300046474 Bacteria 7598
574 Ga0495605_0009136 3300046474 Bacteria 5576
575 Ga0495605_0010025 3300046474 Bacteria 5308
576 Ga0495605_0031661 3300046474 Bacteria 2700
577 Ga0495605_0043335 3300046474 Bacteria 2231
578 Ga0495605_0048388 3300046474 Bacteria 2081
579 Ga0495605_0056973 3300046474 Bacteria 1883
580 Ga0495605_0068052 3300046474 Bacteria 1688
581 Ga0495605_0097537 3300046474 Bacteria 1354
582 Ga0495605_0120364 3300046474 Bacteria 1190
583 Ga0495605_0208639 3300046474 Bacteria 849
584 Ga0495605_0448754 3300046474 Bacteria 531
585 Ga0495639_0003452 3300046475 Bacteria 6842
586 Ga0495639_0015143 3300046475 Bacteria 3342
587 Ga0495584_0003386 3300046491 Bacteria 8802
588 Ga0495584_0007805 3300046491 Bacteria 5566
589 Ga0495584_0007989 3300046491 Bacteria 5498
590 Ga0495584_0009605 3300046491 Bacteria 4983
591 Ga0495584_0012470 3300046491 Bacteria 4338
592 Ga0495584_0015823 3300046491 Bacteria 3847
593 Ga0495584_0021844 3300046491 Bacteria 3249
594 Ga0495584_0043299 3300046491 Bacteria 2272
595 Ga0495584_0055595 3300046491 Bacteria 1991
596 Ga0495584_0074820 3300046491 Bacteria 1702
597 Ga0495584_0124809 3300046491 Bacteria 1304
598 Ga0495584_0236655 3300046491 Bacteria 928
599 Ga0495585_0003371 3300046492 Bacteria 10813
600 Ga0495585_0005619 3300046492 Bacteria 7875
601 Ga0495585_0006088 3300046492 Bacteria 7538
602 Ga0495585_0010425 3300046492 Bacteria 5531
603 Ga0495585_0039415 3300046492 Bacteria 2655
604 Ga0495585_0045544 3300046492 Bacteria 2448
605 Ga0495585_0060206 3300046492 Bacteria 2090
606 Ga0495585_0071601 3300046492 Bacteria 1889
607 Ga0495585_0081521 3300046492 Bacteria 1752
608 Ga0495585_0094497 3300046492 Bacteria 1606
609 Ga0495585_0123613 3300046492 Bacteria 1367
610 Ga0495585_0312204 3300046492 Bacteria 770
611 Ga0495585_0353485 3300046492 Bacteria 713
612 Ga0495594_0019233 3300046499 Bacteria 3627
613 Ga0495594_0060885 3300046499 Bacteria 2088
614 Ga0495594_0073147 3300046499 Bacteria 1907
615 Ga0495596_0000545 3300046500 Bacteria 23624
616 Ga0495596_0009976 3300046500 Bacteria 4156
617 Ga0495596_0041180 3300046500 Bacteria 1821
618 Ga0495607_0001262 3300046501 Bacteria 22625
619 Ga0495607_0001270 3300046501 Bacteria 22565
620 Ga0495607_0002719 3300046501 Bacteria 14112
621 Ga0495607_0006625 3300046501 Bacteria 8121
622 Ga0495607_0007849 3300046501 Bacteria 7346
623 Ga0495607_0009146 3300046501 Bacteria 6734
624 Ga0495607_0011725 3300046501 Bacteria 5816
625 Ga0495607_0011903 3300046501 Bacteria 5762
626 Ga0495607_0018908 3300046501 Bacteria 4382
627 Ga0495607_0024517 3300046501 Bacteria 3759
628 Ga0495607_0032189 3300046501 Bacteria 3204
629 Ga0495607_0034685 3300046501 Bacteria 3059
630 Ga0495607_0049452 3300046501 Bacteria 2451
631 Ga0495607_0062114 3300046501 Bacteria 2119
632 Ga0495607_0102207 3300046501 Bacteria 1533
633 Ga0495607_0134971 3300046501 Bacteria 1279
634 Ga0495607_0207657 3300046501 Bacteria 965
635 Ga0495583_0000015 3300046506 Bacteria 316392
636 Ga0495583_0002179 3300046506 Bacteria 17464
637 Ga0495583_0003557 3300046506 Bacteria 11736
638 Ga0495583_0004153 3300046506 Bacteria 10584
639 Ga0495583_0004386 3300046506 Bacteria 10129
640 Ga0495583_0005087 3300046506 Bacteria 9072
641 Ga0495583_0005841 3300046506 Bacteria 8210
642 Ga0495583_0016855 3300046506 Bacteria 3903
643 Ga0495583_0060381 3300046506 Bacteria 1695
644 Ga0495606_0000447 3300046507 Bacteria 67335
645 Ga0495606_0001171 3300046507 Bacteria 36971
646 Ga0495606_0001936 3300046507 Bacteria 25665
647 Ga0495606_0008312 3300046507 Bacteria 9047
648 Ga0495606_0013954 3300046507 Bacteria 6302
649 Ga0495606_0016616 3300046507 Bacteria 5601
650 Ga0495606_0050737 3300046507 Bacteria 2711
651 Ga0495606_0054299 3300046507 Bacteria 2594
652 Ga0495606_0070073 3300046507 Bacteria 2213
653 Ga0495606_0074835 3300046507 Bacteria 2120
654 Ga0495606_0076337 3300046507 Bacteria 2094
655 Ga0495606_0086187 3300046507 Bacteria 1941
656 Ga0495606_0131494 3300046507 Bacteria 1487
657 Ga0495606_0144676 3300046507 Bacteria 1401
658 Ga0495606_0161981 3300046507 Bacteria 1304
659 Ga0495610_0002985 3300046512 Bacteria 13635
660 Ga0495610_0005122 3300046512 Bacteria 9422
661 Ga0495610_0011082 3300046512 Bacteria 5536
662 Ga0495610_0014750 3300046512 Bacteria 4575
663 Ga0495610_0015733 3300046512 Bacteria 4385
664 Ga0495610_0018883 3300046512 Bacteria 3876
665 Ga0495610_0025624 3300046512 Bacteria 3160
666 Ga0495610_0038432 3300046512 Bacteria 2429
667 Ga0495610_0046616 3300046512 Bacteria 2137
668 Ga0495610_0050024 3300046512 Bacteria 2042
669 Ga0495610_0070362 3300046512 Bacteria 1634
670 Ga0495610_0126079 3300046512 Bacteria 1116
671 Ga0495610_0153796 3300046512 Bacteria 978
672 Ga0495616_0008264 3300046513 Bacteria 6177
673 Ga0495616_0028400 3300046513 Bacteria 2962
674 Ga0495616_0031098 3300046513 Bacteria 2798
675 Ga0495616_0034511 3300046513 Bacteria 2627
676 Ga0495616_0042070 3300046513 Bacteria 2327
677 Ga0495616_0044965 3300046513 Bacteria 2238
678 Ga0495616_0051284 3300046513 Bacteria 2058
679 Ga0495616_0052474 3300046513 Bacteria 2030
680 Ga0495616_0077587 3300046513 Bacteria 1594
681 Ga0495616_0083364 3300046513 Bacteria 1525
682 Ga0495616_0087161 3300046513 Bacteria 1484
683 Ga0495616_0138782 3300046513 Bacteria 1108
684 Ga0495620_0000171 3300046515 Bacteria 51260
685 Ga0495620_0000422 3300046515 Bacteria 28117
686 Ga0495620_0001025 3300046515 Bacteria 17183
687 Ga0495620_0006643 3300046515 Bacteria 6338
688 Ga0495620_0019112 3300046515 Bacteria 3379
689 Ga0495620_0039388 3300046515 Bacteria 2088
690 Ga0495620_0048978 3300046515 Bacteria 1810
691 Ga0495620_0053634 3300046515 Bacteria 1706
692 Ga0495620_0080680 3300046515 Bacteria 1316
693 Ga0495620_0087307 3300046515 Bacteria 1254
694 Ga0495620_0113317 3300046515 Bacteria 1073
695 Ga0495630_0076740 3300046517 Bacteria 2518
696 Ga0495630_0169221 3300046517 Bacteria 1664
697 Ga0495631_0001164 3300046518 Bacteria 16262
698 Ga0495631_0001255 3300046518 Bacteria 15676
699 Ga0495631_0003289 3300046518 Bacteria 8885
700 Ga0495631_0017389 3300046518 Bacteria 3403
701 Ga0495631_0024638 3300046518 Bacteria 2778
702 Ga0495631_0043549 3300046518 Bacteria 1980
703 Ga0495631_0106366 3300046518 Bacteria 1206
704 Ga0495631_0264005 3300046518 Bacteria 733
705 Ga0495632_0000599 3300046519 Bacteria 33406
706 Ga0495632_0001743 3300046519 Bacteria 17635
707 Ga0495632_0008921 3300046519 Bacteria 6093
708 Ga0495632_0018170 3300046519 Bacteria 3864
709 Ga0495632_0020196 3300046519 Bacteria 3612
710 Ga0495632_0021415 3300046519 Bacteria 3483
711 Ga0495632_0029449 3300046519 Bacteria 2858
712 Ga0495632_0047488 3300046519 Bacteria 2128
713 Ga0495632_0055878 3300046519 Bacteria 1931
714 Ga0495632_0057390 3300046519 Bacteria 1900
715 Ga0495632_0065841 3300046519 Bacteria 1749
716 Ga0495632_0102163 3300046519 Bacteria 1350
717 Ga0495632_0106803 3300046519 Bacteria 1316
718 Ga0495632_0164002 3300046519 Bacteria 1022
719 Ga0495632_0256411 3300046519 Bacteria 783
720 Ga0495637_0000298 3300046520 Bacteria 38413
721 Ga0495637_0000682 3300046520 Bacteria 23481
722 Ga0495637_0003904 3300046520 Bacteria 7820
723 Ga0495637_0006005 3300046520 Bacteria 6136
724 Ga0495637_0010927 3300046520 Bacteria 4375
725 Ga0495637_0015818 3300046520 Bacteria 3533
726 Ga0495637_0022942 3300046520 Bacteria 2840
727 Ga0495637_0029600 3300046520 Bacteria 2436
728 Ga0495637_0034836 3300046520 Bacteria 2202
729 Ga0495637_0037391 3300046520 Bacteria 2108
730 Ga0495637_0038157 3300046520 Bacteria 2081
731 Ga0495637_0038188 3300046520 Bacteria 2080
732 Ga0495637_0038338 3300046520 Bacteria 2075
733 Ga0495637_0040992 3300046520 Bacteria 1989
734 Ga0495637_0042080 3300046520 Bacteria 1956
735 Ga0495637_0044203 3300046520 Bacteria 1897
736 Ga0495637_0046417 3300046520 Bacteria 1837
737 Ga0495637_0046505 3300046520 Bacteria 1835
738 Ga0495637_0066996 3300046520 Bacteria 1458
739 Ga0495637_0092456 3300046520 Bacteria 1191
740 Ga0495637_0107775 3300046520 Bacteria 1082
741 Ga0495637_0211366 3300046520 Bacteria 709
742 Ga0495643_0000275 3300046522 Bacteria 73599
743 Ga0495643_0003494 3300046522 Bacteria 11452
744 Ga0495643_0035491 3300046522 Bacteria 2745
745 Ga0495643_0059837 3300046522 Bacteria 2024
746 Ga0495643_0062319 3300046522 Bacteria 1974
747 Ga0495643_0069382 3300046522 Bacteria 1852
748 Ga0495643_0112799 3300046522 Bacteria 1380
749 Ga0495644_0012997 3300046523 Bacteria 3199
750 Ga0495644_0014061 3300046523 Bacteria 3067
751 Ga0495644_0014791 3300046523 Bacteria 2988
752 Ga0495644_0033845 3300046523 Bacteria 1929
753 Ga0495644_0103635 3300046523 Bacteria 1077
754 Ga0495648_0002138 3300046524 Bacteria 18598
755 Ga0495648_0004952 3300046524 Bacteria 11194
756 Ga0495648_0017526 3300046524 Bacteria 5115
757 Ga0495648_0042007 3300046524 Bacteria 2880
758 Ga0495648_0050682 3300046524 Bacteria 2534
759 Ga0495648_0066717 3300046524 Bacteria 2108
760 Ga0495648_0067113 3300046524 Bacteria 2099
761 Ga0495648_0081613 3300046524 Bacteria 1838
762 Ga0495648_0089340 3300046524 Bacteria 1729
763 Ga0495648_0105871 3300046524 Bacteria 1541
764 Ga0495648_0125908 3300046524 Bacteria 1369
765 Ga0495648_0153197 3300046524 Bacteria 1200
766 Ga0495648_0180481 3300046524 Bacteria 1073
767 Ga0495648_0201218 3300046524 Bacteria 997
768 Ga0495648_0217536 3300046524 Bacteria 944
769 Ga0495648_0341847 3300046524 Bacteria 687
770 Ga0495666_0009808 3300046526 Bacteria 4785
771 Ga0495666_0050547 3300046526 Bacteria 1998
772 Ga0495666_0086301 3300046526 Bacteria 1482
773 Ga0495666_0105907 3300046526 Bacteria 1323
774 Ga0495642_0000662 3300046528 Bacteria 17247
775 Ga0495642_0000940 3300046528 Bacteria 13633
776 Ga0495642_0001149 3300046528 Bacteria 12168
777 Ga0495654_0002214 3300046530 Bacteria 12610
778 Ga0495654_0002962 3300046530 Bacteria 10621
779 Ga0495654_0003190 3300046530 Bacteria 10152
780 Ga0495654_0004163 3300046530 Bacteria 8669
781 Ga0495654_0008075 3300046530 Bacteria 5837
782 Ga0495654_0010317 3300046530 Bacteria 5083
783 Ga0495654_0012918 3300046530 Bacteria 4478
784 Ga0495654_0019426 3300046530 Bacteria 3553
785 Ga0495654_0024355 3300046530 Bacteria 3128
786 Ga0495654_0026202 3300046530 Bacteria 3000
787 Ga0495654_0037029 3300046530 Bacteria 2449
788 Ga0495654_0060094 3300046530 Bacteria 1827
789 Ga0495654_0064933 3300046530 Bacteria 1743
790 Ga0495654_0071347 3300046530 Bacteria 1646
791 Ga0495654_0071765 3300046530 Bacteria 1640
792 Ga0495654_0078122 3300046530 Bacteria 1556
793 Ga0495654_0220038 3300046530 Bacteria 803
794 Ga0495654_0290121 3300046530 Bacteria 670
795 Ga0495586_0040896 3300046535 Bacteria 2495
796 Ga0495587_0005497 3300046536 Bacteria 8266
797 Ga0495587_0084211 3300046536 Bacteria 1841
798 Ga0495587_0089703 3300046536 Bacteria 1776
799 Ga0495609_0000023 3300046538 Bacteria 269702
800 Ga0495609_0000133 3300046538 Bacteria 79787
801 Ga0495609_0000283 3300046538 Bacteria 46879
802 Ga0495609_0004074 3300046538 Bacteria 8141
803 Ga0495609_0005158 3300046538 Bacteria 6953
804 Ga0495609_0024670 3300046538 Bacteria 2757
805 Ga0495609_0039423 3300046538 Bacteria 2126
806 Ga0495609_0040830 3300046538 Bacteria 2087
807 Ga0495609_0044094 3300046538 Bacteria 2001
808 Ga0495609_0100648 3300046538 Bacteria 1252
809 Ga0495609_0116338 3300046538 Bacteria 1151
810 Ga0495597_0005379 3300046542 Bacteria 6784
811 Ga0495597_0008603 3300046542 Bacteria 5105
812 Ga0495597_0023962 3300046542 Bacteria 2820
813 Ga0495597_0032667 3300046542 Bacteria 2360
814 Ga0495597_0034104 3300046542 Bacteria 2301
815 Ga0495597_0040652 3300046542 Bacteria 2078
816 Ga0495597_0044277 3300046542 Bacteria 1979
817 Ga0495597_0064245 3300046542 Bacteria 1594
818 Ga0495597_0065840 3300046542 Bacteria 1571
819 Ga0495597_0260937 3300046542 Bacteria 678
820 Ga0495645_0122563 3300046543 Bacteria 1829
821 Ga0495645_0122675 3300046543 Bacteria 1828
822 Ga0495622_0004078 3300046557 Bacteria 6816
823 Ga0495622_0005065 3300046557 Bacteria 6109
824 Ga0495622_0005369 3300046557 Bacteria 5950
825 Ga0495622_0017563 3300046557 Bacteria 3331
826 Ga0495622_0020920 3300046557 Bacteria 3046
827 Ga0495622_0037454 3300046557 Bacteria 2259
828 Ga0495622_0122763 3300046557 Bacteria 1185
829 Ga0495633_0000115 3300046558 Bacteria 108676
830 Ga0495633_0042419 3300046558 Bacteria 2161
831 Ga0495633_0155308 3300046558 Bacteria 1056
832 Ga0495633_0180790 3300046558 Bacteria 971
833 Ga0495656_0002913 3300046615 Bacteria 5734
834 Ga0495656_0120760 3300046615 Bacteria 1236
835 Ga0495668_0004933 3300046616 Bacteria 9250
836 Ga0495668_0018947 3300046616 Bacteria 3975
837 Ga0495668_0039437 3300046616 Bacteria 2636
838 Ga0495668_0040031 3300046616 Bacteria 2615
839 Ga0495668_0060650 3300046616 Bacteria 2086
840 Ga0495668_0441984 3300046616 Bacteria 715
841 Ga0495634_0021303 3300046642 Bacteria 4584
842 Ga0495634_0068730 3300046642 Bacteria 2339
843 Ga0495611_0001128 3300046648 Bacteria 13999
844 Ga0495611_0001569 3300046648 Bacteria 11197
845 Ga0495611_0002357 3300046648 Bacteria 8703
846 Ga0495611_0010313 3300046648 Bacteria 3952
847 Ga0495611_0060026 3300046648 Bacteria 1727
848 Ga0495611_0082430 3300046648 Bacteria 1480
849 Ga0495625_0000086 3300046660 Bacteria 151735
850 Ga0495625_0010751 3300046660 Bacteria 7534
851 Ga0495625_0035194 3300046660 Bacteria 3692
852 Ga0495625_0048039 3300046660 Bacteria 3074
853 Ga0495625_0048220 3300046660 Bacteria 3068
854 Ga0495625_0088525 3300046660 Bacteria 2144
855 Ga0495625_0113337 3300046660 Bacteria 1852
856 Ga0495625_0266700 3300046660 Bacteria 1106
857 Ga0495625_0397651 3300046660 Bacteria 861
858 Ga0495625_0476882 3300046660 Bacteria 766
859 Ga0495635_0037544 3300046663 Bacteria 3353
860 Ga0495635_0079104 3300046663 Bacteria 2250
861 Ga0495659_0009273 3300046664 Bacteria 3138
862 Ga0495659_0018107 3300046664 Bacteria 2342
863 Ga0495659_0035310 3300046664 Bacteria 1761
864 Ga0495659_0035603 3300046664 Bacteria 1755
865 Ga0495661_0000212 3300046665 Bacteria 67078
866 Ga0495661_0000346 3300046665 Bacteria 50529
867 Ga0495661_0001099 3300046665 Bacteria 23697
868 Ga0495661_0001263 3300046665 Bacteria 21779
869 Ga0495661_0002096 3300046665 Bacteria 15649
870 Ga0495661_0012008 3300046665 Bacteria 5862
871 Ga0495661_0024608 3300046665 Bacteria 3898
872 Ga0495661_0033288 3300046665 Bacteria 3252
873 Ga0495661_0060089 3300046665 Bacteria 2259
874 Ga0495661_0123447 3300046665 Bacteria 1427
875 Ga0495661_0133370 3300046665 Bacteria 1358
876 Ga0495661_0202470 3300046665 Bacteria 1038
877 Ga0495661_0235281 3300046665 Bacteria 942
878 Ga0495588_0053519 3300046674 Bacteria 2081
879 Ga0495588_0101058 3300046674 Bacteria 1515
880 Ga0495588_0128232 3300046674 Bacteria 1338
881 Ga0495588_0477975 3300046674 Bacteria 653
882 Ga0495623_0049321 3300046679 Bacteria 2668
