F493599

General Info

Members Datasets Scaffolds Average Seq Length
1392 341 1392 204

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100571397|Ga0070670_1005713971
Length 221
Sequence MHDLGGRQGFGRVRYALNAQVFHEPWERRVNALYSLAVRLGIFNMDEYRHAIERMEPRHYLTASYYERSLTSLATLCVEKGIVTQEELERRAQGAFPIAAPSAPGRPNVPSRQRFAPGDRVKVRNDYVPGHMRMPGYIRGRTGVVVSESPAYPFPDAHAHGVEAADEPTYDVRFRNEDLWPNSSDAALVHVAVFQSYLELEVAAFRPVASDVARFEGRSGG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
188 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
194 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
195 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
196 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
197 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
200 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
201 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
212 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
214 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
216 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
217 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
218 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
219 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
220 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
223 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
224 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
233 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
234 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
235 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
236 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
237 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
238 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
239 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
240 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
241 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
242 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
243 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
244 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
245 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
248 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
249 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
256 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
257 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
258 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
259 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
260 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
261 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
262 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
263 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
264 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
265 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
268 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
269 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
270 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
271 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
272 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
273 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
274 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
275 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
276 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
277 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
278 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
279 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
280 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
281 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
282 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
283 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
284 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
285 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
286 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
287 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
288 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
289 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
290 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
291 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
292 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
293 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
294 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
295 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
296 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
297 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
298 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
299 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
306 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
307 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
308 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
311 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
312 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
313 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
314 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
319 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
320 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
321 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
322 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
323 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
324 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
325 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
326 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
329 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
330 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
331 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
332 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
333 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
334 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
335 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
336 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
337 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
338 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
339 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
340 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
341 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.81
Nodule 0
Rhizoplane 2.51
Rhizosphere 91.88
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10026579 3300005327 Bacteria 4643
2 Ga0070658_10049814 3300005327 Bacteria 3394
3 Ga0070658_10133088 3300005327 Bacteria 2073
4 Ga0070676_10003182 3300005328 Bacteria 8508
5 Ga0070676_10010662 3300005328 Bacteria 4986
6 Ga0070676_10041156 3300005328 Bacteria 2678
7 Ga0070676_10124936 3300005328 Bacteria 1620
8 Ga0070676_10127160 3300005328 Bacteria 1607
9 Ga0070683_100035241 3300005329 Bacteria 4574
10 Ga0070683_100226345 3300005329 Bacteria 1777
11 Ga0070683_100435698 3300005329 Bacteria 1251
12 Ga0070683_100467880 3300005329 Bacteria 1203
13 Ga0070683_100596475 3300005329 Bacteria 1057
14 Ga0070690_100001778 3300005330 Bacteria 11400
15 Ga0070690_100003093 3300005330 Bacteria 9049
16 Ga0070690_100035580 3300005330 Bacteria 3125
17 Ga0070690_100043557 3300005330 Bacteria 2847
18 Ga0070690_100151202 3300005330 Bacteria 1584
19 Ga0070690_100435508 3300005330 Bacteria 969
20 Ga0070670_100002172 3300005331 Bacteria 16114
21 Ga0070670_100008848 3300005331 Bacteria 8595
22 Ga0070670_100036146 3300005331 Bacteria 4251
23 Ga0070670_100071184 3300005331 Bacteria 2985
24 Ga0070670_100093106 3300005331 Bacteria 2592
25 Ga0070670_100144683 3300005331 Bacteria 2056
26 Ga0070670_100227509 3300005331 Bacteria 1623
27 Ga0070670_100231835 3300005331 Bacteria 1607
28 Ga0070670_100476147 3300005331 Bacteria 1108
29 Ga0070670_100571397 3300005331 Bacteria 1010
30 Ga0070677_10000814 3300005333 Bacteria 10317
31 Ga0070677_10026212 3300005333 Bacteria 2183
32 Ga0070677_10061670 3300005333 Bacteria 1548
33 Ga0070677_10193458 3300005333 Bacteria 977
34 Ga0070677_10223186 3300005333 Bacteria 922
35 Ga0068869_100000718 3300005334 Bacteria 18832
36 Ga0068869_100002058 3300005334 Bacteria 12092
37 Ga0068869_100032559 3300005334 Bacteria 3675
38 Ga0068869_100055323 3300005334 Bacteria 2892
39 Ga0068869_100162812 3300005334 Bacteria 1738
40 Ga0068869_100463087 3300005334 Unclassified 1053
41 Ga0068869_100774744 3300005334 Bacteria 823
42 Ga0070666_10001703 3300005335 Bacteria 13412
43 Ga0070666_10005247 3300005335 Bacteria 7938
44 Ga0070666_10025590 3300005335 Bacteria 3848
45 Ga0070666_10099296 3300005335 Bacteria 2005
46 Ga0070666_10120407 3300005335 Bacteria 1820
47 Ga0070666_10351886 3300005335 Bacteria 1054
48 Ga0070680_100008942 3300005336 Bacteria 7679
49 Ga0070680_100039551 3300005336 Plasmid 3816
50 Ga0070682_100054562 3300005337 Bacteria 2508
51 Ga0070682_100770820 3300005337 Unclassified 778
52 Ga0068868_100006642 3300005338 Bacteria 8204
53 Ga0068868_100008658 3300005338 Bacteria 7286
54 Ga0068868_100066024 3300005338 Bacteria 2876
55 Ga0068868_100300109 3300005338 Bacteria 1364
56 Ga0068868_100305766 3300005338 Bacteria 1352
57 Ga0068868_100396024 3300005338 Bacteria 1191
58 Ga0068868_100452159 3300005338 Bacteria 1117
59 Ga0068868_100651852 3300005338 Bacteria 938
60 Ga0070660_100013273 3300005339 Bacteria 5904
61 Ga0070660_100023637 3300005339 Bacteria 4555
62 Ga0070660_100046225 3300005339 Bacteria 3336
63 Ga0070689_100001767 3300005340 Bacteria 13865
64 Ga0070689_100005624 3300005340 Bacteria 8583
65 Ga0070689_100151778 3300005340 Bacteria 1869
66 Ga0070689_100154692 3300005340 Bacteria 1851
67 Ga0070689_100166805 3300005340 Bacteria 1783
68 Ga0070689_100222407 3300005340 Bacteria 1549
69 Ga0070689_100237983 3300005340 Bacteria 1499
70 Ga0070687_100033961 3300005343 Bacteria 2522
71 Ga0070687_100057827 3300005343 Bacteria 2035
72 Ga0070687_100084953 3300005343 Bacteria 1736
73 Ga0070661_100031619 3300005344 Bacteria 3828
74 Ga0070661_100043639 3300005344 Bacteria 3275
75 Ga0070661_100235112 3300005344 Bacteria 1409
76 Ga0070661_100469023 3300005344 Bacteria 1004
77 Ga0070692_10008842 3300005345 Bacteria 4511
78 Ga0070692_10074424 3300005345 Bacteria 1817
79 Ga0070668_100017219 3300005347 Bacteria 5409
80 Ga0070668_100022440 3300005347 Bacteria 4772
81 Ga0070668_100038788 3300005347 Bacteria 3643
82 Ga0070668_100061317 3300005347 Bacteria 2913
83 Ga0070668_100128183 3300005347 Bacteria 2034
84 Ga0070668_100144423 3300005347 Bacteria 1920
85 Ga0070668_100207112 3300005347 Bacteria 1612
86 Ga0070669_100001820 3300005353 Bacteria 15349
87 Ga0070669_100005048 3300005353 Bacteria 9539
88 Ga0070669_100016690 3300005353 Bacteria 5241
89 Ga0070669_100031009 3300005353 Bacteria 3860
90 Ga0070669_100098851 3300005353 Bacteria 2199
91 Ga0070669_100105977 3300005353 Bacteria 2127
92 Ga0070669_100176716 3300005353 Bacteria 1668
93 Ga0070675_100000052 3300005354 Bacteria 71092
94 Ga0070675_100004275 3300005354 Bacteria 10873
95 Ga0070675_100004647 3300005354 Bacteria 10488
96 Ga0070675_100004941 3300005354 Bacteria 10169
97 Ga0070675_100026770 3300005354 Bacteria 4627
98 Ga0070675_100027411 3300005354 Bacteria 4576
99 Ga0070675_100187478 3300005354 Bacteria 1791
100 Ga0070675_100261480 3300005354 Bacteria 1517
101 Ga0070675_100793101 3300005354 Bacteria 866
102 Ga0070671_100005537 3300005355 Bacteria 10060
103 Ga0070671_100010020 3300005355 Bacteria 7610
104 Ga0070671_100012493 3300005355 Bacteria 6838
105 Ga0070671_100016646 3300005355 Bacteria 5943
106 Ga0070671_100071216 3300005355 Bacteria 2901
107 Ga0070671_100079418 3300005355 Bacteria 2742
108 Ga0070671_100220525 3300005355 Bacteria 1609
109 Ga0070671_100329902 3300005355 Bacteria 1300
110 Ga0070671_100368004 3300005355 Bacteria 1228
111 Ga0070671_100472643 3300005355 Unclassified 1077
112 Ga0070674_100005400 3300005356 Bacteria 7377
113 Ga0070674_100016918 3300005356 Bacteria 4576
114 Ga0070674_100038652 3300005356 Bacteria 3218
115 Ga0070674_100047460 3300005356 Bacteria 2943
116 Ga0070674_100061148 3300005356 Bacteria 2628
117 Ga0070674_100083679 3300005356 Bacteria 2286
118 Ga0070674_100101002 3300005356 Bacteria 2101
119 Ga0070674_100234545 3300005356 Bacteria 1434
120 Ga0070673_100000303 3300005364 Bacteria 25790
121 Ga0070673_100019920 3300005364 Bacteria 4828
122 Ga0070673_100023699 3300005364 Bacteria 4488
123 Ga0070673_100027600 3300005364 Bacteria 4210
124 Ga0070673_100077006 3300005364 Bacteria 2695
125 Ga0070673_100104626 3300005364 Bacteria 2337
126 Ga0070673_100117927 3300005364 Bacteria 2210
127 Ga0070673_100226514 3300005364 Bacteria 1620
128 Ga0070673_100355580 3300005364 Bacteria 1301
129 Ga0070673_100413039 3300005364 Bacteria 1209
130 Ga0070673_100436084 3300005364 Bacteria 1177
131 Ga0070673_100889032 3300005364 Bacteria 826
132 Ga0070688_100007711 3300005365 Bacteria 5812
133 Ga0070688_100114923 3300005365 Bacteria 1795
134 Ga0070688_100206228 3300005365 Bacteria 1378
135 Ga0070688_100267689 3300005365 Bacteria 1223
136 Ga0070688_100382589 3300005365 Bacteria 1038
137 Ga0070659_100026061 3300005366 Bacteria 4496
138 Ga0070659_100291724 3300005366 Bacteria 1358
139 Ga0070659_100326417 3300005366 Bacteria 1283
140 Ga0070659_100336001 3300005366 Unclassified 1265
141 Ga0070659_100407900 3300005366 Bacteria 1148
142 Ga0070659_100534320 3300005366 Bacteria 1002
143 Ga0070667_100001254 3300005367 Bacteria 23021