883 Ga0495623_0093101 3300046679 Bacteria 1845
884 Ga0495646_0029139 3300046680 Bacteria 3451
885 Ga0495646_0061964 3300046680 Bacteria 2225
886 Ga0495669_0041772 3300046684 Bacteria 2037
887 Ga0495669_0050527 3300046684 Bacteria 1864
888 Ga0495613_0073876 3300046689 Bacteria 2483
889 Ga0495624_0003018 3300046690 Bacteria 12599
890 Ga0495670_0005198 3300046691 Bacteria 6403
891 Ga0495670_0005874 3300046691 Bacteria 6017
892 Ga0495670_0024764 3300046691 Bacteria 2967
893 Ga0495670_0035369 3300046691 Bacteria 2490
894 Ga0495670_0046547 3300046691 Bacteria 2166
895 Ga0495670_0053988 3300046691 Bacteria 2012
896 Ga0495670_0072854 3300046691 Bacteria 1740
897 Ga0495670_0147805 3300046691 Bacteria 1231
898 Ga0495670_0333253 3300046691 Bacteria 815
899 Ga0495670_0349687 3300046691 Bacteria 795
900 Ga0495670_0377669 3300046691 Bacteria 764
901 Ga0495671_0001074 3300046692 Bacteria 18901
902 Ga0495671_0001719 3300046692 Bacteria 14214
903 Ga0495671_0002381 3300046692 Bacteria 11922
904 Ga0495671_0004628 3300046692 Bacteria 8161
905 Ga0495671_0008562 3300046692 Bacteria 5745
906 Ga0495671_0009715 3300046692 Bacteria 5363
907 Ga0495671_0017612 3300046692 Bacteria 3801
908 Ga0495671_0017976 3300046692 Bacteria 3759
909 Ga0495671_0028763 3300046692 Bacteria 2859
910 Ga0495671_0046843 3300046692 Bacteria 2161
911 Ga0495671_0071470 3300046692 Bacteria 1704
912 Ga0495671_0097903 3300046692 Bacteria 1434
913 Ga0495671_0139049 3300046692 Bacteria 1183
914 Ga0495671_0161808 3300046692 Bacteria 1088
915 Ga0495671_0167791 3300046692 Bacteria 1067
916 Ga0495671_0199090 3300046692 Bacteria 971
917 Ga0495649_0001824 3300046694 Bacteria 15645
918 Ga0495649_0002918 3300046694 Bacteria 11831
919 Ga0495649_0006570 3300046694 Bacteria 7230
920 Ga0495649_0009293 3300046694 Bacteria 5851
921 Ga0495649_0012385 3300046694 Bacteria 4964
922 Ga0495649_0020831 3300046694 Bacteria 3675
923 Ga0495649_0025151 3300046694 Bacteria 3316
924 Ga0495649_0034059 3300046694 Bacteria 2803
925 Ga0495649_0045464 3300046694 Bacteria 2393
926 Ga0495649_0051404 3300046694 Bacteria 2234
927 Ga0495649_0103467 3300046694 Bacteria 1512
928 Ga0495649_0115894 3300046694 Bacteria 1418
929 Ga0495649_0146262 3300046694 Bacteria 1242
930 Ga0495649_0164004 3300046694 Bacteria 1164
931 Ga0495649_0195920 3300046694 Bacteria 1050
932 Ga0495649_0271588 3300046694 Bacteria 867
933 Ga0495589_0000918 3300046794 Bacteria 18098
934 Ga0495589_0002071 3300046794 Bacteria 11354
935 Ga0495589_0006815 3300046794 Bacteria 6011
936 Ga0495589_0022499 3300046794 Bacteria 3216
937 Ga0495589_0033703 3300046794 Bacteria 2571
938 Ga0495589_0040345 3300046794 Bacteria 2331
939 Ga0495589_0044617 3300046794 Bacteria 2204
940 Ga0495589_0057899 3300046794 Bacteria 1905
941 Ga0495589_0061486 3300046794 Bacteria 1843
942 Ga0495589_0080630 3300046794 Bacteria 1583
943 Ga0495589_0120311 3300046794 Bacteria 1264
944 Ga0495589_0375673 3300046794 Bacteria 653
945 Ga0495600_0008491 3300046809 Bacteria 6311
946 Ga0495600_0087221 3300046809 Bacteria 2036
947 Ga0495660_0006218 3300046810 Bacteria 7083
948 Ga0495660_0021679 3300046810 Bacteria 3676
949 Ga0495660_0030938 3300046810 Bacteria 3012
950 Ga0495660_0040453 3300046810 Bacteria 2583
951 Ga0495660_0042889 3300046810 Bacteria 2497
952 Ga0495660_0059804 3300046810 Bacteria 2048
953 Ga0495660_0060605 3300046810 Bacteria 2032
954 Ga0495660_0089201 3300046810 Bacteria 1605
955 Ga0495660_0098098 3300046810 Bacteria 1512
956 Ga0495660_0104511 3300046810 Bacteria 1453
957 Ga0495660_0110063 3300046810 Bacteria 1406
958 Ga0495660_0129146 3300046810 Bacteria 1270
959 Ga0495660_0145547 3300046810 Bacteria 1174
960 Ga0495660_0156275 3300046810 Bacteria 1122
961 Ga0495660_0157528 3300046810 Bacteria 1116
962 Ga0495660_0166767 3300046810 Bacteria 1075
963 Ga0495660_0272355 3300046810 Bacteria 777
964 Ga0495660_0331907 3300046810 Bacteria 680
965 Ga0495660_0402591 3300046810 Bacteria 599
966 Ga0495660_0440045 3300046810 Bacteria 565
967 Ga0495581_0031064 3300047315 Bacteria 3094
968 Ga0495581_0042878 3300047315 Bacteria 2618
969 Ga0495604_0052891 3300047317 Bacteria 3142
970 Ga0495604_0260585 3300047317 Bacteria 1178
971 Ga0495636_0025266 3300047318 Bacteria 2410
972 Ga0495636_0035699 3300047318 Bacteria 2048
973 Ga0495636_0348878 3300047318 Bacteria 698
974 Ga0495674_0306087 3300047319 Bacteria 1297
975 Ga0495674_0487922 3300047319 Bacteria 987
976 Ga0495672_0004360 3300047320 Bacteria 11624
977 Ga0495672_0006960 3300047320 Bacteria 8600
978 Ga0495672_0011630 3300047320 Bacteria 6197
979 Ga0495672_0011714 3300047320 Bacteria 6166
980 Ga0495672_0012419 3300047320 Bacteria 5942
981 Ga0495672_0013235 3300047320 Bacteria 5699
982 Ga0495672_0019239 3300047320 Bacteria 4508
983 Ga0495672_0025428 3300047320 Bacteria 3790
984 Ga0495672_0041790 3300047320 Bacteria 2769
985 Ga0495672_0051736 3300047320 Bacteria 2417
986 Ga0495672_0064337 3300047320 Bacteria 2100
987 Ga0495672_0064492 3300047320 Bacteria 2097
988 Ga0495672_0066207 3300047320 Bacteria 2062
989 Ga0495672_0093497 3300047320 Bacteria 1646
990 Ga0495672_0107598 3300047320 Bacteria 1501
991 Ga0495672_0149300 3300047320 Bacteria 1213
992 Ga0495672_0275310 3300047320 Bacteria 806
993 Ga0495672_0303383 3300047320 Bacteria 755
994 Ga0495676_0000022 3300047321 Bacteria 163719
995 Ga0495676_0016350 3300047321 Bacteria 6589
996 Ga0495676_0035049 3300047321 Bacteria 4202
997 Ga0495680_0002433 3300047322 Bacteria 19048
998 Ga0495680_0081021 3300047322 Bacteria 2451
999 Ga0495683_0000106 3300047323 Bacteria 86579
1000 Ga0495683_0000586 3300047323 Bacteria 27461
1001 Ga0495683_0008727 3300047323 Bacteria 5408
1002 Ga0495683_0021732 3300047323 Bacteria 3304
1003 Ga0495683_0042215 3300047323 Bacteria 2299
1004 Ga0495683_0053073 3300047323 Bacteria 2022
1005 Ga0495683_0062707 3300047323 Bacteria 1838
1006 Ga0495683_0069908 3300047323 Bacteria 1724
1007 Ga0495683_0091978 3300047323 Bacteria 1468
1008 Ga0495683_0094419 3300047323 Bacteria 1445
1009 Ga0495683_0168935 3300047323 Bacteria 1006
1010 Ga0495683_0185416 3300047323 Bacteria 947
1011 Ga0495687_009721 3300047443 Bacteria 5346
1012 Ga0495687_019318 3300047443 Bacteria 3348
1013 Ga0495687_025117 3300047443 Bacteria 2822
1014 Ga0495687_044644 3300047443 Bacteria 1924
1015 Ga0495687_194818 3300047443 Bacteria 649
1016 Ga0495675_0016907 3300047444 Bacteria 4615
1017 Ga0495675_0021298 3300047444 Bacteria 4127
1018 Ga0495675_0372864 3300047444 Bacteria 836
1019 Ga0495677_0039882 3300047445 Bacteria 1716
1020 Ga0495679_000212 3300047446 Bacteria 49948
1021 Ga0495679_000341 3300047446 Bacteria 36651
1022 Ga0495679_012307 3300047446 Bacteria 3261
1023 Ga0495679_012746 3300047446 Bacteria 3185
1024 Ga0495679_023886 3300047446 Bacteria 2067
1025 Ga0495679_062538 3300047446 Bacteria 1089
1026 Ga0495685_028743 3300047447 Bacteria 1912
1027 Ga0495685_119629 3300047447 Bacteria 865
1028 Ga0495685_166686 3300047447 Bacteria 712
1029 Ga0495673_0001296 3300047469 Bacteria 20380
1030 Ga0495673_0001363 3300047469 Bacteria 19747
1031 Ga0495673_0005218 3300047469 Bacteria 7898
1032 Ga0495673_0006168 3300047469 Bacteria 7099
1033 Ga0495673_0007676 3300047469 Bacteria 6161
1034 Ga0495673_0009165 3300047469 Bacteria 5492
1035 Ga0495673_0009710 3300047469 Bacteria 5299
1036 Ga0495673_0015501 3300047469 Bacteria 3926
1037 Ga0495673_0016199 3300047469 Bacteria 3818
1038 Ga0495673_0023171 3300047469 Bacteria 3026
1039 Ga0495673_0023716 3300047469 Bacteria 2978
1040 Ga0495673_0025879 3300047469 Bacteria 2812
1041 Ga0495673_0039192 3300047469 Bacteria 2150
1042 Ga0495673_0039341 3300047469 Bacteria 2146
1043 Ga0495673_0064280 3300047469 Bacteria 1561
1044 Ga0495673_0065871 3300047469 Bacteria 1537
1045 Ga0495673_0069533 3300047469 Bacteria 1484
1046 Ga0495673_0074219 3300047469 Bacteria 1423
1047 Ga0495673_0095519 3300047469 Bacteria 1209
1048 Ga0495673_0113282 3300047469 Bacteria 1082
1049 Ga0495673_0119406 3300047469 Bacteria 1045
1050 Ga0495673_0132848 3300047469 Bacteria 977
1051 Ga0495673_0218389 3300047469 Bacteria 706
1052 Ga0495673_0231373 3300047469 Bacteria 681
1053 Ga0495681_0002383 3300047470 Bacteria 13460
1054 Ga0495681_0008341 3300047470 Bacteria 6507
1055 Ga0495681_0009563 3300047470 Bacteria 5955
1056 Ga0495681_0010666 3300047470 Bacteria 5548
1057 Ga0495681_0014598 3300047470 Bacteria 4490
1058 Ga0495681_0016197 3300047470 Bacteria 4192
1059 Ga0495681_0020738 3300047470 Bacteria 3557
1060 Ga0495681_0024255 3300047470 Bacteria 3200
1061 Ga0495681_0042141 3300047470 Bacteria 2211
1062 Ga0495681_0042229 3300047470 Bacteria 2208
1063 Ga0495681_0042389 3300047470 Bacteria 2202
1064 Ga0495681_0046313 3300047470 Bacteria 2074
1065 Ga0495681_0054417 3300047470 Bacteria 1869
1066 Ga0495681_0070798 3300047470 Bacteria 1580
1067 Ga0495681_0074431 3300047470 Bacteria 1531
1068 Ga0495681_0079109 3300047470 Bacteria 1471
1069 Ga0495684_0080277 3300047471 Bacteria 2476
1070 Ga0495686_0024531 3300047472 Bacteria 3960
1071 Ga0495686_0043750 3300047472 Bacteria 2837
1072 Ga0495686_0080129 3300047472 Bacteria 1996
1073 Ga0495686_0095852 3300047472 Bacteria 1796
1074 Ga0495686_0099678 3300047472 Bacteria 1753
1075 Ga0495686_0101601 3300047472 Bacteria 1733
1076 Ga0495686_0172162 3300047472 Bacteria 1259
1077 Ga0495593_0066199 3300047673 Bacteria 1883
1078 Ga0495593_0110035 3300047673 Bacteria 1407
1079 Ga0495593_0195121 3300047673 Bacteria 1018
1080 Ga0495614_0377631 3300048089 Bacteria 663
1081 Ga0495626_0000039 3300048091 Bacteria 175454
1082 Ga0495626_0000242 3300048091 Bacteria 63298
1083 Ga0495626_0001832 3300048091 Bacteria 15978
1084 Ga0495626_0003249 3300048091 Bacteria 10524
1085 Ga0495626_0007397 3300048091 Bacteria 6115
1086 Ga0495626_0007505 3300048091 Bacteria 6063
1087 Ga0495626_0008286 3300048091 Bacteria 5717
1088 Ga0495626_0019780 3300048091 Bacteria 3362
1089 Ga0495626_0028016 3300048091 Bacteria 2734
1090 Ga0495626_0035168 3300048091 Bacteria 2391
1091 Ga0495626_0042266 3300048091 Bacteria 2141
1092 Ga0495626_0137415 3300048091 Bacteria 1038
1093 Ga0496102_0002921 3300048905 Bacteria 14497
1094 Ga0496102_0198028 3300048905 Bacteria 1893
1095 Ga0496102_0403979 3300048905 Bacteria 1284
1096 Ga0496102_0784596 3300048905 Bacteria 875
1097 Ga0496102_1018273 3300048905 Bacteria 749
1098 Ga0496103_0042627 3300048906 Bacteria 2793
1099 Ga0496105_0496967 3300048908 Bacteria 958
1100 Ga0496106_0555718 3300048909 Bacteria 921
1101 Ga0496107_0462916 3300048910 Bacteria 941
1102 Ga0496110_0069439 3300048913 Bacteria 3120
1103 Ga0496110_0222777 3300048913 Bacteria 1715
1104 Ga0496110_0282651 3300048913 Bacteria 1511
1105 Ga0496111_0180093 3300048914 Bacteria 1571
1106 Ga0496112_0284582 3300048915 Bacteria 1600
1107 Ga0496112_0298266 3300048915 Bacteria 1557
1108 Ga0496116_0000881 3300048919 Bacteria 37470
1109 Ga0496116_0004892 3300048919 Bacteria 12634
1110 Ga0496116_0007271 3300048919 Bacteria 9863
1111 Ga0496116_0065054 3300048919 Bacteria 2341
1112 Ga0496116_0074269 3300048919 Bacteria 2139
1113 Ga0496116_0153232 3300048919 Bacteria 1276
1114 Ga0496117_0002861 3300048920 Bacteria 20985
1115 Ga0496117_0007359 3300048920 Bacteria 10779
1116 Ga0496117_0021194 3300048920 Bacteria 5268
1117 Ga0496117_0043046 3300048920 Bacteria 3288
1118 Ga0496117_0048698 3300048920 Bacteria 3023
1119 Ga0496117_0092372 3300048920 Bacteria 1944
1120 Ga0496117_0105225 3300048920 Bacteria 1774
1121 Ga0496117_0157082 3300048920 Bacteria 1337
1122 Ga0496117_0204903 3300048920 Bacteria 1111
1123 Ga0496117_0205328 3300048920 Bacteria 1110
1124 Ga0496118_0060606 3300048921 Bacteria 2808
1125 Ga0496118_0106211 3300048921 Bacteria 1879
1126 Ga0496118_0119530 3300048921 Bacteria 1722
1127 Ga0496118_0127206 3300048921 Bacteria 1645
1128 Ga0496118_0238739 3300048921 Bacteria 1042
1129 Ga0496118_0390528 3300048921 Bacteria 726
1130 Ga0496119_0070401 3300048922 Bacteria 2051
1131 Ga0496119_0151806 3300048922 Bacteria 1240
1132 Ga0496120_0047984 3300048923 Bacteria 2459
1133 Ga0496120_0134465 3300048923 Bacteria 1262
1134 Ga0496121_0001650 3300048924 Bacteria 36892
1135 Ga0496121_0002827 3300048924 Bacteria 25645
1136 Ga0496121_0007210 3300048924 Bacteria 13464
1137 Ga0496121_0079525 3300048924 Bacteria 2602
1138 Ga0496121_0082253 3300048924 Bacteria 2546
1139 Ga0496121_0106561 3300048924 Bacteria 2148
1140 Ga0496122_0001366 3300048925 Bacteria 39678
1141 Ga0496122_0064257 3300048925 Bacteria 2671
1142 Ga0496122_0066437 3300048925 Bacteria 2605
1143 Ga0496122_0096686 3300048925 Bacteria 1990
1144 Ga0496122_0102300 3300048925 Bacteria 1910
1145 Ga0496122_0368390 3300048925 Bacteria 742
1146 Ga0496123_0001033 3300048926 Bacteria 42272
1147 Ga0496123_0027453 3300048926 Bacteria 4239
1148 Ga0496123_0045321 3300048926 Bacteria 2997
1149 Ga0496123_0075715 3300048926 Bacteria 2075
1150 Ga0496123_0134713 3300048926 Bacteria 1361
1151 Ga0496124_0001280 3300048927 Bacteria 38218
1152 Ga0496124_0015978 3300048927 Bacteria 7164
1153 Ga0496124_0024994 3300048927 Bacteria 5417
1154 Ga0496124_0052583 3300048927 Bacteria 3459
1155 Ga0496124_0083431 3300048927 Bacteria 2621
1156 Ga0496124_0097120 3300048927 Bacteria 2392
1157 Ga0496124_0200268 3300048927 Bacteria 1519
1158 Ga0496124_0216008 3300048927 Bacteria 1446
1159 Ga0496124_0362166 3300048927 Bacteria 1021
1160 Ga0496124_0415880 3300048927 Bacteria 928
1161 Ga0496124_0471936 3300048927 Bacteria 849
1162 Ga0496125_0018486 3300048928 Bacteria 6619
1163 Ga0496125_0079916 3300048928 Bacteria 2505
1164 Ga0496125_0114168 3300048928 Bacteria 1946
1165 Ga0496126_0081510 3300048929 Bacteria 2860
1166 Ga0496126_0094716 3300048929 Bacteria 2620
1167 Ga0496126_0234829 3300048929 Bacteria 1534
1168 Ga0495678_000017 3300049459 Bacteria 282592
1169 Ga0495678_000238 3300049459 Bacteria 62224
1170 Ga0495678_001946 3300049459 Bacteria 14952
1171 Ga0495678_005424 3300049459 Bacteria 7039
1172 Ga0495678_013061 3300049459 Bacteria 3913
1173 Ga0495678_014304 3300049459 Bacteria 3694
1174 Ga0495678_033499 3300049459 Bacteria 2119
1175 Ga0495678_049379 3300049459 Bacteria 1635
1176 Ga0495678_062087 3300049459 Bacteria 1399
1177 Ga0495678_063659 3300049459 Bacteria 1376
1178 Ga0495678_068234 3300049459 Bacteria 1311
1179 Ga0495678_074799 3300049459 Bacteria 1231
1180 Ga0495678_095533 3300049459 Bacteria 1038
1181 Ga0495678_100376 3300049459 Bacteria 1003
1182 Ga0495678_101259 3300049459 Bacteria 997
1183 Ga0495678_106429 3300049459 Bacteria 963
1184 Ga0495678_107191 3300049459 Bacteria 958
1185 Ga0495678_124957 3300049459 Bacteria 859
1186 Ga0495682_0000985 3300049460 Bacteria 16995
1187 Ga0495682_0001189 3300049460 Bacteria 14807
1188 Ga0495682_0017942 3300049460 Bacteria 2665
1189 Ga0495682_0038130 3300049460 Bacteria 1766