144 Ga0070667_100015480 3300005367 Bacteria 6307
145 Ga0070667_100045960 3300005367 Bacteria 3672
146 Ga0070667_100065157 3300005367 Bacteria 3093
147 Ga0070667_100115430 3300005367 Bacteria 2332
148 Ga0070667_100161722 3300005367 Bacteria 1972
149 Ga0070667_100274956 3300005367 Bacteria 1511
150 Ga0070667_100322139 3300005367 Bacteria 1395
151 Ga0070709_10023596 3300005434 Bacteria 3615
152 Ga0070709_10857996 3300005434 Unclassified 716
153 Ga0070714_100021890 3300005435 Bacteria 5234
154 Ga0070714_100163557 3300005435 Bacteria 2015
155 Ga0070714_100219001 3300005435 Bacteria 1749
156 Ga0070713_100003830 3300005436 Bacteria 9963
157 Ga0070713_100047855 3300005436 Bacteria 3517
158 Ga0070713_100135490 3300005436 Bacteria 2176
159 Ga0070710_10024419 3300005437 Bacteria 3189
160 Ga0070701_10033773 3300005438 Bacteria 2558
161 Ga0070701_10311422 3300005438 Bacteria 971
162 Ga0070711_100008755 3300005439 Bacteria 6210
163 Ga0070711_100224729 3300005439 Bacteria 1461
164 Ga0070711_100786928 3300005439 Bacteria 806
165 Ga0070705_100009497 3300005440 Bacteria 4838
166 Ga0070705_100046226 3300005440 Bacteria 2509
167 Ga0070700_100034984 3300005441 Bacteria 3036
168 Ga0070700_100038590 3300005441 Bacteria 2912
169 Ga0070700_100102425 3300005441 Bacteria 1889
170 Ga0070694_100375254 3300005444 Bacteria 1108
171 Ga0070708_100022225 3300005445 Bacteria 5377
172 Ga0070663_100022766 3300005455 Bacteria 4193
173 Ga0070663_100042894 3300005455 Bacteria 3181
174 Ga0070663_100093451 3300005455 Bacteria 2232
175 Ga0070663_100265449 3300005455 Bacteria 1363
176 Ga0070678_100000797 3300005456 Bacteria 15850
177 Ga0070678_100003598 3300005456 Bacteria 8647
178 Ga0070678_100006120 3300005456 Bacteria 7025
179 Ga0070678_100015721 3300005456 Bacteria 4817
180 Ga0070678_100025386 3300005456 Plasmid 3986
181 Ga0070678_100035836 3300005456 Bacteria 3468
182 Ga0070678_100111427 3300005456 Bacteria 2141
183 Ga0070678_100252464 3300005456 Bacteria 1479
184 Ga0070678_100515891 3300005456 Bacteria 1057
185 Ga0070662_100001774 3300005457 Bacteria 13279
186 Ga0070662_100043586 3300005457 Unclassified 3211
187 Ga0070662_100047108 3300005457 Bacteria 3099
188 Ga0070662_100051111 3300005457 Bacteria 2984
189 Ga0070662_100091439 3300005457 Bacteria 2285
190 Ga0070662_100366244 3300005457 Bacteria 1184
191 Ga0070662_100449161 3300005457 Bacteria 1070
192 Ga0070681_10105138 3300005458 Bacteria 2765
193 Ga0070681_10271800 3300005458 Bacteria 1606
194 Ga0070681_10606637 3300005458 Bacteria 1009
195 Ga0068867_100000902 3300005459 Bacteria 20146
196 Ga0068867_100003876 3300005459 Bacteria 10527
197 Ga0068867_100007205 3300005459 Bacteria 7862
198 Ga0068867_100008834 3300005459 Bacteria 7111
199 Ga0068867_100018663 3300005459 Bacteria 4931
200 Ga0068867_100041892 3300005459 Bacteria 3346
201 Ga0068867_100054591 3300005459 Bacteria 2951
202 Ga0068867_100075518 3300005459 Bacteria 2528
203 Ga0068867_100102610 3300005459 Bacteria 2187
204 Ga0068867_100264724 3300005459 Bacteria 1403
205 Ga0068867_100267203 3300005459 Bacteria 1397
206 Ga0068867_100495152 3300005459 Bacteria 1050
207 Ga0068867_100946931 3300005459 Bacteria 778
208 Ga0070685_10008871 3300005466 Bacteria 5185
209 Ga0070685_10125960 3300005466 Bacteria 1596
210 Ga0070707_100012864 3300005468 Bacteria 7815
211 Ga0070698_100571059 3300005471 Unclassified 1071
212 Ga0070699_100035398 3300005518 Bacteria 4316
213 Ga0070679_100043068 3300005530 Bacteria 4497
214 Ga0070679_100138104 3300005530 Bacteria 2418
215 Ga0070679_100666073 3300005530 Bacteria 983
216 Ga0070684_100113721 3300005535 Bacteria 2429
217 Ga0070684_100221409 3300005535 Bacteria 1726
218 Ga0070684_100278719 3300005535 Bacteria 1532
219 Ga0070684_100860737 3300005535 Bacteria 848
220 Ga0070697_100020195 3300005536 Bacteria 5267
221 Ga0068853_100073348 3300005539 Bacteria 2984
222 Ga0068853_100322628 3300005539 Unclassified 1432
223 Ga0068853_100750297 3300005539 Bacteria 933
224 Ga0070672_100000118 3300005543 Bacteria 40531
225 Ga0070672_100000798 3300005543 Bacteria 18769
226 Ga0070672_100006960 3300005543 Bacteria 7649
227 Ga0070672_100008668 3300005543 Bacteria 6972
228 Ga0070672_100021523 3300005543 Bacteria 4721
229 Ga0070672_100027855 3300005543 Bacteria 4219
230 Ga0070672_100028576 3300005543 Bacteria 4173
231 Ga0070672_100066652 3300005543 Bacteria 2851
232 Ga0070672_100120747 3300005543 Bacteria 2145
233 Ga0070672_100200808 3300005543 Bacteria 1667
234 Ga0070672_100259354 3300005543 Bacteria 1465
235 Ga0070672_100521499 3300005543 Bacteria 1029
236 Ga0070672_100906558 3300005543 Bacteria 779
237 Ga0070686_100003723 3300005544 Bacteria 8380
238 Ga0070686_100097745 3300005544 Bacteria 1977
239 Ga0070686_100338564 3300005544 Unclassified 1127
240 Ga0070695_100063890 3300005545 Bacteria 2394
241 Ga0070695_100867496 3300005545 Bacteria 727
242 Ga0070696_100031832 3300005546 Bacteria 3617
243 Ga0070696_100031923 3300005546 Bacteria 3611
244 Ga0070693_100010214 3300005547 Bacteria 4696
245 Ga0070693_100021652 3300005547 Bacteria 3407
246 Ga0070693_100113498 3300005547 Bacteria 1670
247 Ga0070665_100019248 3300005548 Bacteria 6849
248 Ga0070665_100267280 3300005548 Bacteria 1711
249 Ga0070665_100383750 3300005548 Bacteria 1412
250 Ga0070665_100765123 3300005548 Bacteria 979
251 Ga0070665_100903397 3300005548 Unclassified 896
252 Ga0070704_100091698 3300005549 Bacteria 2266
253 Ga0068855_100005168 3300005563 Bacteria 15920
254 Ga0068855_100010690 3300005563 Bacteria 11075
255 Ga0068855_100015678 3300005563 Bacteria 9118
256 Ga0070664_100027841 3300005564 Bacteria 4699
257 Ga0070664_100059096 3300005564 Bacteria 3262
258 Ga0070664_100102327 3300005564 Bacteria 2492
259 Ga0070664_100195639 3300005564 Bacteria 1802
260 Ga0070664_100418135 3300005564 Bacteria 1227
261 Ga0070664_100733651 3300005564 Bacteria 921
262 Ga0070664_100789185 3300005564 Bacteria 888
263 Ga0070664_100911928 3300005564 Bacteria 824
264 Ga0068854_100007769 3300005578 Bacteria 6859
265 Ga0068854_100022062 3300005578 Bacteria 4330
266 Ga0068854_100024272 3300005578 Bacteria 4149
267 Ga0068854_100083257 3300005578 Bacteria 2365
268 Ga0068854_100147108 3300005578 Bacteria 1813
269 Ga0068854_100404395 3300005578 Bacteria 1130
270 Ga0068856_100050898 3300005614 Bacteria 4084
271 Ga0068856_100061938 3300005614 Bacteria 3696
272 Ga0068856_100083041 3300005614 Bacteria 3180
273 Ga0068856_100813528 3300005614 Bacteria 954
274 Ga0068856_100857542 3300005614 Bacteria 927
275 Ga0068856_101628058 3300005614 Bacteria 658
276 Ga0070702_100001533 3300005615 Bacteria 9517
277 Ga0070702_100004222 3300005615 Bacteria 6539
278 Ga0070702_100030011 3300005615 Bacteria 2961
279 Ga0068852_100016659 3300005616 Bacteria 5742