1190 Ga0495682_0052173 3300049460 Bacteria 1486
1191 Ga0495682_0170872 3300049460 Bacteria 773
1192 Ga0501337_002270 3300049553 Bacteria 1169
1193 Ga0501032_0312718 3300049569 Bacteria 1014
1194 Ga0501037_0096138 3300049573 Bacteria 2141
1195 Ga0501038_0198501 3300049574 Bacteria 1611
1196 Ga0501227_049773 3300049665 Bacteria 1055
1197 Ga0501235_079320 3300049669 Bacteria 783
1198 Ga0501240_051827 3300049673 Bacteria 705
1199 Ga0501241_001024 3300049758 Bacteria 5912
1200 Ga0501269_003657 3300049766 Bacteria 1858
1201 nmdc:mga00v17_352568_c1 3300050491 Bacteria 957
1202 nmdc:mga00v17_392661_c1 3300050491 Bacteria 902
1203 nmdc:mga00v17_702870_c1 3300050491 Bacteria 648
1204 nmdc:mga08x19_302618_c1 3300050514 Bacteria 1111
1205 nmdc:mga0sz30_58235_c1 3300050516 Bacteria 1647
1206 Ga0500618_036512 3300053125 Bacteria 1138

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 2124908027 MRS2a_Contig_8608 MRS2a_00476820 161
2 iso_pu_bacteria 2599185307 2599974398 161
3 2124908027 MRS2a_Contig_8444 MRS2a_00332660 163
4 3300041411 Ga0439466_0102254 Ga0439466_0102254_41_538 165
5 3300041411 Ga0439466_0197879 Ga0439466_0197879_69_566 165
6 3300042013 Ga0439456_034785 Ga0439456_034785_27_524 165
7 3300042142 Ga0450905_027645 Ga0450905_027645_344_841 165
8 3300046474 Ga0495605_0448754 Ga0495605_0448754_19_516 165
9 3300046513 Ga0495616_0034511 Ga0495616_0034511_2110_2607 165
10 3300046518 Ga0495631_0264005 Ga0495631_0264005_185_682 165
11 3300046520 Ga0495637_0044203 Ga0495637_0044203_15_512 165
12 3300046538 Ga0495609_0004074 Ga0495609_0004074_27_524 165
13 3300046538 Ga0495609_0116338 Ga0495609_0116338_628_1125 165
14 3300046615 Ga0495656_0120760 Ga0495656_0120760_719_1216 165
15 3300046691 Ga0495670_0333253 Ga0495670_0333253_17_514 165
16 3300046692 Ga0495671_0097903 Ga0495671_0097903_58_555 165
17 3300046694 Ga0495649_0009293 Ga0495649_0009293_5303_5800 165
18 3300046810 Ga0495660_0272355 Ga0495660_0272355_229_726 165
19 3300046810 Ga0495660_0440045 Ga0495660_0440045_11_508 165
20 3300047320 Ga0495672_0066207 Ga0495672_0066207_1539_2036 165
21 3300047320 Ga0495672_0107598 Ga0495672_0107598_27_524 165
22 3300047320 Ga0495672_0303383 Ga0495672_0303383_52_549 165
23 3300047323 Ga0495683_0185416 Ga0495683_0185416_42_539 165
24 3300047445 Ga0495677_0039882 Ga0495677_0039882_1166_1663 165
25 3300049459 Ga0495678_107191 Ga0495678_107191_53_550 165
26 3300009011 Ga0105251_10050491 Ga0105251_100504912 169
27 3300046458 Ga0495591_022568 Ga0495591_022568_956_1480 174
28 3300046519 Ga0495632_0256411 Ga0495632_0256411_17_541 174
29 3300046810 Ga0495660_0060605 Ga0495660_0060605_12_539 175
30 3300042016 Ga0439463_001280 Ga0439463_001280_6173_6703 176
31 3300046691 Ga0495670_0377669 Ga0495670_0377669_22_552 176
32 iso_pu_bacteria 2808606373 2808905505 178
33 iso_pu_bacteria 2923519811 2923524198 178
34 3300046501 Ga0495607_0006625 Ga0495607_0006625_54_620 180
35 3300009011 Ga0105251_10014226 Ga0105251_100142262 181
36 3300009036 Ga0105244_10178771 Ga0105244_101787711 181
37 3300025728 Ga0207655_1019073 Ga0207655_10190734 181
38 3300025735 Ga0207713_1087237 Ga0207713_10872372 181
39 3300046674 Ga0495588_0477975 Ga0495588_0477975_59_604 181
40 3300048915 Ga0496112_0298266 Ga0496112_0298266_936_1481 181
41 iso_pu_bacteria 2738543020 2739287232 181
42 iso_pu_bacteria 2738543021 2739292545 181
43 iso_pu_bacteria 2842805378 2842808484 181
44 iso_pu_bacteria 3007419365 3007419940 181
45 3300046460 Ga0495638_0083955 Ga0495638_0083955_829_1380 183
46 3300046491 Ga0495584_0074820 Ga0495584_0074820_604_1155 183
47 3300046492 Ga0495585_0010425 Ga0495585_0010425_3527_4078 183
48 3300046512 Ga0495610_0014750 Ga0495610_0014750_2820_3371 183
49 3300046519 Ga0495632_0057390 Ga0495632_0057390_898_1449 183
50 3300046810 Ga0495660_0402591 Ga0495660_0402591_25_576 183
51 3300047469 Ga0495673_0009165 Ga0495673_0009165_718_1269 183
52 3300047470 Ga0495681_0042389 Ga0495681_0042389_1263_1814 183
53 3300047472 Ga0495686_0080129 Ga0495686_0080129_515_1066 183
54 3300049569 Ga0501032_0312718 Ga0501032_0312718_127_687 183
55 3300049573 Ga0501037_0096138 Ga0501037_0096138_995_1555 183
56 3300049574 Ga0501038_0198501 Ga0501038_0198501_407_967 183
57 3300013104 Ga0157370_10060146 Ga0157370_100601463 184
58 3300015261 Ga0182006_1026996 Ga0182006_10269964 184
59 iso_pu_bacteria 2511231156 2511822358 184
60 iso_pu_bacteria 2651869719 2652546626 184
61 3300009011 Ga0105251_10001252 Ga0105251_100012529 185
62 3300009036 Ga0105244_10047706 Ga0105244_100477062 185
63 3300009148 Ga0105243_10003109 Ga0105243_100031092 185
64 3300013104 Ga0157370_10000085 Ga0157370_1000008510 185
65 3300017792 Ga0163161_10076136 Ga0163161_100761362 185
66 3300025256 Ga0209759_1013881 Ga0209759_10138813 185
67 3300025728 Ga0207655_1000014 Ga0207655_1000014311 185
68 3300025735 Ga0207713_1000537 Ga0207713_10005376 185
69 3300025935 Ga0207709_10118321 Ga0207709_101183212 185
70 3300046463 Ga0495653_0012803 Ga0495653_0012803_2605_3180 185
71 3300046492 Ga0495585_0003371 Ga0495585_0003371_2692_3267 185
72 3300046492 Ga0495585_0123613 Ga0495585_0123613_543_1118 185
73 3300046507 Ga0495606_0001936 Ga0495606_0001936_13645_14202 185
74 3300046507 Ga0495606_0008312 Ga0495606_0008312_5608_6183 185
75 3300046513 Ga0495616_0087161 Ga0495616_0087161_204_779 185
76 3300046520 Ga0495637_0092456 Ga0495637_0092456_521_1096 185
77 3300046522 Ga0495643_0000275 Ga0495643_0000275_62427_62987 185
78 3300046522 Ga0495643_0003494 Ga0495643_0003494_1317_1874 185
79 3300046660 Ga0495625_0113337 Ga0495625_0113337_452_1012 185
80 3300046665 Ga0495661_0000346 Ga0495661_0000346_40509_41084 185
81 3300046692 Ga0495671_0001719 Ga0495671_0001719_3177_3737 185
82 3300046694 Ga0495649_0002918 Ga0495649_0002918_1527_2084 185
83 3300046694 Ga0495649_0020831 Ga0495649_0020831_1879_2439 185
84 3300046694 Ga0495649_0103467 Ga0495649_0103467_891_1448 185
85 3300046694 Ga0495649_0146262 Ga0495649_0146262_340_900 185
86 3300046810 Ga0495660_0156275 Ga0495660_0156275_479_1039 185
87 3300047470 Ga0495681_0042229 Ga0495681_0042229_85_645 185
88 3300047673 Ga0495593_0195121 Ga0495593_0195121_11_568 185
89 3300049459 Ga0495678_049379 Ga0495678_049379_180_737 185
90 iso_pu_bacteria 2511231004 2511258451 185
91 iso_pu_bacteria 2511231006 2511265608 185
92 iso_pu_bacteria 2511231007 2511269649 185
93 iso_pu_bacteria 2511231008 2511280589 185
94 iso_pu_bacteria 2511231010 2511288861 185
95 iso_pu_bacteria 2511231011 2511293898 185
96 iso_pu_bacteria 2511231012 2511302330 185
97 iso_pu_bacteria 2511231014 2511315179 185
98 iso_pu_bacteria 2511231015 2511322580 185
99 iso_pu_bacteria 2511231016 2511323631 185
100 iso_pu_bacteria 2511231017 2511332714 185
101 iso_pu_bacteria 2511231020 2511349029 185
102 iso_pu_bacteria 2511231021 2511355921 185
103 iso_pu_bacteria 2511231022 2511361410 185
104 iso_pu_bacteria 2511231023 2511368553 185
105 iso_pu_bacteria 2511231031 2511411239 185
106 iso_pu_bacteria 2512047018 2512325880 185
107 iso_pu_bacteria 2554235341 2555667343 185
108 iso_pu_bacteria 2582580891 2583789879 185
109 iso_pu_bacteria 2597489887 2597855587 185
110 iso_pu_bacteria 2597489888 2597861587 185
111 iso_pu_bacteria 2597489889 2597867305 185
112 iso_pu_bacteria 2599185160 2599356566 185
113 iso_pu_bacteria 2599185161 2599363404 185
114 iso_pu_bacteria 2599185162 2599369644 185
115 iso_pu_bacteria 2599185163 2599376513 185
116 iso_pu_bacteria 2599185164 2599381671 185
117 iso_pu_bacteria 2599185165 2599388185 185
118 iso_pu_bacteria 2599185166 2599395291 185
119 iso_pu_bacteria 2599185167 2599398933 185
120 iso_pu_bacteria 2599185168 2599407056 185
121 iso_pu_bacteria 2599185179 2599450988 185
122 iso_pu_bacteria 2599185181 2599463399 185
123 iso_pu_bacteria 2599185182 2599469251 185
124 iso_pu_bacteria 2599185185 2599485489 185
125 iso_pu_bacteria 2599185186 2599492416 185
126 iso_pu_bacteria 2599185188 2599502562 185
127 iso_pu_bacteria 2599185189 2599506355 185
128 iso_pu_bacteria 2599185190 2599514066 185
129 iso_pu_bacteria 2599185191 2599518667 185
130 iso_pu_bacteria 2599185212 2599613041 185
131 iso_pu_bacteria 2599185248 2599769315 185
132 iso_pu_bacteria 2599185257 2599806618 185
133 iso_pu_bacteria 2599185288 2599882579 185
134 iso_pu_bacteria 2599185289 2599888557 185
135 iso_pu_bacteria 2599185290 2599893599 185
136 iso_pu_bacteria 2599185291 2599900194 185
137 iso_pu_bacteria 2599185300 2599934160 185
138 iso_pu_bacteria 2599185302 2599943672 185
139 iso_pu_bacteria 2599185303 2599952121 185
140 iso_pu_bacteria 2599185304 2599955982 185
141 iso_pu_bacteria 2599185305 2599961791 185
142 iso_pu_bacteria 2599185306 2599966910 185
143 iso_pu_bacteria 2599185308 2599978279 185
144 iso_pu_bacteria 2599185309 2599984676 185
145 iso_pu_bacteria 2599185310 2599991171 185
146 iso_pu_bacteria 2599185311 2599994946 185
147 iso_pu_bacteria 2599185312 2600002298 185
148 iso_pu_bacteria 2599185313 2600004768 185
149 iso_pu_bacteria 2599185314 2600012501 185
150 iso_pu_bacteria 2599185315 2600018737 185
151 iso_pu_bacteria 2599185316 2600023876 185
152 iso_pu_bacteria 2599185317 2600029874 185
153 iso_pu_bacteria 2599185318 2600034774 185
154 iso_pu_bacteria 2599185319 2600043896 185
155 iso_pu_bacteria 2599185320 2600047982 185
156 iso_pu_bacteria 2599185321 2600055615 185
157 iso_pu_bacteria 2599185322 2600060301 185
158 iso_pu_bacteria 2599185323 2600067564 185
159 iso_pu_bacteria 2599185324 2600071416 185
160 iso_pu_bacteria 2599185325 2600077569 185
161 iso_pu_bacteria 2599185356 2600216028 185
162 iso_pu_bacteria 2600254930 2600359183 185
163 iso_pu_bacteria 2600254931 2600364957 185
164 iso_pu_bacteria 2600255296 2601692267 185
165 iso_pu_bacteria 2600255313 2601776195 185
166 iso_pu_bacteria 2600255318 2601797757 185
167 iso_pu_bacteria 2603880185 2606076760 185
168 iso_pu_bacteria 2603880199 2606128826 185
169 iso_pu_bacteria 2619619299 2621302252 185
170 iso_pu_bacteria 2623620443 2624478142 185
171 iso_pu_bacteria 2623620446 2624489687 185
172 iso_pu_bacteria 2643221565 2643840907 185
173 iso_pu_bacteria 2643221571 2643872697 185
174 iso_pu_bacteria 2643221589 2643954989 185
175 iso_pu_bacteria 2643221602 2644024626 185
176 iso_pu_bacteria 2643221633 2644186045 185
177 iso_pu_bacteria 2643221650 2644282650 185
178 iso_pu_bacteria 2643221713 2644619571 185
179 iso_pu_bacteria 2667528170 2671092684 185
180 iso_pu_bacteria 2667528171 2671100044 185
181 iso_pu_bacteria 2667528176 2671127246 185
182 iso_pu_bacteria 2671180172 2671772269 185
183 iso_pu_bacteria 2675903420 2677898293 185
184 iso_pu_bacteria 2675903515 2678260894 185
185 iso_pu_bacteria 2713897148 2715749131 185
186 iso_pu_bacteria 2713897149 2715754403 185
187 iso_pu_bacteria 2718217725 2718632088 185
188 iso_pu_bacteria 2721755607 2723246477 185
189 iso_pu_bacteria 2738541265 2738674914 185
190 iso_pu_bacteria 2738541282 2738753307 185
191 iso_pu_bacteria 2738541294 2738807996 185
192 iso_pu_bacteria 2738541303 2738862506 185
193 iso_pu_bacteria 2738541309 2738895356 185
194 iso_pu_bacteria 2738543004 2739197950 185
195 iso_pu_bacteria 2738543015 2739260387 185
196 iso_pu_bacteria 2738543025 2739311206 185
197 iso_pu_bacteria 2740892503 2743735003 185
198 iso_pu_bacteria 2744054620 2745006207 185
199 iso_pu_bacteria 2773857670 2774119636 185
200 iso_pu_bacteria 2773857673 2774134664 185
201 iso_pu_bacteria 2784132063 2784261124 185
202 iso_pu_bacteria 2784132072 2784316289 185
203 iso_pu_bacteria 2791355520 2794598744 185
204 iso_pu_bacteria 2808606361 2808856550 185
205 iso_pu_bacteria 2808606376 2808922833 185
206 iso_pu_bacteria 2808606377 2808932105 185
207 iso_pu_bacteria 2808606378 2808936547 185
208 iso_pu_bacteria 2808606380 2808944520 185
209 iso_pu_bacteria 2808606381 2808954294 185
210 iso_pu_bacteria 2808606382 2808955782 185
211 iso_pu_bacteria 2808606383 2808964937 185
212 iso_pu_bacteria 2808606385 2808976743 185
213 iso_pu_bacteria 2808606388 2808991819 185
214 iso_pu_bacteria 2808606389 2808999829 185
215 iso_pu_bacteria 2808606445 2809217905 185
216 iso_pu_bacteria 2816332298 2817488326 185
217 iso_pu_bacteria 2818991456 2819657153 185
218 iso_pu_bacteria 2818991464 2819705140 185
219 iso_pu_bacteria 2825651385 2825654348 185
220 iso_pu_bacteria 2834028612 2834032288 185
221 iso_pu_bacteria 2842826826 2842830637 185
222 iso_pu_bacteria 2842832357 2842834090 185
223 iso_pu_bacteria 2842837860 2842838541 185
224 iso_pu_bacteria 2842843487 2842846438 185
225 iso_pu_bacteria 2842854478 2842859477 185
226 iso_pu_bacteria 2844665904 2844667824 185
227 iso_pu_bacteria 2852612431 2852616995 185
228 iso_pu_bacteria 2852657418 2852660526 185
229 iso_pu_bacteria 2852667396 2852672016 185
230 iso_pu_bacteria 2860339153 2860343715 185
231 iso_pu_bacteria 2860867994 2860868365 185
232 iso_pu_bacteria 2878029506 2878030089 185
233 iso_pu_bacteria 2880230671 2880231038 185
234 iso_pu_bacteria 2904518522 2904519497 185
235 iso_pu_bacteria 2904550169 2904552323 185
236 iso_pu_bacteria 2908446538 2908446951 185
237 iso_pu_bacteria 2917070673 2917071094 185
238 iso_pu_bacteria 2919063839 2919066229 185
239 iso_pu_bacteria 2919385768 2919389847 185
240 iso_pu_bacteria 2919456309 2919459908 185
241 iso_pu_bacteria 2919481497 2919486488 185
242 iso_pu_bacteria 2919487758 2919488782 185
243 iso_pu_bacteria 2919697872 2919699034 185
244 iso_pu_bacteria 2923153595 2923153998 185
245 iso_pu_bacteria 2923586266 2923589687 185
246 iso_pu_bacteria 2929144301 2929144726 185
247 iso_pu_bacteria 2929189879 2929190225 185
248 iso_pu_bacteria 2931369376 2931371941 185
249 iso_pu_bacteria 2931390751 2931391296 185
250 iso_pu_bacteria 2931396565 2931398761 185
251 iso_pu_bacteria 2935353572 2935358922 185
252 iso_pu_bacteria 2939636861 2939641024 185
253 iso_pu_bacteria 2945928738 2945930253 185
254 iso_pu_bacteria 2945961074 2945967516 185
255 iso_pu_bacteria 2946006987 2946012588 185
256 iso_pu_bacteria 2946027586 2946028566 185
257 iso_pu_bacteria 2947233263 2947235097 185
258 iso_pu_bacteria 2969304461 2969304885 185
259 iso_pu_bacteria 2974289157 2974293422 185
260 iso_pu_bacteria 2984286254 2984292061 185
261 iso_pu_bacteria 2988728565 2988732121 185
262 iso_pu_bacteria 2998139840 2998140384 185
263 iso_pu_bacteria 3007395558 3007398010 185
264 iso_pu_bacteria 3007511990 3007517819 185
265 iso_pu_bacteria 3007614139 3007614950 185
266 iso_pu_bacteria 3007619802 3007625377 185
267 iso_pu_bacteria 3007718800 3007724019 185
268 iso_pu_bacteria 3007855910 3007857168 185
269 iso_pu_bacteria 3007861166 3007864408 185
270 iso_pu_bacteria 3007866637 3007871983 185
271 iso_pu_bacteria 637000220 637317740 185
272 iso_pu_bacteria 8015687852 8015688247 185