280 Ga0068852_100032601 3300005616 Bacteria 4315
281 Ga0068852_100037494 3300005616 Bacteria 4064
282 Ga0068852_100043256 3300005616 Bacteria 3819
283 Ga0068852_100139825 3300005616 Bacteria 2239
284 Ga0068852_100317066 3300005616 Bacteria 1513
285 Ga0068852_100430835 3300005616 Bacteria 1302
286 Ga0068852_100561696 3300005616 Bacteria 1142
287 Ga0068852_100593693 3300005616 Bacteria 1111
288 Ga0068852_100662574 3300005616 Bacteria 1052
289 Ga0068859_100000624 3300005617 Bacteria 35420
290 Ga0068859_100016297 3300005617 Bacteria 7466
291 Ga0068859_100044040 3300005617 Bacteria 4485
292 Ga0068859_100059506 3300005617 Bacteria 3849
293 Ga0068859_100077854 3300005617 Bacteria 3357
294 Ga0068859_100091360 3300005617 Bacteria 3095
295 Ga0068859_100102462 3300005617 Bacteria 2920
296 Ga0068859_100134114 3300005617 Bacteria 2548
297 Ga0068859_100662110 3300005617 Bacteria 1136
298 Ga0068864_100000276 3300005618 Bacteria 45759
299 Ga0068864_100002127 3300005618 Bacteria 16380
300 Ga0068864_100003424 3300005618 Bacteria 13124
301 Ga0068864_100003971 3300005618 Bacteria 12173
302 Ga0068864_100012120 3300005618 Bacteria 7123
303 Ga0068864_100020314 3300005618 Bacteria 5556
304 Ga0068864_100038210 3300005618 Bacteria 4098
305 Ga0068864_100040362 3300005618 Bacteria 3993
306 Ga0068864_100072048 3300005618 Bacteria 3010
307 Ga0068864_100330621 3300005618 Bacteria 1434
308 Ga0068866_10001469 3300005718 Bacteria 10049
309 Ga0068866_10001518 3300005718 Bacteria 9876
310 Ga0068866_10005070 3300005718 Bacteria 5425
311 Ga0068866_10011885 3300005718 Bacteria 3782
312 Ga0068866_10015151 3300005718 Bacteria 3422
313 Ga0068861_100000591 3300005719 Bacteria 21480
314 Ga0068861_100026369 3300005719 Bacteria 4224
315 Ga0068861_100028906 3300005719 Bacteria 4048
316 Ga0068861_100042153 3300005719 Bacteria 3420
317 Ga0068861_100169994 3300005719 Bacteria 1806
318 Ga0068861_100204832 3300005719 Bacteria 1658
319 Ga0068861_100206540 3300005719 Bacteria 1652
320 Ga0068861_100259840 3300005719 Bacteria 1486
321 Ga0068861_100265320 3300005719 Bacteria 1472
322 Ga0068861_100363229 3300005719 Unclassified 1274
323 Ga0068861_100714402 3300005719 Bacteria 932
324 Ga0068861_100770162 3300005719 Bacteria 901
325 Ga0068851_10001648 3300005834 Bacteria 9788
326 Ga0068851_10102376 3300005834 Bacteria 1521
327 Ga0068851_10192407 3300005834 Bacteria 1135
328 Ga0068851_10417453 3300005834 Unclassified 792
329 Ga0068870_10038813 3300005840 Bacteria 2461
330 Ga0068870_10038859 3300005840 Bacteria 2459
331 Ga0068870_10065408 3300005840 Bacteria 1967
332 Ga0068870_10069691 3300005840 Bacteria 1914
333 Ga0068870_10230813 3300005840 Unclassified 1138
334 Ga0068863_100004257 3300005841 Bacteria 14122
335 Ga0068863_100006992 3300005841 Bacteria 11059
336 Ga0068863_100008763 3300005841 Bacteria 9875
337 Ga0068863_100030397 3300005841 Bacteria 5159
338 Ga0068863_100034575 3300005841 Bacteria 4813
339 Ga0068863_100036114 3300005841 Bacteria 4706
340 Ga0068863_100049754 3300005841 Bacteria 3974
341 Ga0068863_100096502 3300005841 Bacteria 2806
342 Ga0068863_100140627 3300005841 Bacteria 2307
343 Ga0068863_100162084 3300005841 Bacteria 2143
344 Ga0068863_100181017 3300005841 Bacteria 2023
345 Ga0068863_100256508 3300005841 Bacteria 1690
346 Ga0068863_100312475 3300005841 Bacteria 1525
347 Ga0068863_100320012 3300005841 Unclassified 1507
348 Ga0068863_100557609 3300005841 Bacteria 1132
349 Ga0068858_100000234 3300005842 Bacteria 60077
350 Ga0068858_100000924 3300005842 Bacteria 30445
351 Ga0068858_100013394 3300005842 Bacteria 7740
352 Ga0068858_100061660 3300005842 Bacteria 3467
353 Ga0068858_100106272 3300005842 Bacteria 2620
354 Ga0068858_100133360 3300005842 Bacteria 2330
355 Ga0068858_100219416 3300005842 Bacteria 1801
356 Ga0068858_100375835 3300005842 Bacteria 1363
357 Ga0068858_100814800 3300005842 Bacteria 911
358 Ga0068858_100848991 3300005842 Bacteria 892
359 Ga0068860_100001386 3300005843 Bacteria 26300
360 Ga0068860_100005410 3300005843 Bacteria 12957
361 Ga0068860_100019548 3300005843 Bacteria 6566
362 Ga0068860_100061976 3300005843 Bacteria 3554
363 Ga0068860_100077578 3300005843 Bacteria 3159
364 Ga0068860_100103930 3300005843 Bacteria 2712
365 Ga0068860_100290466 3300005843 Bacteria 1600
366 Ga0068860_100313456 3300005843 Unclassified 1539
367 Ga0068860_100345047 3300005843 Bacteria 1464
368 Ga0068860_100572420 3300005843 Bacteria 1133
369 Ga0068860_100695704 3300005843 Bacteria 1026
370 Ga0068862_100003725 3300005844 Bacteria 13006
371 Ga0068862_100022960 3300005844 Bacteria 5224
372 Ga0068862_100032782 3300005844 Bacteria 4388
373 Ga0068862_100090229 3300005844 Unclassified 2668
374 Ga0068862_100197931 3300005844 Bacteria 1811
375 Ga0068862_100213805 3300005844 Bacteria 1743
376 Ga0068862_100299060 3300005844 Bacteria 1480
377 Ga0068862_100482462 3300005844 Bacteria 1174
378 Ga0068862_100529992 3300005844 Bacteria 1122
379 Ga0068862_100622379 3300005844 Bacteria 1039
380 Ga0081539_10084453 3300005985 Bacteria 1659
381 Ga0075365_10052880 3300006038 Bacteria 2688
382 Ga0075365_10096040 3300006038 Bacteria 2025
383 Ga0075365_10267691 3300006038 Bacteria 1202
384 Ga0075365_10359992 3300006038 Bacteria 1026
385 Ga0075368_10153505 3300006042 Bacteria 962
386 Ga0075368_10251754 3300006042 Bacteria 755
387 Ga0075363_100103163 3300006048 Bacteria 1580
388 Ga0075363_100136826 3300006048 Bacteria 1377
389 Ga0075364_10181388 3300006051 Unclassified 1425
390 Ga0075364_10352541 3300006051 Bacteria 1003
391 Ga0075364_10446241 3300006051 Bacteria 884
392 Ga0070715_10010927 3300006163 Bacteria 3251
393 Ga0070716_100009552 3300006173 Bacteria 4836
394 Ga0070712_100008817 3300006175 Bacteria 6352
395 Ga0070712_100017504 3300006175 Bacteria 4640
396 Ga0070712_100097376 3300006175 Bacteria 2168
397 Ga0070712_100366472 3300006175 Bacteria 1183
398 Ga0070712_100596943 3300006175 Bacteria 934
399 Ga0075362_10004154 3300006177 Bacteria 5165
400 Ga0075362_10005333 3300006177 Bacteria 4699
401 Ga0075362_10005967 3300006177 Bacteria 4502
402 Ga0075362_10042937 3300006177 Bacteria 2001
403 Ga0075362_10058195 3300006177 Bacteria 1743
404 Ga0075362_10095200 3300006177 Bacteria 1386
405 Ga0075367_10012591 3300006178 Bacteria 4518
406 Ga0075367_10139978 3300006178 Bacteria 1499
407 Ga0075367_10174635 3300006178 Bacteria 1339
408 Ga0075369_10036834 3300006186 Bacteria 2082
409 Ga0075369_10064569 3300006186 Bacteria 1603
410 Ga0075369_10320753 3300006186 Bacteria 725
411 Ga0075366_10019894 3300006195 Bacteria 3890
412 Ga0075366_10031327 3300006195 Bacteria 3129
413 Ga0075366_10127684 3300006195 Bacteria 1534
414 Ga0097621_100004591 3300006237 Bacteria 9640
415 Ga0097621_100006870 3300006237 Bacteria 8095
416 Ga0097621_100014225 3300006237 Bacteria 5951
417 Ga0097621_100020158 3300006237 Bacteria 5135
418 Ga0097621_100029079 3300006237 Bacteria 4362
419 Ga0097621_100034367 3300006237 Bacteria 4045
420 Ga0097621_100103730 3300006237 Bacteria 2396
421 Ga0097621_100118849 3300006237 Bacteria 2240
422 Ga0097621_100154110 3300006237 Bacteria 1971
423 Ga0097621_100205269 3300006237 Bacteria 1712
424 Ga0097621_100495358 3300006237 Bacteria 1106
425 Ga0097621_100527554 3300006237 Bacteria 1072
426 Ga0075370_10018987 3300006353 Bacteria 3735
427 Ga0075370_10055867 3300006353 Bacteria 2243
428 Ga0075370_10145897 3300006353 Bacteria 1385
429 Ga0075370_10348858 3300006353 Bacteria 884
430 Ga0068871_100018911 3300006358 Bacteria 5250
431 Ga0068871_100024554 3300006358 Bacteria 4676
432 Ga0068871_100029581 3300006358 Bacteria 4303
433 Ga0068871_100102400 3300006358 Bacteria 2400
434 Ga0068871_100135206 3300006358 Bacteria 2093
435 Ga0068871_100161346 3300006358 Bacteria 1918
436 Ga0075428_100006182 3300006844 Bacteria 13321
437 Ga0075428_100521001 3300006844 Bacteria 1271
438 Ga0075434_100054329 3300006871 Bacteria 3980
439 Ga0075434_100812744 3300006871 Bacteria 951
440 Ga0075429_100013984 3300006880 Bacteria 6956
441 Ga0068865_100000824 3300006881 Bacteria 17479
442 Ga0068865_100004561 3300006881 Bacteria 8358
443 Ga0068865_100018810 3300006881 Bacteria 4464
444 Ga0068865_100102657 3300006881 Bacteria 2096
445 Ga0068865_100112702 3300006881 Bacteria 2009
446 Ga0068865_100138270 3300006881 Bacteria 1833
447 Ga0068865_100330422 3300006881 Bacteria 1229
448 Ga0068865_100603630 3300006881 Bacteria 928
449 Ga0097620_100000624 3300006931 Bacteria 35420
450 Ga0097620_100016298 3300006931 Bacteria 7466
451 Ga0097620_100044039 3300006931 Bacteria 4485
452 Ga0097620_100059506 3300006931 Bacteria 3849
453 Ga0097620_100077851 3300006931 Bacteria 3357
454 Ga0097620_100091362 3300006931 Bacteria 3095
455 Ga0097620_100102457 3300006931 Bacteria 2920
456 Ga0097620_100134110 3300006931 Bacteria 2548
457 Ga0097620_100662111 3300006931 Bacteria 1136
458 Ga0075435_100196086 3300007076 Bacteria 1710
459 Ga0075435_100609163 3300007076 Unclassified 947
460 Ga0105240_10003248 3300009093 Bacteria 25440
461 Ga0105240_10007090 3300009093 Bacteria 16338
462 Ga0105240_10073994 3300009093 Bacteria 4206
463 Ga0105240_10079875 3300009093 Bacteria 4024
464 Ga0105240_10205508 3300009093 Bacteria 2305
465 Ga0105240_10579172 3300009093 Bacteria 1238
466 Ga0111539_10000843 3300009094 Bacteria 39924
467 Ga0111539_10038829 3300009094 Bacteria 5743
468 Ga0111539_10074827 3300009094 Bacteria 3991
469 Ga0111539_10292169 3300009094 Bacteria 1897
470 Ga0111539_11091154 3300009094 Bacteria 927
471 Ga0111539_11296358 3300009094 Bacteria 845
472 Ga0111539_11358265 3300009094 Bacteria 824
473 Ga0105245_10001111 3300009098 Bacteria 24332
474 Ga0105245_10008875 3300009098 Bacteria 8772
475 Ga0105245_10014490 3300009098 Bacteria 6866
476 Ga0105245_10028235 3300009098 Bacteria 4947
477 Ga0105245_10113319 3300009098 Bacteria 2525
478 Ga0105245_10272887 3300009098 Bacteria 1650
479 Ga0105245_10501028 3300009098 Bacteria 1230
480 Ga0105245_11056322 3300009098 Bacteria 858
481 Ga0105247_10021332 3300009101 Bacteria 3898
482 Ga0105243_10009477 3300009148 Bacteria 7413
483 Ga0105243_10048586 3300009148 Bacteria 3345
484 Ga0105243_10051099 3300009148 Bacteria 3268
485 Ga0105243_10063969 3300009148 Bacteria 2950
486 Ga0105243_10376886 3300009148 Bacteria 1311
487 Ga0105243_11225858 3300009148 Bacteria 764
488 Ga0105241_10005538 3300009174 Bacteria 9331
489 Ga0105241_10046342 3300009174 Bacteria 3302
490 Ga0105241_10070452 3300009174 Bacteria 2713
491 Ga0105241_10162908 3300009174 Bacteria 1835
492 Ga0105241_10531548 3300009174 Bacteria 1053
493 Ga0105241_11156427 3300009174 Bacteria 731
494 Ga0105242_10003508 3300009176 Bacteria 12190
495 Ga0105242_10005080 3300009176 Bacteria 10163
496 Ga0105242_10006858 3300009176 Bacteria 8782
497 Ga0105242_10065729 3300009176 Bacteria 2993
498 Ga0105242_10084417 3300009176 Bacteria 2661
499 Ga0105242_10103031 3300009176 Bacteria 2421
500 Ga0105242_10103729 3300009176 Bacteria 2413
501 Ga0105242_10192379 3300009176 Bacteria 1807
502 Ga0105248_10002960 3300009177 Bacteria 18821
503 Ga0105248_10060540 3300009177 Bacteria 4251
504 Ga0105248_10069128 3300009177 Bacteria 3965
505 Ga0105248_10153088 3300009177 Bacteria 2602
506 Ga0105248_10271262 3300009177 Bacteria 1911
507 Ga0105248_10276887 3300009177 Bacteria 1889
508 Ga0105248_10293267 3300009177 Bacteria 1832
509 Ga0105248_10804644 3300009177 Bacteria 1061
510 Ga0105248_11035308 3300009177 Bacteria 927
511 Ga0105248_11096548 3300009177 Bacteria 900
512 Ga0105248_11421995 3300009177 Unclassified 785
513 Ga0105237_10074389 3300009545 Bacteria 3389
514 Ga0105237_10195445 3300009545 Bacteria 2023
515 Ga0105237_10880908 3300009545 Unclassified 902
516 Ga0105238_10003229 3300009551 Bacteria 16290
517 Ga0105238_10007314 3300009551 Bacteria 11055
518 Ga0105238_10079856 3300009551 Bacteria 3261
519 Ga0105238_10561836 3300009551 Bacteria 1146
520 Ga0105238_11269767 3300009551 Bacteria 762
521 Ga0105249_10002887 3300009553 Bacteria 14824
522 Ga0105249_10011488 3300009553 Bacteria 7778
523 Ga0105249_10027279 3300009553 Bacteria 5153
524 Ga0105249_10046417 3300009553 Bacteria 3953
525 Ga0105249_10047014 3300009553 Plasmid 3930
526 Ga0105249_10148811 3300009553 Bacteria 2252
527 Ga0105249_10185072 3300009553 Bacteria 2029
528 Ga0105249_10252688 3300009553 Bacteria 1748
529 Ga0105249_10305316 3300009553 Bacteria 1598
530 Ga0105249_10394366 3300009553 Bacteria 1413
531 Ga0105249_10423051 3300009553 Bacteria 1366
532 Ga0105249_10480297 3300009553 Bacteria 1285
533 Ga0105249_10863030 3300009553 Bacteria 971
534 Ga0105249_10910345 3300009553 Unclassified 947
535 Ga0105239_10025477 3300010375 Bacteria 6512
536 Ga0105239_10209395 3300010375 Bacteria 2185
537 Ga0105239_10893522 3300010375 Bacteria 1020
538 Ga0105246_10025128 3300011119 Bacteria 3881
539 Ga0105246_10091560 3300011119 Bacteria 2192
540 Ga0105246_10419898 3300011119 Bacteria 1116
541 Ga0157342_1027150 3300012507 Unclassified 701
542 Ga0157373_10009014 3300013100 Bacteria 7382
543 Ga0157373_10159750 3300013100 Bacteria 1586
544 Ga0157373_10187106 3300013100 Bacteria 1459
545 Ga0157371_10155314 3300013102 Bacteria 1633
546 Ga0157371_10250389 3300013102 Bacteria 1275
547 Ga0157371_10482331 3300013102 Bacteria 914
548 Ga0157370_10066629 3300013104 Bacteria 3405
549 Ga0157369_10019958 3300013105 Bacteria 7493
550 Ga0157369_10501499 3300013105 Bacteria 1256
551 Ga0157369_10507692 3300013105 Bacteria 1247
552 Ga0157374_10006996 3300013296 Bacteria 9603
553 Ga0157374_10022540 3300013296 Bacteria 5618