273 iso_pu_bacteria 8019769354 8019770238 185
274 iso_pu_bacteria 8019775933 8019777261 185
275 iso_pu_bacteria 8029995093 8030000348 185
276 iso_pu_bacteria 8054285046 8054286144 185
277 iso_pu_bacteria 8054347763 8054350203 185
278 iso_pu_bacteria 8054503363 8054503872 185
279 iso_pu_bacteria 8055770955 8055771345 185
280 iso_pu_bacteria 8055817908 8055818273 185
281 iso_pu_bacteria 8056125926 8056126391 185
282 iso_pu_bacteria 8056131705 8056132257 185
283 iso_pu_bacteria 8056143049 8056143652 185
284 iso_pu_bacteria 8056148874 8056152400 185
285 iso_pu_bacteria 8056155041 8056158440 185
286 iso_pu_bacteria 8056161164 8056164266 185
287 iso_pu_bacteria 8056166840 8056170662 185
288 iso_pu_bacteria 8056172158 8056176778 185
289 iso_pu_bacteria 8056177738 8056179717 185
290 iso_pu_bacteria 8056569372 8056572246 185
291 iso_pu_bacteria 8057798959 8057802636 185
292 3300009011 Ga0105251_10000118 Ga0105251_100001189 186
293 3300009092 Ga0105250_10000251 Ga0105250_1000025133 186
294 3300009092 Ga0105250_10095206 Ga0105250_100952062 186
295 3300013102 Ga0157371_10000238 Ga0157371_100002388 186
296 3300025711 Ga0207696_1000020 Ga0207696_1000020112 186
297 3300025735 Ga0207713_1000114 Ga0207713_1000114104 186
298 3300032004 Ga0307414_10018336 Ga0307414_100183363 186
299 3300046453 Ga0495627_000774 Ga0495627_000774_12387_12965 186
300 3300046471 Ga0495650_0023485 Ga0495650_0023485_2064_2642 186
301 3300046474 Ga0495605_0208639 Ga0495605_0208639_86_664 186
302 3300046518 Ga0495631_0001164 Ga0495631_0001164_1779_2357 186
303 3300046519 Ga0495632_0020196 Ga0495632_0020196_958_1536 186
304 3300046519 Ga0495632_0029449 Ga0495632_0029449_711_1289 186
305 3300046530 Ga0495654_0008075 Ga0495654_0008075_3227_3805 186
306 3300046692 Ga0495671_0001074 Ga0495671_0001074_1952_2530 186
307 3300047320 Ga0495672_0011714 Ga0495672_0011714_1639_2217 186
308 3300049460 Ga0495682_0001189 Ga0495682_0001189_11169_11747 186
309 iso_pu_bacteria 2912963787 2912964126 186
310 iso_pu_bacteria 2939651529 2939655244 186
311 iso_pu_bacteria 8055878733 8055880029 186
312 3300046460 Ga0495638_0012494 Ga0495638_0012494_5062_5628 187
313 3300048925 Ga0496122_0001366 Ga0496122_0001366_3126_3707 187
314 3300048926 Ga0496123_0001033 Ga0496123_0001033_35714_36295 187
315 3300048927 Ga0496124_0015978 Ga0496124_0015978_3307_3879 187
316 3300005564 Ga0070664_100000531 Ga0070664_10000053115 188
317 3300005578 Ga0068854_100020969 Ga0068854_1000209693 188
318 3300005834 Ga0068851_10000035 Ga0068851_1000003586 188
319 3300006051 Ga0075364_10239692 Ga0075364_102396922 188
320 3300006177 Ga0075362_10142259 Ga0075362_101422592 188
321 3300006946 Ga0079104_1001202 Ga0079104_10012025 188
322 3300006948 Ga0099826_10031348 Ga0099826_100313481 188
323 3300009036 Ga0105244_10011044 Ga0105244_100110445 188
324 3300014497 Ga0182008_10135796 Ga0182008_101357961 188
325 3300015261 Ga0182006_1022012 Ga0182006_10220123 188
326 3300015261 Ga0182006_1211361 Ga0182006_12113611 188
327 3300025206 Ga0209435_102659 Ga0209435_1026591 188
328 3300025224 Ga0209784_100087 Ga0209784_10008715 188
329 3300025225 Ga0209566_100106 Ga0209566_10010615 188
330 3300025226 Ga0209674_100128 Ga0209674_10012815 188
331 3300025229 Ga0209147_100129 Ga0209147_10012915 188
332 3300025230 Ga0209563_100122 Ga0209563_100122109 188
333 3300025242 Ga0209258_100352 Ga0209258_10035255 188
334 3300025246 Ga0209646_1004290 Ga0209646_10042902 188
335 3300025253 Ga0209677_100078 Ga0209677_100078109 188
336 3300025256 Ga0209759_1013188 Ga0209759_10131882 188
337 3300025321 Ga0207656_10000008 Ga0207656_10000008175 188
338 3300025728 Ga0207655_1008839 Ga0207655_10088395 188
339 3300025914 Ga0207671_10000015 Ga0207671_10000015167 188
340 3300025920 Ga0207649_10000001 Ga0207649_10000001320 188
341 3300025931 Ga0207644_10242954 Ga0207644_102429541 188
342 3300025941 Ga0207711_10051129 Ga0207711_100511292 188
343 3300025945 Ga0207679_10000009 Ga0207679_10000009302 188
344 3300025945 Ga0207679_10844412 Ga0207679_108444122 188
345 3300027111 Ga0209281_1000033 Ga0209281_1000033314 188
346 3300027666 Ga0209282_1053453 Ga0209282_10534533 188
347 3300046453 Ga0495627_024536 Ga0495627_024536_1171_1749 188
348 3300046455 Ga0495603_0032367 Ga0495603_0032367_194_778 188
349 3300046458 Ga0495591_011767 Ga0495591_011767_1670_2248 188
350 3300046471 Ga0495650_0005047 Ga0495650_0005047_2024_2605 188
351 3300046471 Ga0495650_0030367 Ga0495650_0030367_1478_2056 188
352 3300046474 Ga0495605_0000095 Ga0495605_0000095_89240_89818 188
353 3300046474 Ga0495605_0000210 Ga0495605_0000210_42696_43277 188
354 3300046474 Ga0495605_0056973 Ga0495605_0056973_1245_1826 188
355 3300046492 Ga0495585_0006088 Ga0495585_0006088_4991_5575 188
356 3300046499 Ga0495594_0019233 Ga0495594_0019233_2343_2921 188
357 3300046501 Ga0495607_0007849 Ga0495607_0007849_3286_3870 188
358 3300046501 Ga0495607_0134971 Ga0495607_0134971_486_1067 188
359 3300046506 Ga0495583_0000015 Ga0495583_0000015_84845_85423 188
360 3300046506 Ga0495583_0004386 Ga0495583_0004386_7942_8523 188
361 3300046506 Ga0495583_0005087 Ga0495583_0005087_1455_2036 188
362 3300046507 Ga0495606_0070073 Ga0495606_0070073_376_960 188
363 3300046507 Ga0495606_0144676 Ga0495606_0144676_269_853 188
364 3300046512 Ga0495610_0002985 Ga0495610_0002985_8534_9112 188
365 3300046512 Ga0495610_0153796 Ga0495610_0153796_369_950 188
366 3300046515 Ga0495620_0000171 Ga0495620_0000171_719_1297 188
367 3300046518 Ga0495631_0017389 Ga0495631_0017389_2109_2687 188
368 3300046519 Ga0495632_0000599 Ga0495632_0000599_1612_2193 188
369 3300046520 Ga0495637_0003904 Ga0495637_0003904_5754_6335 188
370 3300046520 Ga0495637_0006005 Ga0495637_0006005_380_958 188
371 3300046520 Ga0495637_0010927 Ga0495637_0010927_2926_3510 188
372 3300046520 Ga0495637_0107775 Ga0495637_0107775_39_623 188
373 3300046530 Ga0495654_0002214 Ga0495654_0002214_827_1405 188
374 3300046530 Ga0495654_0220038 Ga0495654_0220038_73_657 188
375 3300046538 Ga0495609_0000023 Ga0495609_0000023_262130_262711 188
376 3300046538 Ga0495609_0000133 Ga0495609_0000133_62409_62987 188
377 3300046538 Ga0495609_0040830 Ga0495609_0040830_988_1569 188
378 3300046542 Ga0495597_0005379 Ga0495597_0005379_438_1016 188
379 3300046558 Ga0495633_0000115 Ga0495633_0000115_58173_58751 188
380 3300046648 Ga0495611_0002357 Ga0495611_0002357_654_1232 188
381 3300046665 Ga0495661_0001099 Ga0495661_0001099_301_879 188
382 3300046665 Ga0495661_0001263 Ga0495661_0001263_18911_19492 188
383 3300046691 Ga0495670_0046547 Ga0495670_0046547_721_1299 188
384 3300046692 Ga0495671_0002381 Ga0495671_0002381_462_1040 188
385 3300046692 Ga0495671_0017976 Ga0495671_0017976_1608_2192 188
386 3300046694 Ga0495649_0006570 Ga0495649_0006570_2544_3128 188
387 3300046794 Ga0495589_0040345 Ga0495589_0040345_1147_1725 188
388 3300046810 Ga0495660_0089201 Ga0495660_0089201_700_1278 188
389 3300047320 Ga0495672_0093497 Ga0495672_0093497_235_813 188
390 3300047321 Ga0495676_0016350 Ga0495676_0016350_2679_3263 188
391 3300047323 Ga0495683_0000106 Ga0495683_0000106_673_1251 188
392 3300047323 Ga0495683_0000586 Ga0495683_0000586_16373_16957 188
393 3300047446 Ga0495679_000341 Ga0495679_000341_9482_10060 188
394 3300047469 Ga0495673_0023171 Ga0495673_0023171_2091_2669 188
395 3300047469 Ga0495673_0113282 Ga0495673_0113282_89_670 188
396 3300047470 Ga0495681_0074431 Ga0495681_0074431_222_800 188
397 3300048905 Ga0496102_1018273 Ga0496102_1018273_113_697 188
398 3300048920 Ga0496117_0204903 Ga0496117_0204903_79_663 188
399 3300048920 Ga0496117_0205328 Ga0496117_0205328_166_744 188
400 3300048924 Ga0496121_0007210 Ga0496121_0007210_5970_6554 188
401 3300048925 Ga0496122_0066437 Ga0496122_0066437_697_1275 188
402 3300048926 Ga0496123_0045321 Ga0496123_0045321_1777_2355 188
403 3300049459 Ga0495678_000017 Ga0495678_000017_49982_50560 188
404 3300049459 Ga0495678_124957 Ga0495678_124957_123_707 188
405 3300053125 Ga0500618_036512 Ga0500618_036512_466_1050 188
406 iso_pu_bacteria 2738541271 2738687642 188
407 iso_pu_bacteria 2738543016 2739263263 188
408 2124908027 MRS2a_Contig_1221 MRS2a_00123940 189
409 2124908027 MRS2a_Contig_52 MRS2a_00400590 189
410 2124908027 MRS2a_Contig_7587 MRS2a_00458000 189
411 2124908027 MRS2a_Contig_7777 MRS2a_00634070 189
412 2124908027 MRS2a_Contig_9578 MRS2a_00450410 189
413 2162886007 SwRhRL2b_contig_1469690 SwRhRL2b_0951.00004530 189
414 2162886007 SwRhRL2b_contig_2969190 SwRhRL2b_0084.00000650 189
415 3300001915 JGI24741J21665_1002858 JGI24741J21665_10028583 189
416 3300002737 JGI25162J39368_1000129 JGI25162J39368_100012934 189
417 3300002771 JGI25163J39215_1001029 JGI25163J39215_10010294 189
418 3300002771 JGI25163J39215_1001444 JGI25163J39215_10014441 189
419 3300002772 JGI25164J39214_1000076 JGI25164J39214_100007640 189
420 3300002772 JGI25164J39214_1000101 JGI25164J39214_100010144 189
421 3300003214 JGI25165J46597_1000150 JGI25165J46597_100015059 189
422 3300003214 JGI25165J46597_1000180 JGI25165J46597_100018051 189
423 3300003578 Ga0006562J51391_1014806 Ga0006562J51391_10148062 189
424 3300003751 Ga0055538_1000115 Ga0055538_100011553 189
425 3300003752 Ga0055539_1000162 Ga0055539_100016253 189
426 3300003756 Ga0055533_1000164 Ga0055533_100016453 189
427 3300003758 Ga0055532_1000153 Ga0055532_100015314 189
428 3300003759 Ga0055525_1000224 Ga0055525_100022453 189
429 3300003761 Ga0055535_1012559 Ga0055535_10125591 189
430 3300003781 Ga0055536_1000312 Ga0055536_100031219 189
431 3300003781 Ga0055536_1003306 Ga0055536_10033065 189
432 3300003781 Ga0055536_1003395 Ga0055536_10033955 189
433 3300003791 Ga0055530_10000404 Ga0055530_1000040420 189
434 3300003791 Ga0055530_10003582 Ga0055530_100035825 189
435 3300003791 Ga0055530_10003672 Ga0055530_100036725 189
436 3300003792 Ga0055540_1000339 Ga0055540_100033910 189
437 3300003792 Ga0055540_1002883 Ga0055540_10028835 189
438 3300003792 Ga0055540_1002945 Ga0055540_10029455 189
439 3300003792 Ga0055540_1029894 Ga0055540_10298943 189
440 3300003794 Ga0055531_10000238 Ga0055531_100002386 189
441 3300003841 Ga0055541_1000107 Ga0055541_100010753 189
442 3300005288 Ga0065714_10000416 Ga0065714_100004164 189
443 3300005288 Ga0065714_10002970 Ga0065714_100029702 189
444 3300005288 Ga0065714_10003157 Ga0065714_100031571 189
445 3300005288 Ga0065714_10018725 Ga0065714_100187251 189
446 3300005288 Ga0065714_10019685 Ga0065714_100196851 189
447 3300005288 Ga0065714_10019913 Ga0065714_100199131 189
448 3300005288 Ga0065714_10044865 Ga0065714_100448651 189
449 3300005288 Ga0065714_10089224 Ga0065714_100892243 189
450 3300005288 Ga0065714_10128246 Ga0065714_101282462 189
451 3300005288 Ga0065714_10236192 Ga0065714_102361921 189
452 3300005288 Ga0065714_10243303 Ga0065714_102433031 189
453 3300005288 Ga0065714_10267826 Ga0065714_102678261 189
454 3300005289 Ga0065704_10003425 Ga0065704_100034253 189
455 3300005289 Ga0065704_10007980 Ga0065704_100079803 189
456 3300005289 Ga0065704_10071105 Ga0065704_100711051 189
457 3300005289 Ga0065704_10099524 Ga0065704_100995242 189
458 3300005289 Ga0065704_10174034 Ga0065704_101740341 189
459 3300005289 Ga0065704_10285287 Ga0065704_102852872 189
460 3300005289 Ga0065704_10387747 Ga0065704_103877471 189
461 3300005289 Ga0065704_10398946 Ga0065704_103989461 189
462 3300005290 Ga0065712_10002657 Ga0065712_100026574 189
463 3300005290 Ga0065712_10107268 Ga0065712_101072683 189
464 3300005293 Ga0065715_10228515 Ga0065715_102285152 189
465 3300005331 Ga0070670_100000321 Ga0070670_10000032128 189
466 3300005344 Ga0070661_100001439 Ga0070661_1000014395 189
467 3300005353 Ga0070669_100000233 Ga0070669_10000023312 189
468 3300005353 Ga0070669_100000265 Ga0070669_10000026541 189
469 3300005355 Ga0070671_100393414 Ga0070671_1003934142 189
470 3300005366 Ga0070659_100143101 Ga0070659_1001431012 189
471 3300005440 Ga0070705_100566726 Ga0070705_1005667261 189
472 3300005457 Ga0070662_100001331 Ga0070662_1000013314 189
473 3300005457 Ga0070662_100024057 Ga0070662_1000240573 189
474 3300005539 Ga0068853_100000029 Ga0068853_10000002951 189
475 3300005548 Ga0070665_100026744 Ga0070665_1000267445 189
476 3300005548 Ga0070665_100168996 Ga0070665_1001689961 189
477 3300006048 Ga0075363_100201989 Ga0075363_1002019892 189
478 3300006048 Ga0075363_100363670 Ga0075363_1003636701 189
479 3300006051 Ga0075364_10171824 Ga0075364_101718242 189
480 3300006051 Ga0075364_10259335 Ga0075364_102593351 189
481 3300006051 Ga0075364_10392110 Ga0075364_103921102 189
482 3300006058 Ga0075432_10001952 Ga0075432_100019527 189
483 3300006058 Ga0075432_10003404 Ga0075432_100034045 189
484 3300006058 Ga0075432_10013439 Ga0075432_100134393 189
485 3300006058 Ga0075432_10013492 Ga0075432_100134923 189
486 3300006058 Ga0075432_10025972 Ga0075432_100259722 189
487 3300006058 Ga0075432_10072442 Ga0075432_100724422 189
488 3300006177 Ga0075362_10015908 Ga0075362_100159082 189
489 3300006177 Ga0075362_10090263 Ga0075362_100902632 189
490 3300006177 Ga0075362_10232408 Ga0075362_102324082 189
491 3300006177 Ga0075362_10450667 Ga0075362_104506671 189
492 3300006914 Ga0075436_100161149 Ga0075436_1001611492 189
493 3300006914 Ga0075436_100244917 Ga0075436_1002449173 189
494 3300006914 Ga0075436_100561674 Ga0075436_1005616742 189
495 3300006946 Ga0079104_1000423 Ga0079104_100042330 189
496 3300009011 Ga0105251_10001477 Ga0105251_100014773 189
497 3300009011 Ga0105251_10008261 Ga0105251_100082615 189
498 3300009011 Ga0105251_10009813 Ga0105251_100098133 189
499 3300009011 Ga0105251_10032440 Ga0105251_100324402 189
500 3300009011 Ga0105251_10038137 Ga0105251_100381372 189
501 3300009011 Ga0105251_10045690 Ga0105251_100456902 189
502 3300009011 Ga0105251_10051096 Ga0105251_100510962 189
503 3300009036 Ga0105244_10000969 Ga0105244_100009698 189
504 3300009036 Ga0105244_10001341 Ga0105244_100013418 189
505 3300009036 Ga0105244_10008644 Ga0105244_100086446 189
506 3300009036 Ga0105244_10009952 Ga0105244_100099526 189
507 3300009036 Ga0105244_10045280 Ga0105244_100452802 189
508 3300009036 Ga0105244_10048978 Ga0105244_100489783 189
509 3300009036 Ga0105244_10067010 Ga0105244_100670102 189
510 3300009036 Ga0105244_10091767 Ga0105244_100917674 189
511 3300009036 Ga0105244_10158620 Ga0105244_101586202 189
512 3300009092 Ga0105250_10000651 Ga0105250_1000065118 189
513 3300009092 Ga0105250_10001638 Ga0105250_100016387 189
514 3300009092 Ga0105250_10017202 Ga0105250_100172023 189
515 3300009092 Ga0105250_10025506 Ga0105250_100255062 189
516 3300009092 Ga0105250_10162459 Ga0105250_101624591 189
517 3300009094 Ga0111539_11234771 Ga0111539_112347711 189
518 3300009148 Ga0105243_10000299 Ga0105243_1000029938 189
519 3300009148 Ga0105243_10001887 Ga0105243_100018875 189
520 3300009148 Ga0105243_10105552 Ga0105243_101055522 189
521 3300009148 Ga0105243_10358176 Ga0105243_103581762 189
522 3300009148 Ga0105243_10424395 Ga0105243_104243953 189
523 3300009176 Ga0105242_10019973 Ga0105242_100199733 189
524 3300009176 Ga0105242_11564114 Ga0105242_115641141 189
525 3300009177 Ga0105248_10062512 Ga0105248_100625122 189
526 3300009545 Ga0105237_10002856 Ga0105237_100028561 189
527 3300009545 Ga0105237_10117460 Ga0105237_101174603 189
528 3300009553 Ga0105249_10029972 Ga0105249_100299725 189
529 3300011119 Ga0105246_10000445 Ga0105246_100004455 189
530 3300011119 Ga0105246_10002004 Ga0105246_100020048 189
531 3300011119 Ga0105246_10234818 Ga0105246_102348183 189
532 3300012477 Ga0157336_1002792 Ga0157336_10027922 189
533 3300012498 Ga0157345_1000390 Ga0157345_10003903 189
534 3300012498 Ga0157345_1001327 Ga0157345_10013272 189
535 3300013100 Ga0157373_10000945 Ga0157373_1000094513 189
536 3300013100 Ga0157373_10008664 Ga0157373_100086642 189
537 3300013100 Ga0157373_10066360 Ga0157373_100663602 189
538 3300013100 Ga0157373_10093854 Ga0157373_100938542 189
539 3300013100 Ga0157373_10128672 Ga0157373_101286723 189
540 3300013100 Ga0157373_10455059 Ga0157373_104550592 189
541 3300013100 Ga0157373_10784105 Ga0157373_107841051 189
542 3300013102 Ga0157371_10004002 Ga0157371_100040025 189
543 3300013102 Ga0157371_10012849 Ga0157371_100128495 189
544 3300013102 Ga0157371_10140972 Ga0157371_101409722 189
545 3300013102 Ga0157371_10179654 Ga0157371_101796542 189
546 3300013102 Ga0157371_10293092 Ga0157371_102930922 189
547 3300013104 Ga0157370_10023954 Ga0157370_100239545 189
548 3300013104 Ga0157370_10062944 Ga0157370_100629442 189
549 3300013104 Ga0157370_10084229 Ga0157370_100842292 189
550 3300013104 Ga0157370_10102145 Ga0157370_101021451 189
551 3300013104 Ga0157370_10182238 Ga0157370_101822382 189
552 3300013105 Ga0157369_10020219 Ga0157369_100202192 189
553 3300013105 Ga0157369_10135729 Ga0157369_101357292 189
554 3300013105 Ga0157369_10163890 Ga0157369_101638902 189
555 3300013105 Ga0157369_10173309 Ga0157369_101733091 189
556 3300013105 Ga0157369_10251541 Ga0157369_102515411 189
557 3300013306 Ga0163162_10023363 Ga0163162_100233635 189
558 3300013306 Ga0163162_10178864 Ga0163162_101788642 189
559 3300013306 Ga0163162_10230509 Ga0163162_102305092 189
560 3300013306 Ga0163162_10560585 Ga0163162_105605852 189
561 3300013306 Ga0163162_10811585 Ga0163162_108115851 189
562 3300013307 Ga0157372_10092387 Ga0157372_100923872 189
563 3300013308 Ga0157375_10124390 Ga0157375_101243903 189
564 3300013308 Ga0157375_10221082 Ga0157375_102210821 189
565 3300013308 Ga0157375_10872717 Ga0157375_108727172 189
566 3300014497 Ga0182008_10003739 Ga0182008_100037395 189
567 3300014497 Ga0182008_10007470 Ga0182008_100074705 189
568 3300014497 Ga0182008_10008836 Ga0182008_100088365 189
569 3300014497 Ga0182008_10013087 Ga0182008_100130875 189
570 3300014497 Ga0182008_10016701 Ga0182008_100167012 189
571 3300014497 Ga0182008_10020397 Ga0182008_100203973 189
572 3300014497 Ga0182008_10025522 Ga0182008_100255223 189
573 3300014497 Ga0182008_10345879 Ga0182008_103458791 189
574 3300014497 Ga0182008_10469539 Ga0182008_104695391 189
575 3300015261 Ga0182006_1000753 Ga0182006_100075310 189
576 3300015261 Ga0182006_1002780 Ga0182006_10027803 189
577 3300015261 Ga0182006_1005124 Ga0182006_10051247 189
578 3300015261 Ga0182006_1009250 Ga0182006_10092503 189
579 3300015261 Ga0182006_1014550 Ga0182006_10145502 189
580 3300015261 Ga0182006_1020209 Ga0182006_10202093 189
581 3300015261 Ga0182006_1033571 Ga0182006_10335712 189
582 3300015262 Ga0182007_10001061 Ga0182007_100010612 189
583 3300015262 Ga0182007_10014024 Ga0182007_100140243 189
584 3300015265 Ga0182005_1002918 Ga0182005_10029182 189
585 3300015265 Ga0182005_1003752 Ga0182005_10037522 189
586 3300015265 Ga0182005_1019012 Ga0182005_10190122 189
587 3300015265 Ga0182005_1034903 Ga0182005_10349033 189
588 3300015265 Ga0182005_1043009 Ga0182005_10430092 189
589 3300015265 Ga0182005_1073120 Ga0182005_10731202 189
590 3300015265 Ga0182005_1120249 Ga0182005_11202491 189
591 3300017792 Ga0163161_10028382 Ga0163161_100283822 189
592 3300017792 Ga0163161_10036066 Ga0163161_100360662 189
593 3300017792 Ga0163161_10084006 Ga0163161_100840063 189
594 3300017792 Ga0163161_10093078 Ga0163161_100930782 189
595 3300017792 Ga0163161_10109392 Ga0163161_101093921 189
596 3300017792 Ga0163161_10457703 Ga0163161_104577032 189
597 3300025207 Ga0209760_100080 Ga0209760_10008010 189
598 3300025207 Ga0209760_100159 Ga0209760_10015923 189
599 3300025231 Ga0207427_100014 Ga0207427_100014296 189
600 3300025231 Ga0207427_100016 Ga0207427_10001661 189
601 3300025233 Ga0209437_100011 Ga0209437_100011250 189
602 3300025233 Ga0209437_100016 Ga0209437_100016341 189
603 3300025261 Ga0209233_1000019 Ga0209233_1000019250 189
604 3300025261 Ga0209233_1000036 Ga0209233_1000036296 189
605 3300025291 Ga0209675_1002039 Ga0209675_10020399 189
606 3300025292 Ga0209676_1000025 Ga0209676_1000025345 189
607 3300025292 Ga0209676_1000032 Ga0209676_1000032277 189
608 3300025292 Ga0209676_1000208 Ga0209676_100020831 189
609 3300025292 Ga0209676_1008844 Ga0209676_10088442 189
610 3300025298 Ga0209050_1000025 Ga0209050_1000025278 189
611 3300025298 Ga0209050_1000028 Ga0209050_1000028177 189
612 3300025298 Ga0209050_1000381 Ga0209050_100038159 189
613 3300025298 Ga0209050_1004298 Ga0209050_10042985 189
614 3300025303 Ga0209051_1000026 Ga0209051_1000026140 189
615 3300025303 Ga0209051_1000080 Ga0209051_100008010 189
616 3300025303 Ga0209051_1000299 Ga0209051_100029967 189
617 3300025303 Ga0209051_1007210 Ga0209051_10072102 189
618 3300025304 Ga0209257_1000034 Ga0209257_1000034345 189
619 3300025711 Ga0207696_1000057 Ga0207696_1000057172 189
620 3300025711 Ga0207696_1000084 Ga0207696_1000084112 189
621 3300025711 Ga0207696_1001618 Ga0207696_10016185 189
622 3300025711 Ga0207696_1001785 Ga0207696_10017857 189
623 3300025711 Ga0207696_1015745 Ga0207696_10157453 189
624 3300025711 Ga0207696_1019215 Ga0207696_10192152 189
625 3300025728 Ga0207655_1000904 Ga0207655_100090418 189
626 3300025728 Ga0207655_1001055 Ga0207655_10010558 189
627 3300025728 Ga0207655_1001190 Ga0207655_100119017 189
628 3300025728 Ga0207655_1002635 Ga0207655_10026352 189
629 3300025728 Ga0207655_1008767 Ga0207655_10087676 189
630 3300025728 Ga0207655_1008967 Ga0207655_10089672 189
631 3300025728 Ga0207655_1014494 Ga0207655_10144943 189
632 3300025728 Ga0207655_1016259 Ga0207655_10162593 189
633 3300025728 Ga0207655_1021200 Ga0207655_10212002 189
634 3300025728 Ga0207655_1032022 Ga0207655_10320223 189
635 3300025728 Ga0207655_1060432 Ga0207655_10604322 189
636 3300025728 Ga0207655_1170742 Ga0207655_11707421 189
637 3300025735 Ga0207713_1000031 Ga0207713_100003125 189
638 3300025735 Ga0207713_1000814 Ga0207713_100081416 189
639 3300025735 Ga0207713_1000823 Ga0207713_10008238 189
640 3300025735 Ga0207713_1002650 Ga0207713_10026507 189
641 3300025735 Ga0207713_1009755 Ga0207713_10097555 189
642 3300025735 Ga0207713_1012347 Ga0207713_10123474 189
643 3300025735 Ga0207713_1029279 Ga0207713_10292792 189
644 3300025735 Ga0207713_1036246 Ga0207713_10362462 189
645 3300025735 Ga0207713_1052298 Ga0207713_10522982 189
646 3300025735 Ga0207713_1059722 Ga0207713_10597222 189
647 3300025923 Ga0207681_10003730 Ga0207681_100037305 189
648 3300025925 Ga0207650_10000239 Ga0207650_1000023949 189
649 3300025925 Ga0207650_10000329 Ga0207650_1000032933 189
650 3300025932 Ga0207690_10114470 Ga0207690_101144702 189
651 3300025933 Ga0207706_10000885 Ga0207706_1000088518 189
652 3300025933 Ga0207706_10023197 Ga0207706_100231973 189
653 3300025934 Ga0207686_10004530 Ga0207686_100045305 189
654 3300025934 Ga0207686_11083749 Ga0207686_110837491 189
655 3300025935 Ga0207709_10000451 Ga0207709_1000045111 189
656 3300025935 Ga0207709_10001143 Ga0207709_1000114311 189
657 3300025935 Ga0207709_10023633 Ga0207709_100236333 189
658 3300025935 Ga0207709_10282213 Ga0207709_102822131 189
659 3300025937 Ga0207669_10538028 Ga0207669_105380281 189
660 3300025961 Ga0207712_10015979 Ga0207712_100159795 189
661 3300025981 Ga0207640_10270882 Ga0207640_102708822 189
662 3300026041 Ga0207639_10000090 Ga0207639_100000909 189
663 3300027111 Ga0209281_1000026 Ga0209281_1000026217 189
664 3300027543 Ga0209999_1021528 Ga0209999_10215282 189
665 3300027876 Ga0209974_10036493 Ga0209974_100364933 189
666 3300027907 Ga0207428_10049095 Ga0207428_100490952 189
667 3300027907 Ga0207428_10066966 Ga0207428_100669662 189
668 3300027907 Ga0207428_10095968 Ga0207428_100959682 189
669 3300027907 Ga0207428_10118080 Ga0207428_101180803 189
670 3300027907 Ga0207428_10144919 Ga0207428_101449193 189
671 3300027907 Ga0207428_10147461 Ga0207428_101474612 189
672 3300027907 Ga0207428_10232651 Ga0207428_102326511 189
673 3300027907 Ga0207428_10250272 Ga0207428_102502723 189
674 3300027907 Ga0207428_10270798 Ga0207428_102707982 189
675 3300027907 Ga0207428_10340233 Ga0207428_103402332 189
676 3300027907 Ga0207428_10378057 Ga0207428_103780572 189
677 3300028379 Ga0268266_10010145 Ga0268266_100101455 189
678 3300028379 Ga0268266_10398129 Ga0268266_103981293 189
679 3300028379 Ga0268266_10502825 Ga0268266_105028252 189
680 3300028379 Ga0268266_10856734 Ga0268266_108567342 189
681 3300030521 Ga0307511_10053758 Ga0307511_100537581 189
682 3300030731 Ga0316177_1177268 Ga0316177_11772682 189
683 3300030733 Ga0314311_1075429 Ga0314311_10754292 189
684 3300030734 Ga0316179_1006263 Ga0316179_10062633 189
685 3300030735 Ga0316178_1102168 Ga0316178_110216821 189
686 3300030744 Ga0316181_1002693 Ga0316181_10026932 189
687 3300030744 Ga0316181_1121023 Ga0316181_11210232 189
688 3300031548 Ga0307408_100012498 Ga0307408_1000124982 189
689 3300031548 Ga0307408_100032358 Ga0307408_1000323584 189
690 3300031548 Ga0307408_100037404 Ga0307408_1000374044 189
691 3300031548 Ga0307408_100064408 Ga0307408_1000644082 189
692 3300031548 Ga0307408_100365380 Ga0307408_1003653802 189
693 3300031548 Ga0307408_100792034 Ga0307408_1007920341 189
694 3300031730 Ga0307516_10375404 Ga0307516_103754041 189
695 3300031730 Ga0307516_10413951 Ga0307516_104139512 189
696 3300031730 Ga0307516_10663563 Ga0307516_106635631 189
697 3300031730 Ga0307516_10682850 Ga0307516_106828501 189
698 3300031731 Ga0307405_10007313 Ga0307405_100073138 189
699 3300031731 Ga0307405_10008242 Ga0307405_100082425 189
700 3300031731 Ga0307405_10192149 Ga0307405_101921492 189
701 3300031824 Ga0307413_10009156 Ga0307413_100091562 189
702 3300031824 Ga0307413_10351581 Ga0307413_103515812 189
703 3300031901 Ga0307406_10063345 Ga0307406_100633452 189
704 3300031901 Ga0307406_10064223 Ga0307406_100642233 189
705 3300031901 Ga0307406_10075363 Ga0307406_100753631 189
706 3300031903 Ga0307407_10022269 Ga0307407_100222692 189
707 3300031903 Ga0307407_10181792 Ga0307407_101817921 189
708 3300031903 Ga0307407_10211307 Ga0307407_102113073 189
709 3300031911 Ga0307412_10004350 Ga0307412_100043504 189
710 3300031911 Ga0307412_10016014 Ga0307412_100160144 189
711 3300031911 Ga0307412_10046924 Ga0307412_100469241 189
712 3300031911 Ga0307412_10079810 Ga0307412_100798102 189
713 3300031995 Ga0307409_100024465 Ga0307409_1000244653 189
714 3300031995 Ga0307409_100059172 Ga0307409_1000591724 189
715 3300032002 Ga0307416_100238636 Ga0307416_1002386363 189
716 3300032004 Ga0307414_10035341 Ga0307414_100353413 189
717 3300032004 Ga0307414_10141088 Ga0307414_101410882 189
718 3300032004 Ga0307414_10783747 Ga0307414_107837472 189
719 3300032005 Ga0307411_10022884 Ga0307411_100228842 189
720 3300032005 Ga0307411_10028510 Ga0307411_100285105 189
721 3300033180 Ga0307510_10255860 Ga0307510_102558602 189
722 3300033180 Ga0307510_10278147 Ga0307510_102781471 189
723 3300038705 Ga0237819_01489 Ga0237819_01489_2138_2707 189
724 3300041405 Ga0439438_003654 Ga0439438_003654_1281_1850 189
725 3300041405 Ga0439438_004828 Ga0439438_004828_753_1322 189
726 3300041405 Ga0439438_005738 Ga0439438_005738_18_587 189
727 3300041405 Ga0439438_008517 Ga0439438_008517_2090_2659 189
728 3300041405 Ga0439438_009720 Ga0439438_009720_954_1523 189
729 3300041405 Ga0439438_011790 Ga0439438_011790_1560_2129 189
730 3300041405 Ga0439438_012563 Ga0439438_012563_740_1309 189
731 3300041405 Ga0439438_020043 Ga0439438_020043_792_1361 189
732 3300041405 Ga0439438_021687 Ga0439438_021687_999_1568 189
733 3300041405 Ga0439438_109455 Ga0439438_109455_63_632 189
734 3300041407 Ga0439447_001162 Ga0439447_001162_674_1243 189
735 3300041407 Ga0439447_002676 Ga0439447_002676_5615_6184 189
736 3300041407 Ga0439447_003145 Ga0439447_003145_1450_2019 189
737 3300041407 Ga0439447_009907 Ga0439447_009907_794_1363 189
738 3300041407 Ga0439447_013534 Ga0439447_013534_1340_1909 189
739 3300041407 Ga0439447_019669 Ga0439447_019669_289_858 189
740 3300041407 Ga0439447_037941 Ga0439447_037941_542_1111 189
741 3300041407 Ga0439447_041274 Ga0439447_041274_92_661 189
742 3300041410 Ga0439461_0012965 Ga0439461_0012965_646_1215 189
743 3300041411 Ga0439466_0002609 Ga0439466_0002609_1985_2554 189
744 3300041411 Ga0439466_0010095 Ga0439466_0010095_253_822 189
745 3300041411 Ga0439466_0015149 Ga0439466_0015149_812_1381 189
746 3300041411 Ga0439466_0023349 Ga0439466_0023349_1305_1874 189
747 3300041411 Ga0439466_0024797 Ga0439466_0024797_1301_1870 189
748 3300041411 Ga0439466_0041874 Ga0439466_0041874_940_1509 189
749 3300041411 Ga0439466_0042655 Ga0439466_0042655_781_1350 189
750 3300041411 Ga0439466_0065398 Ga0439466_0065398_21_590 189
751 3300041411 Ga0439466_0123004 Ga0439466_0123004_109_678 189
752 3300041411 Ga0439466_0166073 Ga0439466_0166073_76_645 189
753 3300041413 Ga0439465_0021499 Ga0439465_0021499_644_1213 189
754 3300041413 Ga0439465_0181168 Ga0439465_0181168_65_634 189
755 3300041997 Ga0439431_0036057 Ga0439431_0036057_90_659 189
756 3300042004 Ga0439445_0034593 Ga0439445_0034593_31_600 189
757 3300042004 Ga0439445_0083072 Ga0439445_0083072_174_743 189
758 3300042006 Ga0439432_007470 Ga0439432_007470_29_598 189
759 3300042006 Ga0439432_010854 Ga0439432_010854_1173_1742 189
760 3300042006 Ga0439432_010861 Ga0439432_010861_847_1416 189
761 3300042006 Ga0439432_013727 Ga0439432_013727_545_1114 189
762 3300042006 Ga0439432_018291 Ga0439432_018291_824_1393 189
763 3300042006 Ga0439432_037859 Ga0439432_037859_951_1520 189
764 3300042006 Ga0439432_049827 Ga0439432_049827_656_1225 189
765 3300042009 Ga0439451_000219 Ga0439451_000219_3312_3881 189
766 3300042009 Ga0439451_003423 Ga0439451_003423_2155_2724 189
767 3300042009 Ga0439451_009673 Ga0439451_009673_740_1309 189
768 3300042009 Ga0439451_012251 Ga0439451_012251_675_1244 189