554 Ga0157374_10026815 3300013296 Bacteria 5189
555 Ga0157374_10189755 3300013296 Bacteria 2010
556 Ga0157374_10272739 3300013296 Bacteria 1668
557 Ga0157374_10308858 3300013296 Bacteria 1565
558 Ga0157374_10432518 3300013296 Bacteria 1316
559 Ga0157378_10001790 3300013297 Bacteria 19289
560 Ga0157378_10004340 3300013297 Bacteria 12472
561 Ga0157378_10010502 3300013297 Bacteria 8091
562 Ga0157378_10019984 3300013297 Bacteria 5888
563 Ga0157378_10115402 3300013297 Bacteria 2468
564 Ga0157378_10123389 3300013297 Bacteria 2390
565 Ga0157378_10200723 3300013297 Bacteria 1886
566 Ga0157378_10344738 3300013297 Bacteria 1454
567 Ga0157378_10495569 3300013297 Bacteria 1219
568 Ga0157378_10620335 3300013297 Bacteria 1094
569 Ga0157378_10717327 3300013297 Bacteria 1020
570 Ga0157378_11506842 3300013297 Bacteria 717
571 Ga0163162_10004820 3300013306 Bacteria 13020
572 Ga0163162_10024400 3300013306 Bacteria 5968
573 Ga0163162_10028267 3300013306 Bacteria 5547
574 Ga0163162_10147725 3300013306 Bacteria 2467
575 Ga0163162_10246651 3300013306 Bacteria 1917
576 Ga0163162_10325056 3300013306 Bacteria 1670
577 Ga0163162_10475790 3300013306 Unclassified 1380
578 Ga0163162_10591161 3300013306 Bacteria 1236
579 Ga0163162_11219658 3300013306 Bacteria 854
580 Ga0157372_10011095 3300013307 Bacteria 9585
581 Ga0157372_10015598 3300013307 Bacteria 8147
582 Ga0157372_10726969 3300013307 Unclassified 1155
583 Ga0157372_10948903 3300013307 Bacteria 997
584 Ga0157375_10001809 3300013308 Bacteria 18319
585 Ga0157375_10002818 3300013308 Bacteria 15049
586 Ga0157375_10003501 3300013308 Bacteria 13609
587 Ga0157375_10102795 3300013308 Bacteria 2943
588 Ga0157375_10108232 3300013308 Bacteria 2874
589 Ga0157375_10135007 3300013308 Bacteria 2590
590 Ga0157375_10156651 3300013308 Bacteria 2417
591 Ga0157375_10247183 3300013308 Bacteria 1944
592 Ga0157375_10276577 3300013308 Bacteria 1841
593 Ga0157375_10505455 3300013308 Bacteria 1373
594 Ga0157375_10786263 3300013308 Bacteria 1101
595 Ga0157375_10944947 3300013308 Bacteria 1004
596 Ga0157375_11032393 3300013308 Bacteria 961
597 Ga0157375_11092619 3300013308 Unclassified 933
598 Ga0163163_10004376 3300014325 Bacteria 12034
599 Ga0163163_10048308 3300014325 Bacteria 4184
600 Ga0163163_10053567 3300014325 Bacteria 3983
601 Ga0163163_10074096 3300014325 Bacteria 3395
602 Ga0163163_10150794 3300014325 Bacteria 2369
603 Ga0163163_10415278 3300014325 Bacteria 1404
604 Ga0163163_10764308 3300014325 Bacteria 1030
605 Ga0163163_10866689 3300014325 Bacteria 966
606 Ga0163163_11249630 3300014325 Bacteria 805
607 Ga0163163_11477447 3300014325 Bacteria 741
608 Ga0157380_10003603 3300014326 Bacteria 10652
609 Ga0157380_10080155 3300014326 Bacteria 2668
610 Ga0157380_10179158 3300014326 Bacteria 1860
611 Ga0157380_10276351 3300014326 Bacteria 1534
612 Ga0157380_10371448 3300014326 Bacteria 1346
613 Ga0157380_10639787 3300014326 Bacteria 1059
614 Ga0157380_11031430 3300014326 Bacteria 858
615 Ga0157380_11105266 3300014326 Bacteria 832
616 Ga0157380_11455553 3300014326 Bacteria 737
617 Ga0157377_10003662 3300014745 Bacteria 6970
618 Ga0157377_10067610 3300014745 Bacteria 2057
619 Ga0157377_10129540 3300014745 Bacteria 1539
620 Ga0157379_10018797 3300014968 Bacteria 6094
621 Ga0157379_10019828 3300014968 Bacteria 5942
622 Ga0157379_10029206 3300014968 Bacteria 4904
623 Ga0157379_10041797 3300014968 Bacteria 4091
624 Ga0157379_10100652 3300014968 Bacteria 2594
625 Ga0157379_10390448 3300014968 Bacteria 1278
626 Ga0157379_10662506 3300014968 Bacteria 978
627 Ga0157379_10672952 3300014968 Bacteria 970
628 Ga0157379_10812910 3300014968 Bacteria 883
629 Ga0157376_10018103 3300014969 Bacteria 5391
630 Ga0157376_10019374 3300014969 Bacteria 5243
631 Ga0157376_10020678 3300014969 Bacteria 5098
632 Ga0157376_10043564 3300014969 Bacteria 3683
633 Ga0157376_10080736 3300014969 Bacteria 2791
634 Ga0157376_10732408 3300014969 Bacteria 996
635 Ga0157376_11092605 3300014969 Bacteria 823
636 Ga0163161_10000916 3300017792 Bacteria 22803
637 Ga0163161_10017198 3300017792 Bacteria 5057
638 Ga0163161_10031777 3300017792 Bacteria 3764
639 Ga0163161_10040746 3300017792 Bacteria 3336
640 Ga0163161_10066616 3300017792 Bacteria 2630
641 Ga0163161_10388032 3300017792 Bacteria 1117
642 Ga0163161_10640060 3300017792 Bacteria 880
643 Ga0213876_10035613 3300021384 Bacteria 2625
644 Ga0213876_10047600 3300021384 Bacteria 2267
645 Ga0213876_10068993 3300021384 Bacteria 1867
646 Ga0207697_10066718 3300025315 Bacteria 1504
647 Ga0207697_10078982 3300025315 Bacteria 1385
648 Ga0207697_10103713 3300025315 Bacteria 1214
649 Ga0207656_10003595 3300025321 Bacteria 5346
650 Ga0207656_10071725 3300025321 Bacteria 1540
651 Ga0207656_10118652 3300025321 Bacteria 1229
652 Ga0207656_10300258 3300025321 Unclassified 795
653 Ga0207682_10000329 3300025893 Bacteria 21637
654 Ga0207682_10009175 3300025893 Bacteria 3908
655 Ga0207682_10010696 3300025893 Bacteria 3590
656 Ga0207682_10043767 3300025893 Bacteria 1833
657 Ga0207682_10050443 3300025893 Bacteria 1720
658 Ga0207682_10150543 3300025893 Bacteria 1049
659 Ga0207682_10187870 3300025893 Bacteria 946
660 Ga0207692_10016684 3300025898 Bacteria 3259
661 Ga0207692_10327473 3300025898 Bacteria 939
662 Ga0207642_10010710 3300025899 Bacteria 3245
663 Ga0207642_10018140 3300025899 Bacteria 2694
664 Ga0207642_10032246 3300025899 Bacteria 2204
665 Ga0207642_10110758 3300025899 Bacteria 1397
666 Ga0207710_10049759 3300025900 Bacteria 1879
667 Ga0207688_10059984 3300025901 Bacteria 2142
668 Ga0207688_10071737 3300025901 Bacteria 1966
669 Ga0207688_10241584 3300025901 Bacteria 1092
670 Ga0207688_10487200 3300025901 Bacteria 771
671 Ga0207680_10004953 3300025903 Bacteria 6344
672 Ga0207680_10008077 3300025903 Bacteria 5156
673 Ga0207680_10023548 3300025903 Bacteria 3365
674 Ga0207680_10100309 3300025903 Bacteria 1859
675 Ga0207680_10168620 3300025903 Bacteria 1473
676 Ga0207680_10211599 3300025903 Bacteria 1326
677 Ga0207680_10288047 3300025903 Bacteria 1143
678 Ga0207680_10604148 3300025903 Bacteria 785
679 Ga0207685_10013464 3300025905 Bacteria 2531
680 Ga0207699_10019156 3300025906 Bacteria 3643
681 Ga0207699_10034841 3300025906 Bacteria 2859
682 Ga0207699_10211612 3300025906 Bacteria 1319
683 Ga0207699_10240946 3300025906 Bacteria 1242
684 Ga0207645_10026093 3300025907 Bacteria 3777
685 Ga0207645_10059685 3300025907 Bacteria 2436
686 Ga0207645_10065787 3300025907 Bacteria 2317
687 Ga0207645_10081064 3300025907 Bacteria 2080
688 Ga0207645_10093611 3300025907 Bacteria 1934
689 Ga0207645_10131009 3300025907 Bacteria 1632
690 Ga0207645_10221979 3300025907 Unclassified 1246
691 Ga0207643_10007603 3300025908 Bacteria 5819