769 3300042010 Ga0439452_000786 Ga0439452_000786_12966_13535 189
770 3300042010 Ga0439452_000858 Ga0439452_000858_1552_2121 189
771 3300042010 Ga0439452_000882 Ga0439452_000882_133_702 189
772 3300042010 Ga0439452_007512 Ga0439452_007512_805_1374 189
773 3300042010 Ga0439452_017937 Ga0439452_017937_632_1201 189
774 3300042010 Ga0439452_019221 Ga0439452_019221_289_858 189
775 3300042010 Ga0439452_101407 Ga0439452_101407_27_596 189
776 3300042013 Ga0439456_001434 Ga0439456_001434_332_901 189
777 3300042013 Ga0439456_003499 Ga0439456_003499_262_831 189
778 3300042013 Ga0439456_004040 Ga0439456_004040_1457_2026 189
779 3300042013 Ga0439456_013673 Ga0439456_013673_557_1126 189
780 3300042016 Ga0439463_000059 Ga0439463_000059_9973_10557 189
781 3300042016 Ga0439463_002011 Ga0439463_002011_3586_4155 189
782 3300042016 Ga0439463_007735 Ga0439463_007735_885_1454 189
783 3300042115 Ga0450911_000355 Ga0450911_000355_1543_2112 189
784 3300042115 Ga0450911_001787 Ga0450911_001787_3492_4061 189
785 3300042115 Ga0450911_020729 Ga0450911_020729_154_723 189
786 3300042121 Ga0450919_002716 Ga0450919_002716_143_712 189
787 3300042121 Ga0450919_005971 Ga0450919_005971_802_1371 189
788 3300042122 Ga0450920_003893 Ga0450920_003893_364_933 189
789 3300042124 Ga0450922_001766 Ga0450922_001766_994_1563 189
790 3300042124 Ga0450922_002275 Ga0450922_002275_712_1281 189
791 3300042127 Ga0450890_002796 Ga0450890_002796_624_1193 189
792 3300042137 Ga0450902_002664 Ga0450902_002664_1292_1861 189
793 3300042137 Ga0450902_006480 Ga0450902_006480_204_773 189
794 3300042137 Ga0450902_007764 Ga0450902_007764_786_1355 189
795 3300042137 Ga0450902_015368 Ga0450902_015368_279_848 189
796 3300042137 Ga0450902_022188 Ga0450902_022188_394_963 189
797 3300042138 Ga0450903_003286 Ga0450903_003286_842_1411 189
798 3300042138 Ga0450903_005488 Ga0450903_005488_1029_1598 189
799 3300042138 Ga0450903_005831 Ga0450903_005831_1175_1744 189
800 3300042138 Ga0450903_010751 Ga0450903_010751_390_959 189
801 3300042138 Ga0450903_031479 Ga0450903_031479_199_768 189
802 3300042139 Ga0450904_004131 Ga0450904_004131_656_1225 189
803 3300042139 Ga0450904_005098 Ga0450904_005098_707_1276 189
804 3300042139 Ga0450904_016033 Ga0450904_016033_64_633 189
805 3300042142 Ga0450905_015875 Ga0450905_015875_239_808 189
806 3300042145 Ga0450906_001300 Ga0450906_001300_3702_4271 189
807 3300042145 Ga0450906_003092 Ga0450906_003092_1620_2189 189
808 3300042145 Ga0450906_004459 Ga0450906_004459_1838_2407 189
809 3300042145 Ga0450906_015452 Ga0450906_015452_27_596 189
810 3300042146 Ga0450907_000751 Ga0450907_000751_3976_4545 189
811 3300042146 Ga0450907_001928 Ga0450907_001928_1017_1586 189
812 3300042146 Ga0450907_008730 Ga0450907_008730_110_679 189
813 3300042146 Ga0450907_015168 Ga0450907_015168_45_614 189
814 3300042147 Ga0450910_001148 Ga0450910_001148_1367_1936 189
815 3300042147 Ga0450910_001197 Ga0450910_001197_1988_2557 189
816 3300042156 Ga0439446_0005785 Ga0439446_0005785_325_894 189
817 3300042156 Ga0439446_0021796 Ga0439446_0021796_588_1157 189
818 3300042156 Ga0439446_0166510 Ga0439446_0166510_95_664 189
819 3300042184 Ga0450908_002052 Ga0450908_002052_2138_2707 189
820 3300042184 Ga0450908_015740 Ga0450908_015740_672_1241 189
821 3300042185 Ga0450909_000194 Ga0450909_000194_2907_3476 189
822 3300042185 Ga0450909_004815 Ga0450909_004815_392_961 189
823 3300042185 Ga0450909_006031 Ga0450909_006031_933_1502 189
824 3300042185 Ga0450909_017250 Ga0450909_017250_313_882 189
825 3300042185 Ga0450909_027573 Ga0450909_027573_267_836 189
826 3300042435 Ga0439434_0007561 Ga0439434_0007561_1460_2029 189
827 3300042435 Ga0439434_0019121 Ga0439434_0019121_960_1529 189
828 3300042439 Ga0439464_0017084 Ga0439464_0017084_986_1555 189
829 3300042461 Ga0439460_0000931 Ga0439460_0000931_661_1230 189
830 3300042461 Ga0439460_0005366 Ga0439460_0005366_1125_1694 189
831 3300042461 Ga0439460_0043704 Ga0439460_0043704_439_1008 189
832 3300042531 Ga0450918_004836 Ga0450918_004836_1394_1963 189
833 3300042532 Ga0450893_0008146 Ga0450893_0008146_687_1256 189
834 3300042532 Ga0450893_0015623 Ga0450893_0015623_235_804 189
835 3300042533 Ga0450901_001538 Ga0450901_001538_1490_2059 189
836 3300042993 Ga0439440_0002263 Ga0439440_0002263_901_1470 189
837 3300042993 Ga0439440_0004511 Ga0439440_0004511_1162_1731 189
838 3300042993 Ga0439440_0042963 Ga0439440_0042963_88_657 189
839 3300046452 Ga0495617_000455 Ga0495617_000455_8450_9019 189
840 3300046452 Ga0495617_016968 Ga0495617_016968_1416_1985 189
841 3300046452 Ga0495617_020572 Ga0495617_020572_993_1562 189
842 3300046452 Ga0495617_023097 Ga0495617_023097_698_1267 189
843 3300046452 Ga0495617_032429 Ga0495617_032429_466_1035 189
844 3300046452 Ga0495617_042487 Ga0495617_042487_900_1469 189
845 3300046452 Ga0495617_079982 Ga0495617_079982_479_1048 189
846 3300046452 Ga0495617_122407 Ga0495617_122407_239_808 189
847 3300046452 Ga0495617_166455 Ga0495617_166455_49_618 189
848 3300046453 Ga0495627_002889 Ga0495627_002889_645_1214 189
849 3300046453 Ga0495627_004710 Ga0495627_004710_1762_2331 189
850 3300046453 Ga0495627_005252 Ga0495627_005252_102_671 189
851 3300046453 Ga0495627_005394 Ga0495627_005394_3589_4158 189
852 3300046455 Ga0495603_0019755 Ga0495603_0019755_2035_2604 189
853 3300046455 Ga0495603_0021930 Ga0495603_0021930_800_1369 189
854 3300046455 Ga0495603_0127178 Ga0495603_0127178_464_1033 189
855 3300046457 Ga0495590_0005324 Ga0495590_0005324_685_1254 189
856 3300046457 Ga0495590_0005345 Ga0495590_0005345_4512_5081 189
857 3300046457 Ga0495590_0006976 Ga0495590_0006976_3737_4306 189
858 3300046457 Ga0495590_0010131 Ga0495590_0010131_496_1065 189
859 3300046457 Ga0495590_0067163 Ga0495590_0067163_44_613 189
860 3300046457 Ga0495590_0137570 Ga0495590_0137570_24_611 189
861 3300046457 Ga0495590_0213544 Ga0495590_0213544_49_618 189
862 3300046457 Ga0495590_0219809 Ga0495590_0219809_99_668 189
863 3300046458 Ga0495591_001374 Ga0495591_001374_30_617 189
864 3300046458 Ga0495591_002443 Ga0495591_002443_2697_3284 189
865 3300046458 Ga0495591_004511 Ga0495591_004511_1319_1888 189
866 3300046458 Ga0495591_007579 Ga0495591_007579_1518_2087 189
867 3300046458 Ga0495591_011222 Ga0495591_011222_346_915 189
868 3300046458 Ga0495591_013401 Ga0495591_013401_2135_2704 189
869 3300046458 Ga0495591_020900 Ga0495591_020900_1475_2044 189
870 3300046458 Ga0495591_021315 Ga0495591_021315_73_642 189
871 3300046458 Ga0495591_023376 Ga0495591_023376_643_1212 189
872 3300046458 Ga0495591_023901 Ga0495591_023901_726_1295 189
873 3300046458 Ga0495591_027487 Ga0495591_027487_73_642 189
874 3300046459 Ga0495629_0041841 Ga0495629_0041841_1344_1913 189
875 3300046459 Ga0495629_0489478 Ga0495629_0489478_95_664 189
876 3300046460 Ga0495638_0012439 Ga0495638_0012439_1610_2179 189
877 3300046460 Ga0495638_0040709 Ga0495638_0040709_915_1484 189
878 3300046460 Ga0495638_0042708 Ga0495638_0042708_1776_2345 189
879 3300046460 Ga0495638_0066208 Ga0495638_0066208_1065_1634 189
880 3300046460 Ga0495638_0085550 Ga0495638_0085550_401_970 189
881 3300046460 Ga0495638_0102268 Ga0495638_0102268_347_916 189
882 3300046460 Ga0495638_0142455 Ga0495638_0142455_730_1299 189
883 3300046460 Ga0495638_0146968 Ga0495638_0146968_694_1263 189
884 3300046460 Ga0495638_0151961 Ga0495638_0151961_485_1054 189
885 3300046460 Ga0495638_0170600 Ga0495638_0170600_387_956 189
886 3300046460 Ga0495638_0172172 Ga0495638_0172172_50_619 189
887 3300046460 Ga0495638_0264652 Ga0495638_0264652_19_588 189
888 3300046460 Ga0495638_0352668 Ga0495638_0352668_63_632 189
889 3300046463 Ga0495653_0028107 Ga0495653_0028107_1408_1977 189
890 3300046463 Ga0495653_0031214 Ga0495653_0031214_526_1095 189
891 3300046463 Ga0495653_0114074 Ga0495653_0114074_534_1103 189
892 3300046463 Ga0495653_0123821 Ga0495653_0123821_136_705 189
893 3300046463 Ga0495653_0150220 Ga0495653_0150220_604_1173 189
894 3300046471 Ga0495650_0000718 Ga0495650_0000718_40358_40945 189
895 3300046471 Ga0495650_0009711 Ga0495650_0009711_4588_5157 189
896 3300046471 Ga0495650_0016359 Ga0495650_0016359_1725_2294 189
897 3300046471 Ga0495650_0027069 Ga0495650_0027069_656_1225 189
898 3300046471 Ga0495650_0028337 Ga0495650_0028337_1940_2509 189
899 3300046471 Ga0495650_0041241 Ga0495650_0041241_107_676 189
900 3300046471 Ga0495650_0063363 Ga0495650_0063363_824_1393 189
901 3300046471 Ga0495650_0078816 Ga0495650_0078816_134_703 189
902 3300046471 Ga0495650_0081303 Ga0495650_0081303_478_1047 189
903 3300046472 Ga0495580_0372099 Ga0495580_0372099_174_743 189
904 3300046473 Ga0495582_0017643 Ga0495582_0017643_1383_1952 189
905 3300046474 Ga0495605_0000677 Ga0495605_0000677_10206_10775 189
906 3300046474 Ga0495605_0005176 Ga0495605_0005176_3243_3812 189
907 3300046474 Ga0495605_0009136 Ga0495605_0009136_4383_4952 189
908 3300046474 Ga0495605_0010025 Ga0495605_0010025_2852_3439 189
909 3300046474 Ga0495605_0031661 Ga0495605_0031661_1144_1713 189
910 3300046474 Ga0495605_0043335 Ga0495605_0043335_1454_2023 189
911 3300046474 Ga0495605_0048388 Ga0495605_0048388_815_1384 189
912 3300046474 Ga0495605_0068052 Ga0495605_0068052_868_1437 189
913 3300046474 Ga0495605_0097537 Ga0495605_0097537_504_1073 189
914 3300046474 Ga0495605_0120364 Ga0495605_0120364_261_830 189
915 3300046475 Ga0495639_0003452 Ga0495639_0003452_4494_5063 189
916 3300046475 Ga0495639_0015143 Ga0495639_0015143_1351_1920 189
917 3300046491 Ga0495584_0003386 Ga0495584_0003386_3902_4471 189
918 3300046491 Ga0495584_0007805 Ga0495584_0007805_3377_3946 189
919 3300046491 Ga0495584_0007989 Ga0495584_0007989_1148_1717 189
920 3300046491 Ga0495584_0009605 Ga0495584_0009605_3268_3837 189
921 3300046491 Ga0495584_0012470 Ga0495584_0012470_483_1052 189
922 3300046491 Ga0495584_0015823 Ga0495584_0015823_305_892 189
923 3300046491 Ga0495584_0021844 Ga0495584_0021844_16_585 189
924 3300046491 Ga0495584_0043299 Ga0495584_0043299_684_1253 189
925 3300046491 Ga0495584_0055595 Ga0495584_0055595_150_719 189
926 3300046491 Ga0495584_0124809 Ga0495584_0124809_701_1270 189
927 3300046491 Ga0495584_0236655 Ga0495584_0236655_119_688 189
928 3300046492 Ga0495585_0005619 Ga0495585_0005619_3558_4127 189
929 3300046492 Ga0495585_0039415 Ga0495585_0039415_603_1172 189
930 3300046492 Ga0495585_0045544 Ga0495585_0045544_678_1247 189
931 3300046492 Ga0495585_0060206 Ga0495585_0060206_63_632 189
932 3300046492 Ga0495585_0071601 Ga0495585_0071601_642_1211 189
933 3300046492 Ga0495585_0081521 Ga0495585_0081521_630_1199 189
934 3300046492 Ga0495585_0094497 Ga0495585_0094497_90_659 189
935 3300046492 Ga0495585_0312204 Ga0495585_0312204_106_675 189
936 3300046492 Ga0495585_0353485 Ga0495585_0353485_73_642 189
937 3300046499 Ga0495594_0060885 Ga0495594_0060885_900_1469 189
938 3300046499 Ga0495594_0073147 Ga0495594_0073147_545_1114 189
939 3300046500 Ga0495596_0000545 Ga0495596_0000545_8616_9185 189
940 3300046500 Ga0495596_0009976 Ga0495596_0009976_2286_2873 189
941 3300046500 Ga0495596_0041180 Ga0495596_0041180_137_706 189
942 3300046501 Ga0495607_0001262 Ga0495607_0001262_1243_1830 189
943 3300046501 Ga0495607_0001270 Ga0495607_0001270_10750_11334 189
944 3300046501 Ga0495607_0002719 Ga0495607_0002719_13026_13595 189
945 3300046501 Ga0495607_0009146 Ga0495607_0009146_131_718 189
946 3300046501 Ga0495607_0011725 Ga0495607_0011725_2886_3473 189
947 3300046501 Ga0495607_0011903 Ga0495607_0011903_1501_2070 189
948 3300046501 Ga0495607_0018908 Ga0495607_0018908_336_905 189
949 3300046501 Ga0495607_0024517 Ga0495607_0024517_1452_2021 189
950 3300046501 Ga0495607_0032189 Ga0495607_0032189_1119_1688 189
951 3300046501 Ga0495607_0034685 Ga0495607_0034685_1767_2336 189
952 3300046501 Ga0495607_0049452 Ga0495607_0049452_366_935 189
953 3300046501 Ga0495607_0062114 Ga0495607_0062114_1488_2057 189
954 3300046501 Ga0495607_0102207 Ga0495607_0102207_906_1475 189
955 3300046501 Ga0495607_0207657 Ga0495607_0207657_311_880 189
956 3300046506 Ga0495583_0002179 Ga0495583_0002179_9556_10143 189
957 3300046506 Ga0495583_0003557 Ga0495583_0003557_9522_10091 189
958 3300046506 Ga0495583_0004153 Ga0495583_0004153_589_1158 189
959 3300046506 Ga0495583_0005841 Ga0495583_0005841_2321_2908 189
960 3300046506 Ga0495583_0016855 Ga0495583_0016855_1959_2528 189
961 3300046506 Ga0495583_0060381 Ga0495583_0060381_316_885 189
962 3300046507 Ga0495606_0000447 Ga0495606_0000447_13474_14061 189
963 3300046507 Ga0495606_0001171 Ga0495606_0001171_6870_7439 189
964 3300046507 Ga0495606_0013954 Ga0495606_0013954_4581_5150 189
965 3300046507 Ga0495606_0016616 Ga0495606_0016616_3892_4461 189
966 3300046507 Ga0495606_0050737 Ga0495606_0050737_1492_2061 189
967 3300046507 Ga0495606_0054299 Ga0495606_0054299_205_792 189
968 3300046507 Ga0495606_0074835 Ga0495606_0074835_1479_2048 189
969 3300046507 Ga0495606_0076337 Ga0495606_0076337_494_1063 189
970 3300046507 Ga0495606_0086187 Ga0495606_0086187_100_669 189
971 3300046507 Ga0495606_0131494 Ga0495606_0131494_808_1377 189
972 3300046507 Ga0495606_0161981 Ga0495606_0161981_673_1242 189
973 3300046512 Ga0495610_0005122 Ga0495610_0005122_812_1381 189
974 3300046512 Ga0495610_0011082 Ga0495610_0011082_3677_4264 189
975 3300046512 Ga0495610_0015733 Ga0495610_0015733_3231_3800 189
976 3300046512 Ga0495610_0018883 Ga0495610_0018883_706_1275 189
977 3300046512 Ga0495610_0025624 Ga0495610_0025624_993_1562 189
978 3300046512 Ga0495610_0038432 Ga0495610_0038432_1489_2058 189
979 3300046512 Ga0495610_0046616 Ga0495610_0046616_684_1253 189
980 3300046512 Ga0495610_0050024 Ga0495610_0050024_63_632 189
981 3300046512 Ga0495610_0070362 Ga0495610_0070362_500_1069 189
982 3300046512 Ga0495610_0126079 Ga0495610_0126079_518_1087 189
983 3300046513 Ga0495616_0008264 Ga0495616_0008264_765_1334 189
984 3300046513 Ga0495616_0028400 Ga0495616_0028400_932_1501 189
985 3300046513 Ga0495616_0031098 Ga0495616_0031098_1024_1611 189
986 3300046513 Ga0495616_0042070 Ga0495616_0042070_300_869 189
987 3300046513 Ga0495616_0044965 Ga0495616_0044965_1370_1939 189
988 3300046513 Ga0495616_0051284 Ga0495616_0051284_1021_1590 189
989 3300046513 Ga0495616_0052474 Ga0495616_0052474_779_1348 189
990 3300046513 Ga0495616_0077587 Ga0495616_0077587_60_629 189
991 3300046513 Ga0495616_0083364 Ga0495616_0083364_651_1220 189
992 3300046513 Ga0495616_0138782 Ga0495616_0138782_134_703 189
993 3300046515 Ga0495620_0000422 Ga0495620_0000422_9709_10293 189
994 3300046515 Ga0495620_0001025 Ga0495620_0001025_13761_14330 189
995 3300046515 Ga0495620_0006643 Ga0495620_0006643_1444_2031 189
996 3300046515 Ga0495620_0019112 Ga0495620_0019112_1683_2252 189
997 3300046515 Ga0495620_0039388 Ga0495620_0039388_73_642 189
998 3300046515 Ga0495620_0048978 Ga0495620_0048978_925_1494 189