692 Ga0207643_10031257 3300025908 Bacteria 2967
693 Ga0207643_10285415 3300025908 Bacteria 1024
694 Ga0207705_10018066 3300025909 Bacteria 5043
695 Ga0207705_10120670 3300025909 Bacteria 1945
696 Ga0207705_10328014 3300025909 Bacteria 1177
697 Ga0207705_10415343 3300025909 Bacteria 1041
698 Ga0207654_10004656 3300025911 Bacteria 6935
699 Ga0207654_10093092 3300025911 Bacteria 1842
700 Ga0207707_10019946 3300025912 Bacteria 5850
701 Ga0207707_10204272 3300025912 Bacteria 1722
702 Ga0207695_10005746 3300025913 Bacteria 16336
703 Ga0207695_10150303 3300025913 Bacteria 2268
704 Ga0207671_10230247 3300025914 Bacteria 1454
705 Ga0207693_10026174 3300025915 Bacteria 4619
706 Ga0207693_10170228 3300025915 Unclassified 1715
707 Ga0207693_10425997 3300025915 Bacteria 1037
708 Ga0207663_10193340 3300025916 Bacteria 1462
709 Ga0207660_10159303 3300025917 Bacteria 1740
710 Ga0207660_10288417 3300025917 Bacteria 1304
711 Ga0207662_10008862 3300025918 Bacteria 5519
712 Ga0207662_10040287 3300025918 Bacteria 2745
713 Ga0207662_10355616 3300025918 Bacteria 985
714 Ga0207657_10012272 3300025919 Bacteria 8465
715 Ga0207657_10030358 3300025919 Bacteria 4906
716 Ga0207657_10153815 3300025919 Bacteria 1872
717 Ga0207649_10135307 3300025920 Bacteria 1679
718 Ga0207649_10157102 3300025920 Bacteria 1572
719 Ga0207649_10167320 3300025920 Bacteria 1528
720 Ga0207649_10641758 3300025920 Bacteria 820
721 Ga0207652_10015622 3300025921 Bacteria 6179
722 Ga0207652_10031258 3300025921 Bacteria 4471
723 Ga0207652_10102536 3300025921 Bacteria 2529
724 Ga0207681_10000507 3300025923 Bacteria 27091
725 Ga0207681_10006599 3300025923 Bacteria 7127
726 Ga0207681_10032065 3300025923 Bacteria 3437
727 Ga0207681_10093002 3300025923 Bacteria 2157
728 Ga0207681_10272628 3300025923 Unclassified 1329
729 Ga0207681_10276361 3300025923 Bacteria 1321
730 Ga0207681_10370288 3300025923 Bacteria 1151
731 Ga0207681_10390286 3300025923 Bacteria 1122
732 Ga0207694_10047121 3300025924 Bacteria 3333
733 Ga0207694_10087647 3300025924 Bacteria 2452
734 Ga0207694_10117973 3300025924 Bacteria 2116
735 Ga0207694_10128220 3300025924 Bacteria 2031
736 Ga0207694_10205113 3300025924 Bacteria 1605
737 Ga0207694_10295820 3300025924 Bacteria 1332
738 Ga0207650_10003311 3300025925 Bacteria 11089
739 Ga0207650_10008922 3300025925 Bacteria 6852
740 Ga0207650_10021972 3300025925 Bacteria 4514
741 Ga0207650_10027703 3300025925 Bacteria 4057
742 Ga0207650_10054664 3300025925 Bacteria 2963
743 Ga0207650_10069804 3300025925 Bacteria 2640
744 Ga0207650_10071716 3300025925 Bacteria 2606
745 Ga0207650_10092270 3300025925 Bacteria 2316
746 Ga0207650_10204649 3300025925 Bacteria 1582
747 Ga0207650_10260732 3300025925 Bacteria 1406
748 Ga0207650_10310586 3300025925 Unclassified 1289
749 Ga0207650_10332166 3300025925 Bacteria 1247
750 Ga0207650_10375384 3300025925 Bacteria 1173
751 Ga0207650_11053292 3300025925 Unclassified 692
752 Ga0207659_10000208 3300025926 Bacteria 35245
753 Ga0207659_10000550 3300025926 Bacteria 22431
754 Ga0207659_10039891 3300025926 Bacteria 3279
755 Ga0207659_10098086 3300025926 Bacteria 2203
756 Ga0207659_10111621 3300025926 Bacteria 2079
757 Ga0207659_10114234 3300025926 Bacteria 2058
758 Ga0207659_10226754 3300025926 Bacteria 1505
759 Ga0207659_10656001 3300025926 Bacteria 897
760 Ga0207687_10000792 3300025927 Bacteria 21334
761 Ga0207687_10013732 3300025927 Bacteria 5288
762 Ga0207687_10021109 3300025927 Bacteria 4323
763 Ga0207687_10027398 3300025927 Bacteria 3823
764 Ga0207687_10028889 3300025927 Bacteria 3727
765 Ga0207687_10200001 3300025927 Bacteria 1561
766 Ga0207687_10449556 3300025927 Unclassified 1068
767 Ga0207687_10470522 3300025927 Bacteria 1045
768 Ga0207700_10000044 3300025928 Bacteria 89454
769 Ga0207700_10009373 3300025928 Bacteria 6111
770 Ga0207700_10014071 3300025928 Bacteria 5230
771 Ga0207664_10006563 3300025929 Bacteria 8012
772 Ga0207664_10027779 3300025929 Bacteria 4294
773 Ga0207664_10206308 3300025929 Bacteria 1699
774 Ga0207664_10388050 3300025929 Bacteria 1240
775 Ga0207644_10000462 3300025931 Bacteria 26318
776 Ga0207644_10003606 3300025931 Bacteria 10029
777 Ga0207644_10007409 3300025931 Bacteria 7152
778 Ga0207644_10019469 3300025931 Bacteria 4604
779 Ga0207644_10037450 3300025931 Bacteria 3412
780 Ga0207644_10065529 3300025931 Bacteria 2642
781 Ga0207644_10152086 3300025931 Unclassified 1791
782 Ga0207644_10175505 3300025931 Bacteria 1676
783 Ga0207644_10367073 3300025931 Bacteria 1172
784 Ga0207644_10413892 3300025931 Bacteria 1103
785 Ga0207644_10599957 3300025931 Bacteria 914
786 Ga0207644_11041163 3300025931 Bacteria 687
787 Ga0207690_10006774 3300025932 Bacteria 6792
788 Ga0207690_10029877 3300025932 Bacteria 3469
789 Ga0207690_10059676 3300025932 Bacteria 2585
790 Ga0207690_10315172 3300025932 Bacteria 1228
791 Ga0207706_10004915 3300025933 Bacteria 12499
792 Ga0207706_10009529 3300025933 Bacteria 8917
793 Ga0207706_10019569 3300025933 Bacteria 6090
794 Ga0207706_10022997 3300025933 Bacteria 5597
795 Ga0207706_10029601 3300025933 Bacteria 4887
796 Ga0207706_10052216 3300025933 Bacteria 3609
797 Ga0207706_10079466 3300025933 Bacteria 2884
798 Ga0207706_10167435 3300025933 Bacteria 1931
799 Ga0207706_10302887 3300025933 Bacteria 1392
800 Ga0207686_10000643 3300025934 Bacteria 21534
801 Ga0207686_10010453 3300025934 Bacteria 5055
802 Ga0207686_10017105 3300025934 Bacteria 4080
803 Ga0207686_10048919 3300025934 Bacteria 2622
804 Ga0207686_10098304 3300025934 Bacteria 1949
805 Ga0207686_10334074 3300025934 Bacteria 1136
806 Ga0207709_10033113 3300025935 Bacteria 3032
807 Ga0207709_10199319 3300025935 Bacteria 1428
808 Ga0207670_10004198 3300025936 Bacteria 7723
809 Ga0207670_10005369 3300025936 Bacteria 7027
810 Ga0207670_10051431 3300025936 Bacteria 2766
811 Ga0207670_10114383 3300025936 Bacteria 1950
812 Ga0207670_10231639 3300025936 Bacteria 1419
813 Ga0207670_10507121 3300025936 Bacteria 980
814 Ga0207669_10001373 3300025937 Bacteria 10359
815 Ga0207669_10007739 3300025937 Bacteria 4998
816 Ga0207669_10016583 3300025937 Bacteria 3748
817 Ga0207669_10030571 3300025937 Unclassified 2994
818 Ga0207669_10190329 3300025937 Bacteria 1479
819 Ga0207669_10235453 3300025937 Bacteria 1354
820 Ga0207669_10504712 3300025937 Bacteria 968
821 Ga0207669_10562958 3300025937 Bacteria 921
822 Ga0207704_10006006 3300025938 Bacteria 5630
823 Ga0207704_10015004 3300025938 Bacteria 3934
824 Ga0207704_10023542 3300025938 Bacteria 3321
825 Ga0207704_10052413 3300025938 Bacteria 2473
826 Ga0207704_10110151 3300025938 Bacteria 1859
827 Ga0207704_10178347 3300025938 Bacteria 1532
828 Ga0207704_10271942 3300025938 Bacteria 1283
829 Ga0207665_10006482 3300025939 Bacteria 7762
830 Ga0207665_10007475 3300025939 Bacteria 7221