999 3300046515 Ga0495620_0053634 Ga0495620_0053634_138_707 189
1000 3300046515 Ga0495620_0080680 Ga0495620_0080680_667_1236 189
1001 3300046515 Ga0495620_0087307 Ga0495620_0087307_281_868 189
1002 3300046515 Ga0495620_0113317 Ga0495620_0113317_442_1011 189
1003 3300046517 Ga0495630_0076740 Ga0495630_0076740_1428_1997 189
1004 3300046517 Ga0495630_0169221 Ga0495630_0169221_556_1125 189
1005 3300046518 Ga0495631_0001255 Ga0495631_0001255_13514_14083 189
1006 3300046518 Ga0495631_0003289 Ga0495631_0003289_6254_6841 189
1007 3300046518 Ga0495631_0024638 Ga0495631_0024638_781_1350 189
1008 3300046518 Ga0495631_0043549 Ga0495631_0043549_802_1371 189
1009 3300046518 Ga0495631_0106366 Ga0495631_0106366_53_622 189
1010 3300046519 Ga0495632_0001743 Ga0495632_0001743_3707_4276 189
1011 3300046519 Ga0495632_0008921 Ga0495632_0008921_1515_2084 189
1012 3300046519 Ga0495632_0018170 Ga0495632_0018170_1935_2504 189
1013 3300046519 Ga0495632_0021415 Ga0495632_0021415_1419_1988 189
1014 3300046519 Ga0495632_0047488 Ga0495632_0047488_1487_2056 189
1015 3300046519 Ga0495632_0055878 Ga0495632_0055878_697_1266 189
1016 3300046519 Ga0495632_0065841 Ga0495632_0065841_26_595 189
1017 3300046519 Ga0495632_0102163 Ga0495632_0102163_365_952 189
1018 3300046519 Ga0495632_0106803 Ga0495632_0106803_108_677 189
1019 3300046519 Ga0495632_0164002 Ga0495632_0164002_384_953 189
1020 3300046520 Ga0495637_0000298 Ga0495637_0000298_1739_2326 189
1021 3300046520 Ga0495637_0000682 Ga0495637_0000682_11306_11893 189
1022 3300046520 Ga0495637_0015818 Ga0495637_0015818_1624_2211 189
1023 3300046520 Ga0495637_0022942 Ga0495637_0022942_320_889 189
1024 3300046520 Ga0495637_0029600 Ga0495637_0029600_655_1224 189
1025 3300046520 Ga0495637_0034836 Ga0495637_0034836_666_1235 189
1026 3300046520 Ga0495637_0037391 Ga0495637_0037391_38_607 189
1027 3300046520 Ga0495637_0038157 Ga0495637_0038157_1475_2044 189
1028 3300046520 Ga0495637_0038188 Ga0495637_0038188_1441_2010 189
1029 3300046520 Ga0495637_0038338 Ga0495637_0038338_1489_2058 189
1030 3300046520 Ga0495637_0040992 Ga0495637_0040992_18_587 189
1031 3300046520 Ga0495637_0042080 Ga0495637_0042080_135_704 189
1032 3300046520 Ga0495637_0046417 Ga0495637_0046417_713_1282 189
1033 3300046520 Ga0495637_0046505 Ga0495637_0046505_606_1175 189
1034 3300046520 Ga0495637_0066996 Ga0495637_0066996_87_656 189
1035 3300046520 Ga0495637_0211366 Ga0495637_0211366_25_594 189
1036 3300046522 Ga0495643_0035491 Ga0495643_0035491_1533_2102 189
1037 3300046522 Ga0495643_0059837 Ga0495643_0059837_133_702 189
1038 3300046522 Ga0495643_0062319 Ga0495643_0062319_764_1333 189
1039 3300046522 Ga0495643_0069382 Ga0495643_0069382_497_1066 189
1040 3300046522 Ga0495643_0112799 Ga0495643_0112799_258_845 189
1041 3300046523 Ga0495644_0012997 Ga0495644_0012997_643_1212 189
1042 3300046523 Ga0495644_0014061 Ga0495644_0014061_1126_1713 189
1043 3300046523 Ga0495644_0014791 Ga0495644_0014791_775_1344 189
1044 3300046523 Ga0495644_0033845 Ga0495644_0033845_1236_1805 189
1045 3300046523 Ga0495644_0103635 Ga0495644_0103635_171_740 189
1046 3300046524 Ga0495648_0002138 Ga0495648_0002138_3915_4484 189
1047 3300046524 Ga0495648_0004952 Ga0495648_0004952_8614_9201 189
1048 3300046524 Ga0495648_0017526 Ga0495648_0017526_3551_4138 189
1049 3300046524 Ga0495648_0042007 Ga0495648_0042007_992_1561 189
1050 3300046524 Ga0495648_0050682 Ga0495648_0050682_537_1106 189
1051 3300046524 Ga0495648_0066717 Ga0495648_0066717_1467_2036 189
1052 3300046524 Ga0495648_0067113 Ga0495648_0067113_73_642 189
1053 3300046524 Ga0495648_0081613 Ga0495648_0081613_1159_1728 189
1054 3300046524 Ga0495648_0089340 Ga0495648_0089340_601_1170 189
1055 3300046524 Ga0495648_0105871 Ga0495648_0105871_562_1131 189
1056 3300046524 Ga0495648_0125908 Ga0495648_0125908_30_599 189
1057 3300046524 Ga0495648_0153197 Ga0495648_0153197_25_594 189
1058 3300046524 Ga0495648_0180481 Ga0495648_0180481_481_1050 189
1059 3300046524 Ga0495648_0201218 Ga0495648_0201218_133_702 189
1060 3300046524 Ga0495648_0217536 Ga0495648_0217536_305_874 189
1061 3300046524 Ga0495648_0341847 Ga0495648_0341847_90_659 189
1062 3300046526 Ga0495666_0009808 Ga0495666_0009808_1370_1939 189
1063 3300046526 Ga0495666_0050547 Ga0495666_0050547_865_1434 189
1064 3300046526 Ga0495666_0086301 Ga0495666_0086301_868_1437 189
1065 3300046526 Ga0495666_0105907 Ga0495666_0105907_296_865 189
1066 3300046528 Ga0495642_0000662 Ga0495642_0000662_3656_4225 189
1067 3300046528 Ga0495642_0000940 Ga0495642_0000940_2017_2586 189
1068 3300046528 Ga0495642_0001149 Ga0495642_0001149_11002_11571 189
1069 3300046530 Ga0495654_0002962 Ga0495654_0002962_7950_8537 189
1070 3300046530 Ga0495654_0003190 Ga0495654_0003190_9275_9862 189
1071 3300046530 Ga0495654_0004163 Ga0495654_0004163_3154_3723 189
1072 3300046530 Ga0495654_0010317 Ga0495654_0010317_2427_2996 189
1073 3300046530 Ga0495654_0012918 Ga0495654_0012918_515_1084 189
1074 3300046530 Ga0495654_0019426 Ga0495654_0019426_1950_2519 189
1075 3300046530 Ga0495654_0024355 Ga0495654_0024355_1127_1696 189
1076 3300046530 Ga0495654_0026202 Ga0495654_0026202_1764_2333 189
1077 3300046530 Ga0495654_0037029 Ga0495654_0037029_1563_2132 189
1078 3300046530 Ga0495654_0060094 Ga0495654_0060094_684_1253 189
1079 3300046530 Ga0495654_0064933 Ga0495654_0064933_635_1204 189
1080 3300046530 Ga0495654_0071347 Ga0495654_0071347_188_757 189
1081 3300046530 Ga0495654_0071765 Ga0495654_0071765_518_1087 189
1082 3300046530 Ga0495654_0078122 Ga0495654_0078122_425_994 189
1083 3300046530 Ga0495654_0290121 Ga0495654_0290121_51_620 189
1084 3300046535 Ga0495586_0040896 Ga0495586_0040896_609_1178 189
1085 3300046536 Ga0495587_0005497 Ga0495587_0005497_15_584 189
1086 3300046536 Ga0495587_0084211 Ga0495587_0084211_162_731 189
1087 3300046536 Ga0495587_0089703 Ga0495587_0089703_1193_1762 189
1088 3300046538 Ga0495609_0000283 Ga0495609_0000283_14873_15460 189
1089 3300046538 Ga0495609_0005158 Ga0495609_0005158_2900_3469 189
1090 3300046538 Ga0495609_0024670 Ga0495609_0024670_1506_2075 189
1091 3300046538 Ga0495609_0039423 Ga0495609_0039423_1430_1999 189
1092 3300046538 Ga0495609_0044094 Ga0495609_0044094_716_1285 189
1093 3300046538 Ga0495609_0100648 Ga0495609_0100648_94_663 189
1094 3300046542 Ga0495597_0008603 Ga0495597_0008603_2097_2666 189
1095 3300046542 Ga0495597_0023962 Ga0495597_0023962_1423_1992 189
1096 3300046542 Ga0495597_0032667 Ga0495597_0032667_1039_1608 189
1097 3300046542 Ga0495597_0034104 Ga0495597_0034104_1656_2249 189
1098 3300046542 Ga0495597_0040652 Ga0495597_0040652_1420_1989 189
1099 3300046542 Ga0495597_0044277 Ga0495597_0044277_852_1421 189
1100 3300046542 Ga0495597_0064245 Ga0495597_0064245_70_639 189
1101 3300046542 Ga0495597_0065840 Ga0495597_0065840_88_657 189
1102 3300046542 Ga0495597_0260937 Ga0495597_0260937_90_659 189
1103 3300046543 Ga0495645_0122563 Ga0495645_0122563_28_597 189
1104 3300046543 Ga0495645_0122675 Ga0495645_0122675_89_673 189
1105 3300046557 Ga0495622_0004078 Ga0495622_0004078_3213_3782 189
1106 3300046557 Ga0495622_0005065 Ga0495622_0005065_5159_5746 189
1107 3300046557 Ga0495622_0005369 Ga0495622_0005369_3938_4507 189
1108 3300046557 Ga0495622_0017563 Ga0495622_0017563_1385_1954 189
1109 3300046557 Ga0495622_0020920 Ga0495622_0020920_998_1567 189
1110 3300046557 Ga0495622_0037454 Ga0495622_0037454_963_1532 189
1111 3300046557 Ga0495622_0122763 Ga0495622_0122763_576_1145 189
1112 3300046558 Ga0495633_0042419 Ga0495633_0042419_162_731 189
1113 3300046558 Ga0495633_0155308 Ga0495633_0155308_385_954 189
1114 3300046558 Ga0495633_0180790 Ga0495633_0180790_170_739 189
1115 3300046615 Ga0495656_0002913 Ga0495656_0002913_3431_4000 189
1116 3300046616 Ga0495668_0004933 Ga0495668_0004933_611_1180 189
1117 3300046616 Ga0495668_0018947 Ga0495668_0018947_3238_3822 189
1118 3300046616 Ga0495668_0039437 Ga0495668_0039437_1009_1596 189
1119 3300046616 Ga0495668_0040031 Ga0495668_0040031_160_729 189
1120 3300046616 Ga0495668_0060650 Ga0495668_0060650_63_632 189
1121 3300046616 Ga0495668_0441984 Ga0495668_0441984_63_632 189
1122 3300046642 Ga0495634_0021303 Ga0495634_0021303_554_1123 189
1123 3300046642 Ga0495634_0068730 Ga0495634_0068730_735_1304 189
1124 3300046648 Ga0495611_0001128 Ga0495611_0001128_13122_13709 189
1125 3300046648 Ga0495611_0001569 Ga0495611_0001569_1481_2050 189
1126 3300046648 Ga0495611_0010313 Ga0495611_0010313_1312_1899 189
1127 3300046648 Ga0495611_0060026 Ga0495611_0060026_875_1444 189
1128 3300046648 Ga0495611_0082430 Ga0495611_0082430_857_1426 189
1129 3300046660 Ga0495625_0000086 Ga0495625_0000086_36094_36681 189
1130 3300046660 Ga0495625_0010751 Ga0495625_0010751_3487_4056 189
1131 3300046660 Ga0495625_0035194 Ga0495625_0035194_580_1149 189
1132 3300046660 Ga0495625_0048039 Ga0495625_0048039_1373_1942 189
1133 3300046660 Ga0495625_0048220 Ga0495625_0048220_1194_1763 189
1134 3300046660 Ga0495625_0088525 Ga0495625_0088525_1475_2044 189
1135 3300046660 Ga0495625_0266700 Ga0495625_0266700_500_1069 189
1136 3300046660 Ga0495625_0397651 Ga0495625_0397651_24_593 189
1137 3300046660 Ga0495625_0476882 Ga0495625_0476882_100_669 189
1138 3300046663 Ga0495635_0037544 Ga0495635_0037544_1389_1958 189
1139 3300046663 Ga0495635_0079104 Ga0495635_0079104_1033_1602 189
1140 3300046664 Ga0495659_0009273 Ga0495659_0009273_1450_2019 189
1141 3300046664 Ga0495659_0018107 Ga0495659_0018107_1179_1748 189
1142 3300046664 Ga0495659_0035310 Ga0495659_0035310_782_1351 189
1143 3300046664 Ga0495659_0035603 Ga0495659_0035603_821_1390 189
1144 3300046665 Ga0495661_0000212 Ga0495661_0000212_33280_33867 189
1145 3300046665 Ga0495661_0002096 Ga0495661_0002096_10742_11311 189
1146 3300046665 Ga0495661_0012008 Ga0495661_0012008_1461_2030 189
1147 3300046665 Ga0495661_0024608 Ga0495661_0024608_180_749 189
1148 3300046665 Ga0495661_0033288 Ga0495661_0033288_1449_2018 189
1149 3300046665 Ga0495661_0060089 Ga0495661_0060089_1489_2076 189
1150 3300046665 Ga0495661_0123447 Ga0495661_0123447_63_632 189
1151 3300046665 Ga0495661_0133370 Ga0495661_0133370_679_1248 189
1152 3300046665 Ga0495661_0202470 Ga0495661_0202470_393_962 189
1153 3300046665 Ga0495661_0235281 Ga0495661_0235281_19_588 189
1154 3300046674 Ga0495588_0053519 Ga0495588_0053519_932_1501 189
1155 3300046674 Ga0495588_0101058 Ga0495588_0101058_82_651 189
1156 3300046674 Ga0495588_0128232 Ga0495588_0128232_669_1238 189
1157 3300046679 Ga0495623_0049321 Ga0495623_0049321_859_1428 189
1158 3300046679 Ga0495623_0093101 Ga0495623_0093101_370_939 189
1159 3300046680 Ga0495646_0029139 Ga0495646_0029139_1943_2512 189
1160 3300046680 Ga0495646_0061964 Ga0495646_0061964_503_1072 189
1161 3300046684 Ga0495669_0041772 Ga0495669_0041772_1123_1692 189
1162 3300046684 Ga0495669_0050527 Ga0495669_0050527_926_1495 189
1163 3300046689 Ga0495613_0073876 Ga0495613_0073876_665_1234 189
1164 3300046690 Ga0495624_0003018 Ga0495624_0003018_10602_11171 189
1165 3300046691 Ga0495670_0005198 Ga0495670_0005198_226_795 189
1166 3300046691 Ga0495670_0005874 Ga0495670_0005874_1490_2059 189
1167 3300046691 Ga0495670_0024764 Ga0495670_0024764_911_1480 189
1168 3300046691 Ga0495670_0035369 Ga0495670_0035369_636_1205 189
1169 3300046691 Ga0495670_0053988 Ga0495670_0053988_439_1008 189
1170 3300046691 Ga0495670_0072854 Ga0495670_0072854_751_1320 189
1171 3300046691 Ga0495670_0147805 Ga0495670_0147805_85_654 189
1172 3300046691 Ga0495670_0349687 Ga0495670_0349687_138_707 189
1173 3300046692 Ga0495671_0004628 Ga0495671_0004628_3954_4523 189
1174 3300046692 Ga0495671_0008562 Ga0495671_0008562_1332_1901 189
1175 3300046692 Ga0495671_0009715 Ga0495671_0009715_612_1181 189
1176 3300046692 Ga0495671_0017612 Ga0495671_0017612_81_668 189
1177 3300046692 Ga0495671_0028763 Ga0495671_0028763_838_1407 189
1178 3300046692 Ga0495671_0046843 Ga0495671_0046843_139_708 189
1179 3300046692 Ga0495671_0071470 Ga0495671_0071470_659_1228 189
1180 3300046692 Ga0495671_0139049 Ga0495671_0139049_604_1173 189
1181 3300046692 Ga0495671_0161808 Ga0495671_0161808_301_888 189
1182 3300046692 Ga0495671_0167791 Ga0495671_0167791_363_932 189
1183 3300046692 Ga0495671_0199090 Ga0495671_0199090_343_930 189
1184 3300046694 Ga0495649_0001824 Ga0495649_0001824_1698_2267 189
1185 3300046694 Ga0495649_0012385 Ga0495649_0012385_3661_4230 189
1186 3300046694 Ga0495649_0025151 Ga0495649_0025151_942_1511 189
1187 3300046694 Ga0495649_0034059 Ga0495649_0034059_1430_1999 189
1188 3300046694 Ga0495649_0045464 Ga0495649_0045464_1328_1897 189
1189 3300046694 Ga0495649_0051404 Ga0495649_0051404_611_1180 189
1190 3300046694 Ga0495649_0115894 Ga0495649_0115894_87_656 189
1191 3300046694 Ga0495649_0164004 Ga0495649_0164004_301_870 189
1192 3300046694 Ga0495649_0195920 Ga0495649_0195920_90_659 189
1193 3300046694 Ga0495649_0271588 Ga0495649_0271588_63_632 189
1194 3300046794 Ga0495589_0000918 Ga0495589_0000918_4603_5172 189
1195 3300046794 Ga0495589_0002071 Ga0495589_0002071_2389_2958 189
1196 3300046794 Ga0495589_0006815 Ga0495589_0006815_1475_2044 189
1197 3300046794 Ga0495589_0022499 Ga0495589_0022499_1664_2233 189
1198 3300046794 Ga0495589_0033703 Ga0495589_0033703_80_649 189
1199 3300046794 Ga0495589_0044617 Ga0495589_0044617_1359_1928 189
1200 3300046794 Ga0495589_0057899 Ga0495589_0057899_1307_1876 189
1201 3300046794 Ga0495589_0061486 Ga0495589_0061486_24_593 189
1202 3300046794 Ga0495589_0080630 Ga0495589_0080630_240_809 189
1203 3300046794 Ga0495589_0120311 Ga0495589_0120311_566_1135 189
1204 3300046794 Ga0495589_0375673 Ga0495589_0375673_19_588 189
1205 3300046809 Ga0495600_0008491 Ga0495600_0008491_3482_4051 189
1206 3300046809 Ga0495600_0087221 Ga0495600_0087221_321_890 189
1207 3300046810 Ga0495660_0006218 Ga0495660_0006218_399_986 189
1208 3300046810 Ga0495660_0021679 Ga0495660_0021679_1774_2361 189
1209 3300046810 Ga0495660_0030938 Ga0495660_0030938_2381_2950 189
1210 3300046810 Ga0495660_0040453 Ga0495660_0040453_1428_1997 189
1211 3300046810 Ga0495660_0042889 Ga0495660_0042889_1511_2080 189
1212 3300046810 Ga0495660_0059804 Ga0495660_0059804_38_607 189
1213 3300046810 Ga0495660_0098098 Ga0495660_0098098_583_1152 189
1214 3300046810 Ga0495660_0104511 Ga0495660_0104511_753_1322 189
1215 3300046810 Ga0495660_0110063 Ga0495660_0110063_812_1381 189
1216 3300046810 Ga0495660_0129146 Ga0495660_0129146_680_1249 189
1217 3300046810 Ga0495660_0145547 Ga0495660_0145547_73_642 189
1218 3300046810 Ga0495660_0157528 Ga0495660_0157528_470_1039 189
1219 3300046810 Ga0495660_0166767 Ga0495660_0166767_475_1044 189
1220 3300046810 Ga0495660_0331907 Ga0495660_0331907_63_632 189
1221 3300047315 Ga0495581_0031064 Ga0495581_0031064_1299_1868 189
1222 3300047315 Ga0495581_0042878 Ga0495581_0042878_832_1401 189
1223 3300047317 Ga0495604_0052891 Ga0495604_0052891_1134_1703 189
1224 3300047317 Ga0495604_0260585 Ga0495604_0260585_466_1035 189
1225 3300047318 Ga0495636_0025266 Ga0495636_0025266_144_713 189
1226 3300047318 Ga0495636_0035699 Ga0495636_0035699_851_1420 189
1227 3300047318 Ga0495636_0348878 Ga0495636_0348878_56_625 189
1228 3300047319 Ga0495674_0306087 Ga0495674_0306087_624_1193 189
1229 3300047319 Ga0495674_0487922 Ga0495674_0487922_11_580 189
1230 3300047320 Ga0495672_0004360 Ga0495672_0004360_10431_11000 189
1231 3300047320 Ga0495672_0006960 Ga0495672_0006960_4399_4968 189
1232 3300047320 Ga0495672_0011630 Ga0495672_0011630_1732_2301 189
1233 3300047320 Ga0495672_0012419 Ga0495672_0012419_1483_2052 189
1234 3300047320 Ga0495672_0013235 Ga0495672_0013235_4193_4762 189
1235 3300047320 Ga0495672_0019239 Ga0495672_0019239_603_1172 189
1236 3300047320 Ga0495672_0025428 Ga0495672_0025428_1226_1813 189
1237 3300047320 Ga0495672_0041790 Ga0495672_0041790_789_1358 189
1238 3300047320 Ga0495672_0051736 Ga0495672_0051736_1227_1796 189
1239 3300047320 Ga0495672_0064337 Ga0495672_0064337_560_1129 189
1240 3300047320 Ga0495672_0064492 Ga0495672_0064492_274_843 189
1241 3300047320 Ga0495672_0149300 Ga0495672_0149300_550_1119 189
1242 3300047320 Ga0495672_0275310 Ga0495672_0275310_211_780 189
1243 3300047321 Ga0495676_0000022 Ga0495676_0000022_35942_36529 189
1244 3300047321 Ga0495676_0035049 Ga0495676_0035049_3496_4065 189
1245 3300047322 Ga0495680_0002433 Ga0495680_0002433_3482_4051 189
1246 3300047322 Ga0495680_0081021 Ga0495680_0081021_1280_1849 189
1247 3300047323 Ga0495683_0008727 Ga0495683_0008727_3987_4556 189
1248 3300047323 Ga0495683_0021732 Ga0495683_0021732_1281_1850 189
1249 3300047323 Ga0495683_0042215 Ga0495683_0042215_437_1006 189
1250 3300047323 Ga0495683_0053073 Ga0495683_0053073_634_1203 189
1251 3300047323 Ga0495683_0062707 Ga0495683_0062707_352_921 189
1252 3300047323 Ga0495683_0069908 Ga0495683_0069908_550_1119 189
1253 3300047323 Ga0495683_0091978 Ga0495683_0091978_804_1373 189
1254 3300047323 Ga0495683_0094419 Ga0495683_0094419_452_1039 189
1255 3300047323 Ga0495683_0168935 Ga0495683_0168935_302_871 189
1256 3300047443 Ga0495687_009721 Ga0495687_009721_1004_1573 189
1257 3300047443 Ga0495687_019318 Ga0495687_019318_1383_1952 189
1258 3300047443 Ga0495687_025117 Ga0495687_025117_920_1489 189
1259 3300047443 Ga0495687_044644 Ga0495687_044644_569_1138 189
1260 3300047443 Ga0495687_194818 Ga0495687_194818_13_582 189
1261 3300047444 Ga0495675_0016907 Ga0495675_0016907_3576_4145 189
1262 3300047444 Ga0495675_0021298 Ga0495675_0021298_3025_3594 189
1263 3300047444 Ga0495675_0372864 Ga0495675_0372864_147_716 189
1264 3300047446 Ga0495679_000212 Ga0495679_000212_28966_29553 189
1265 3300047446 Ga0495679_012307 Ga0495679_012307_2004_2573 189
1266 3300047446 Ga0495679_012746 Ga0495679_012746_1236_1805 189
1267 3300047446 Ga0495679_023886 Ga0495679_023886_1426_1995 189
1268 3300047446 Ga0495679_062538 Ga0495679_062538_448_1017 189
1269 3300047447 Ga0495685_028743 Ga0495685_028743_683_1252 189
1270 3300047447 Ga0495685_119629 Ga0495685_119629_27_596 189
1271 3300047447 Ga0495685_166686 Ga0495685_166686_24_593 189
1272 3300047469 Ga0495673_0001296 Ga0495673_0001296_8412_8999 189
1273 3300047469 Ga0495673_0001363 Ga0495673_0001363_17568_18155 189
1274 3300047469 Ga0495673_0005218 Ga0495673_0005218_1507_2076 189
1275 3300047469 Ga0495673_0006168 Ga0495673_0006168_5028_5597 189
1276 3300047469 Ga0495673_0007676 Ga0495673_0007676_1449_2018 189
1277 3300047469 Ga0495673_0009710 Ga0495673_0009710_3319_3888 189
1278 3300047469 Ga0495673_0015501 Ga0495673_0015501_1131_1715 189
1279 3300047469 Ga0495673_0016199 Ga0495673_0016199_1795_2382 189
1280 3300047469 Ga0495673_0023716 Ga0495673_0023716_902_1471 189
1281 3300047469 Ga0495673_0025879 Ga0495673_0025879_1494_2063 189
1282 3300047469 Ga0495673_0039192 Ga0495673_0039192_1483_2052 189
1283 3300047469 Ga0495673_0039341 Ga0495673_0039341_1486_2055 189
1284 3300047469 Ga0495673_0064280 Ga0495673_0064280_648_1235 189
1285 3300047469 Ga0495673_0065871 Ga0495673_0065871_774_1343 189
1286 3300047469 Ga0495673_0069533 Ga0495673_0069533_498_1067 189
1287 3300047469 Ga0495673_0074219 Ga0495673_0074219_258_827 189
1288 3300047469 Ga0495673_0095519 Ga0495673_0095519_619_1188 189
1289 3300047469 Ga0495673_0119406 Ga0495673_0119406_38_607 189
1290 3300047469 Ga0495673_0132848 Ga0495673_0132848_138_707 189
1291 3300047469 Ga0495673_0218389 Ga0495673_0218389_38_607 189
1292 3300047469 Ga0495673_0231373 Ga0495673_0231373_27_596 189
1293 3300047470 Ga0495681_0002383 Ga0495681_0002383_8371_8958 189
1294 3300047470 Ga0495681_0008341 Ga0495681_0008341_4599_5168 189
1295 3300047470 Ga0495681_0009563 Ga0495681_0009563_1482_2051 189
1296 3300047470 Ga0495681_0010666 Ga0495681_0010666_3810_4379 189
1297 3300047470 Ga0495681_0014598 Ga0495681_0014598_3330_3899 189
1298 3300047470 Ga0495681_0016197 Ga0495681_0016197_69_638 189
1299 3300047470 Ga0495681_0020738 Ga0495681_0020738_1475_2044 189
1300 3300047470 Ga0495681_0024255 Ga0495681_0024255_1197_1766 189
1301 3300047470 Ga0495681_0042141 Ga0495681_0042141_169_738 189
1302 3300047470 Ga0495681_0046313 Ga0495681_0046313_1488_2057 189
1303 3300047470 Ga0495681_0054417 Ga0495681_0054417_1283_1852 189
1304 3300047470 Ga0495681_0070798 Ga0495681_0070798_583_1152 189
1305 3300047470 Ga0495681_0079109 Ga0495681_0079109_86_655 189
1306 3300047471 Ga0495684_0080277 Ga0495684_0080277_221_790 189
1307 3300047472 Ga0495686_0024531 Ga0495686_0024531_3329_3898 189
1308 3300047472 Ga0495686_0043750 Ga0495686_0043750_1317_1886 189
1309 3300047472 Ga0495686_0095852 Ga0495686_0095852_1187_1756 189
1310 3300047472 Ga0495686_0099678 Ga0495686_0099678_1122_1691 189
1311 3300047472 Ga0495686_0101601 Ga0495686_0101601_940_1509 189
1312 3300047472 Ga0495686_0172162 Ga0495686_0172162_562_1131 189
1313 3300047673 Ga0495593_0066199 Ga0495593_0066199_658_1227 189
1314 3300047673 Ga0495593_0110035 Ga0495593_0110035_70_639 189
1315 3300048089 Ga0495614_0377631 Ga0495614_0377631_49_618 189
1316 3300048091 Ga0495626_0000039 Ga0495626_0000039_126563_127150 189
1317 3300048091 Ga0495626_0000242 Ga0495626_0000242_3419_3988 189
1318 3300048091 Ga0495626_0001832 Ga0495626_0001832_1481_2050 189
1319 3300048091 Ga0495626_0003249 Ga0495626_0003249_8585_9154 189
1320 3300048091 Ga0495626_0007397 Ga0495626_0007397_2199_2768 189
1321 3300048091 Ga0495626_0007505 Ga0495626_0007505_3990_4559 189
1322 3300048091 Ga0495626_0008286 Ga0495626_0008286_3672_4241 189
1323 3300048091 Ga0495626_0019780 Ga0495626_0019780_2765_3334 189
1324 3300048091 Ga0495626_0028016 Ga0495626_0028016_1229_1798 189
1325 3300048091 Ga0495626_0035168 Ga0495626_0035168_1751_2320 189
1326 3300048091 Ga0495626_0042266 Ga0495626_0042266_101_670 189
1327 3300048091 Ga0495626_0137415 Ga0495626_0137415_441_1010 189
1328 3300048905 Ga0496102_0002921 Ga0496102_0002921_13354_13923 189
1329 3300048905 Ga0496102_0198028 Ga0496102_0198028_1131_1700 189
1330 3300048905 Ga0496102_0403979 Ga0496102_0403979_627_1196 189
1331 3300048905 Ga0496102_0784596 Ga0496102_0784596_268_852 189
1332 3300048906 Ga0496103_0042627 Ga0496103_0042627_261_830 189
1333 3300048908 Ga0496105_0496967 Ga0496105_0496967_196_765 189
1334 3300048909 Ga0496106_0555718 Ga0496106_0555718_244_813 189
1335 3300048910 Ga0496107_0462916 Ga0496107_0462916_249_818 189
1336 3300048913 Ga0496110_0069439 Ga0496110_0069439_1327_1911 189
1337 3300048913 Ga0496110_0222777 Ga0496110_0222777_79_648 189
1338 3300048913 Ga0496110_0282651 Ga0496110_0282651_854_1423 189
1339 3300048914 Ga0496111_0180093 Ga0496111_0180093_277_861 189
1340 3300048915 Ga0496112_0284582 Ga0496112_0284582_219_788 189
1341 3300048919 Ga0496116_0000881 Ga0496116_0000881_14405_14974 189
1342 3300048919 Ga0496116_0004892 Ga0496116_0004892_4515_5084 189
1343 3300048919 Ga0496116_0007271 Ga0496116_0007271_771_1340 189
1344 3300048919 Ga0496116_0065054 Ga0496116_0065054_760_1329 189
1345 3300048919 Ga0496116_0074269 Ga0496116_0074269_79_648 189
1346 3300048919 Ga0496116_0153232 Ga0496116_0153232_668_1237 189
1347 3300048920 Ga0496117_0002861 Ga0496117_0002861_14405_14974 189
1348 3300048920 Ga0496117_0007359 Ga0496117_0007359_9107_9676 189
1349 3300048920 Ga0496117_0021194 Ga0496117_0021194_1303_1872 189
1350 3300048920 Ga0496117_0043046 Ga0496117_0043046_1442_2011 189
1351 3300048920 Ga0496117_0048698 Ga0496117_0048698_1938_2507 189
1352 3300048920 Ga0496117_0092372 Ga0496117_0092372_460_1029 189
1353 3300048920 Ga0496117_0105225 Ga0496117_0105225_435_1004 189
1354 3300048920 Ga0496117_0157082 Ga0496117_0157082_699_1268 189
1355 3300048921 Ga0496118_0060606 Ga0496118_0060606_1472_2041 189
1356 3300048921 Ga0496118_0106211 Ga0496118_0106211_1007_1576 189
1357 3300048921 Ga0496118_0119530 Ga0496118_0119530_1073_1642 189
1358 3300048921 Ga0496118_0127206 Ga0496118_0127206_253_822 189
1359 3300048921 Ga0496118_0238739 Ga0496118_0238739_319_888 189
1360 3300048921 Ga0496118_0390528 Ga0496118_0390528_88_657 189
1361 3300048922 Ga0496119_0070401 Ga0496119_0070401_1403_1972 189
1362 3300048922 Ga0496119_0151806 Ga0496119_0151806_640_1209 189
1363 3300048923 Ga0496120_0047984 Ga0496120_0047984_1250_1819 189
1364 3300048923 Ga0496120_0134465 Ga0496120_0134465_17_586 189
1365 3300048924 Ga0496121_0001650 Ga0496121_0001650_14533_15102 189
1366 3300048924 Ga0496121_0002827 Ga0496121_0002827_21526_22095 189
1367 3300048924 Ga0496121_0079525 Ga0496121_0079525_179_748 189
1368 3300048924 Ga0496121_0082253 Ga0496121_0082253_774_1343 189
1369 3300048924 Ga0496121_0106561 Ga0496121_0106561_1520_2089 189
1370 3300048925 Ga0496122_0064257 Ga0496122_0064257_689_1258 189
1371 3300048925 Ga0496122_0096686 Ga0496122_0096686_834_1403 189
1372 3300048925 Ga0496122_0102300 Ga0496122_0102300_76_645 189
1373 3300048925 Ga0496122_0368390 Ga0496122_0368390_100_669 189
1374 3300048926 Ga0496123_0027453 Ga0496123_0027453_71_640 189
1375 3300048926 Ga0496123_0075715 Ga0496123_0075715_47_616 189
1376 3300048926 Ga0496123_0134713 Ga0496123_0134713_99_668 189
1377 3300048927 Ga0496124_0001280 Ga0496124_0001280_34430_34999 189
1378 3300048927 Ga0496124_0024994 Ga0496124_0024994_3452_4021 189
1379 3300048927 Ga0496124_0052583 Ga0496124_0052583_1019_1588 189
1380 3300048927 Ga0496124_0083431 Ga0496124_0083431_974_1543 189
1381 3300048927 Ga0496124_0097120 Ga0496124_0097120_894_1463 189
1382 3300048927 Ga0496124_0200268 Ga0496124_0200268_796_1365 189
1383 3300048927 Ga0496124_0216008 Ga0496124_0216008_779_1363 189
1384 3300048927 Ga0496124_0362166 Ga0496124_0362166_61_630 189
1385 3300048927 Ga0496124_0415880 Ga0496124_0415880_95_664 189
1386 3300048927 Ga0496124_0471936 Ga0496124_0471936_100_669 189
1387 3300048928 Ga0496125_0018486 Ga0496125_0018486_1034_1603 189
1388 3300048928 Ga0496125_0079916 Ga0496125_0079916_733_1302 189
1389 3300048928 Ga0496125_0114168 Ga0496125_0114168_553_1122 189
1390 3300048929 Ga0496126_0081510 Ga0496126_0081510_812_1381 189
1391 3300048929 Ga0496126_0094716 Ga0496126_0094716_703_1272 189
1392 3300048929 Ga0496126_0234829 Ga0496126_0234829_365_934 189
1393 3300049459 Ga0495678_000238 Ga0495678_000238_26988_27575 189
1394 3300049459 Ga0495678_001946 Ga0495678_001946_13029_13598 189
1395 3300049459 Ga0495678_005424 Ga0495678_005424_4324_4911 189
1396 3300049459 Ga0495678_013061 Ga0495678_013061_2076_2645 189
1397 3300049459 Ga0495678_014304 Ga0495678_014304_1891_2460 189
1398 3300049459 Ga0495678_033499 Ga0495678_033499_1478_2047 189
1399 3300049459 Ga0495678_062087 Ga0495678_062087_771_1340 189
1400 3300049459 Ga0495678_063659 Ga0495678_063659_772_1341 189
1401 3300049459 Ga0495678_068234 Ga0495678_068234_72_641 189
1402 3300049459 Ga0495678_074799 Ga0495678_074799_590_1159 189
1403 3300049459 Ga0495678_095533 Ga0495678_095533_78_647 189
1404 3300049459 Ga0495678_100376 Ga0495678_100376_345_914 189
1405 3300049459 Ga0495678_101259 Ga0495678_101259_32_601 189
1406 3300049459 Ga0495678_106429 Ga0495678_106429_370_939 189
1407 3300049460 Ga0495682_0000985 Ga0495682_0000985_6782_7366 189
1408 3300049460 Ga0495682_0017942 Ga0495682_0017942_1362_1931 189
1409 3300049460 Ga0495682_0038130 Ga0495682_0038130_48_617 189
1410 3300049460 Ga0495682_0052173 Ga0495682_0052173_273_842 189
1411 3300049460 Ga0495682_0170872 Ga0495682_0170872_154_723 189
1412 3300049553 Ga0501337_002270 Ga0501337_002270_144_713 189
1413 3300049665 Ga0501227_049773 Ga0501227_049773_435_1004 189
1414 3300049669 Ga0501235_079320 Ga0501235_079320_124_693 189
1415 3300049673 Ga0501240_051827 Ga0501240_051827_79_648 189
1416 3300049758 Ga0501241_001024 Ga0501241_001024_1982_2551 189
1417 3300049766 Ga0501269_003657 Ga0501269_003657_723_1292 189
1418 3300050491 nmdc:mga00v17_352568_c1 nmdc:mga00v17_352568_c1_123_692 189
1419 3300050491 nmdc:mga00v17_392661_c1 nmdc:mga00v17_392661_c1_125_694 189
1420 3300050491 nmdc:mga00v17_702870_c1 nmdc:mga00v17_702870_c1_44_613 189
1421 3300050514 nmdc:mga08x19_302618_c1 nmdc:mga08x19_302618_c1_84_653 189
1422 3300050516 nmdc:mga0sz30_58235_c1 nmdc:mga0sz30_58235_c1_789_1358 189
1423 iso_pu_bacteria 2600255283 2601627253 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08212

Lipocalin_2

Lipocalin-like domain

41

188

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7l5m-assembly1.cif.gz_B crystal structure of the dib-rm-split protein 0.9529 122 180
6vri-assembly1.cif.gz_B crystal structure of the wtblc-split protein 0.9493 122 180
6ubo-assembly1.cif.gz_B fluorogen activating protein dib1 0.9366 27 180
6ukl-assembly3.cif.gz_F crystal structure of a dib2-split protein 0.9362 122 182
3mbt-assembly1.cif.gz_A structure of monomeric blc from e. coli 0.9318 27 180
ID Description Score Start End Superfamily
3mbtA00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.9318 27 180 2.40.128.20
1qwdB00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.926 29 177 2.40.128.20
af_Q38JE7_14_176_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.9211 27 182 2.40.128.20
af_Q55CV8_22_181_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.9185 27 181 2.40.128.20
3mbtA00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.9138 27 180 2.40.128.20
ID Description Score Start End GO Terms
AF-A0A1G7WRD1-F1-model_v4 Outer membrane lipoprotein Blc 0.9784 26 189 GO:0006950
GO:0008289
GO:0009279
AF-A0A4Q5VSE0-F1-model_v4 deleted 0.9682 58 181
AF-A0A1G7WRD1-F1-model_v4 Outer membrane lipoprotein Blc 0.9667 26 189 GO:0006950
GO:0008289
GO:0009279
AF-J3BIM6-F1-model_v4 Lipocalin 0.9547 13 146 GO:0006950
AF-A0A4Q5VSE0-F1-model_v4 deleted 0.9531 58 181

Feature Viewer

pLDDT pTM Quality
83.61 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map