831 Ga0207665_10100560 3300025939 Bacteria 2018
832 Ga0207691_10000090 3300025940 Bacteria 77582
833 Ga0207691_10002155 3300025940 Bacteria 19256
834 Ga0207691_10004195 3300025940 Bacteria 13988
835 Ga0207691_10005710 3300025940 Bacteria 12034
836 Ga0207691_10041152 3300025940 Bacteria 4268
837 Ga0207691_10041383 3300025940 Bacteria 4255
838 Ga0207691_10047164 3300025940 Bacteria 3955
839 Ga0207691_10063115 3300025940 Bacteria 3361
840 Ga0207691_10079035 3300025940 Bacteria 2961
841 Ga0207691_10082412 3300025940 Bacteria 2889
842 Ga0207691_10117592 3300025940 Bacteria 2358
843 Ga0207691_10133967 3300025940 Bacteria 2187
844 Ga0207691_10314871 3300025940 Bacteria 1342
845 Ga0207691_10513045 3300025940 Bacteria 1018
846 Ga0207691_10707717 3300025940 Bacteria 849
847 Ga0207691_10905309 3300025940 Bacteria 738
848 Ga0207711_10000841 3300025941 Bacteria 29654
849 Ga0207711_10009601 3300025941 Bacteria 8065
850 Ga0207711_10018649 3300025941 Bacteria 5769
851 Ga0207711_10025126 3300025941 Bacteria 4998
852 Ga0207711_10043400 3300025941 Bacteria 3835
853 Ga0207711_10084690 3300025941 Bacteria 2775
854 Ga0207711_10107322 3300025941 Bacteria 2479
855 Ga0207711_10111814 3300025941 Bacteria 2430
856 Ga0207711_10397336 3300025941 Bacteria 1280
857 Ga0207689_10000455 3300025942 Bacteria 38509
858 Ga0207689_10005809 3300025942 Bacteria 10941
859 Ga0207689_10007229 3300025942 Bacteria 9751
860 Ga0207689_10015321 3300025942 Bacteria 6489
861 Ga0207689_10022306 3300025942 Bacteria 5324
862 Ga0207689_10133953 3300025942 Bacteria 2040
863 Ga0207689_10164469 3300025942 Bacteria 1828
864 Ga0207689_10189385 3300025942 Bacteria 1697
865 Ga0207689_10456658 3300025942 Bacteria 1068
866 Ga0207689_10913004 3300025942 Bacteria 741
867 Ga0207661_10159661 3300025944 Bacteria 1955
868 Ga0207679_10038530 3300025945 Bacteria 3406
869 Ga0207679_10213221 3300025945 Bacteria 1620
870 Ga0207679_10293285 3300025945 Bacteria 1399
871 Ga0207679_10378601 3300025945 Bacteria 1240
872 Ga0207679_10700353 3300025945 Bacteria 919
873 Ga0207679_10912343 3300025945 Bacteria 804
874 Ga0207667_10009857 3300025949 Bacteria 11216
875 Ga0207667_10038078 3300025949 Bacteria 5137
876 Ga0207667_10260843 3300025949 Bacteria 1772
877 Ga0207667_10960485 3300025949 Bacteria 844
878 Ga0207651_10000418 3300025960 Bacteria 18094
879 Ga0207651_10005645 3300025960 Bacteria 6449
880 Ga0207651_10018832 3300025960 Bacteria 4120
881 Ga0207651_10031339 3300025960 Bacteria 3397
882 Ga0207651_10047696 3300025960 Bacteria 2890
883 Ga0207651_10058095 3300025960 Bacteria 2672
884 Ga0207651_10065131 3300025960 Bacteria 2554
885 Ga0207651_10215022 3300025960 Bacteria 1550
886 Ga0207651_10237215 3300025960 Bacteria 1484
887 Ga0207651_10254556 3300025960 Bacteria 1438
888 Ga0207651_10532121 3300025960 Bacteria 1020
889 Ga0207651_10598010 3300025960 Bacteria 964
890 Ga0207651_10769242 3300025960 Bacteria 852
891 Ga0207651_10800761 3300025960 Bacteria 835
892 Ga0207651_10887207 3300025960 Bacteria 794
893 Ga0207712_10003891 3300025961 Bacteria 9438
894 Ga0207712_10069778 3300025961 Bacteria 2522
895 Ga0207712_10104219 3300025961 Bacteria 2115
896 Ga0207712_10142901 3300025961 Bacteria 1839
897 Ga0207712_10259163 3300025961 Bacteria 1409
898 Ga0207668_10001012 3300025972 Bacteria 16813
899 Ga0207668_10029388 3300025972 Bacteria 3602
900 Ga0207668_10037262 3300025972 Bacteria 3253
901 Ga0207668_10053463 3300025972 Bacteria 2799
902 Ga0207668_10109780 3300025972 Bacteria 2067
903 Ga0207640_10009528 3300025981 Bacteria 5439
904 Ga0207640_10132452 3300025981 Bacteria 1804
905 Ga0207640_10601017 3300025981 Bacteria 931
906 Ga0207658_10001563 3300025986 Bacteria 17747
907 Ga0207658_10002727 3300025986 Bacteria 12762
908 Ga0207658_10068554 3300025986 Bacteria 2677
909 Ga0207658_10097663 3300025986 Bacteria 2294
910 Ga0207658_10158315 3300025986 Bacteria 1853
911 Ga0207658_10247004 3300025986 Bacteria 1515
912 Ga0207658_10252193 3300025986 Bacteria 1500
913 Ga0207658_10401101 3300025986 Bacteria 1205
914 Ga0207658_10455142 3300025986 Bacteria 1134
915 Ga0207658_10480928 3300025986 Bacteria 1103
916 Ga0207677_10000387 3300026023 Bacteria 30319
917 Ga0207677_10003024 3300026023 Bacteria 8881
918 Ga0207677_10004900 3300026023 Bacteria 7225
919 Ga0207677_10158782 3300026023 Bacteria 1754
920 Ga0207677_10162814 3300026023 Bacteria 1735
921 Ga0207677_10203476 3300026023 Bacteria 1575
922 Ga0207677_10207634 3300026023 Bacteria 1561
923 Ga0207677_10521616 3300026023 Bacteria 1031
924 Ga0207677_10613869 3300026023 Bacteria 956
925 Ga0207677_11009010 3300026023 Bacteria 755
926 Ga0207703_10001201 3300026035 Bacteria 24271
927 Ga0207703_10001656 3300026035 Bacteria 20008
928 Ga0207703_10002328 3300026035 Bacteria 16574
929 Ga0207703_10144546 3300026035 Bacteria 2067
930 Ga0207703_10315870 3300026035 Bacteria 1429
931 Ga0207703_10419271 3300026035 Bacteria 1245
932 Ga0207703_10495232 3300026035 Bacteria 1147
933 Ga0207703_10784358 3300026035 Bacteria 909
934 Ga0207703_10796765 3300026035 Bacteria 902
935 Ga0207639_10005944 3300026041 Bacteria 8277
936 Ga0207639_10401536 3300026041 Bacteria 1235
937 Ga0207639_10472456 3300026041 Bacteria 1142
938 Ga0207639_10541135 3300026041 Bacteria 1068
939 Ga0207678_10009908 3300026067 Bacteria 8364
940 Ga0207678_10047155 3300026067 Bacteria 3727
941 Ga0207678_10087743 3300026067 Bacteria 2658
942 Ga0207708_10000339 3300026075 Bacteria 36860
943 Ga0207708_10016794 3300026075 Bacteria 5510
944 Ga0207708_10032759 3300026075 Bacteria 3945
945 Ga0207708_10089011 3300026075 Bacteria 2378
946 Ga0207708_10572825 3300026075 Bacteria 954
947 Ga0207702_10005967 3300026078 Bacteria 10580
948 Ga0207702_10049228 3300026078 Bacteria 3556
949 Ga0207702_10276483 3300026078 Bacteria 1586
950 Ga0207702_10410535 3300026078 Bacteria 1307
951 Ga0207641_10000752 3300026088 Bacteria 34898
952 Ga0207641_10004027 3300026088 Bacteria 12826
953 Ga0207641_10024043 3300026088 Bacteria 5021
954 Ga0207641_10037230 3300026088 Bacteria 4062
955 Ga0207641_10039963 3300026088 Bacteria 3924
956 Ga0207641_10054235 3300026088 Bacteria 3401
957 Ga0207641_10122809 3300026088 Bacteria 2320
958 Ga0207641_10145654 3300026088 Bacteria 2141
959 Ga0207641_10213119 3300026088 Bacteria 1787
960 Ga0207641_10217394 3300026088 Bacteria 1770
961 Ga0207641_10238900 3300026088 Bacteria 1692
962 Ga0207641_10262816 3300026088 Bacteria 1617
963 Ga0207641_10325957 3300026088 Bacteria 1457
964 Ga0207641_10433646 3300026088 Bacteria 1267
965 Ga0207648_10001237 3300026089 Bacteria 28700
966 Ga0207648_10001707 3300026089 Bacteria 24034
967 Ga0207648_10003601 3300026089 Bacteria 16199
968 Ga0207648_10011188 3300026089 Bacteria 8461
969 Ga0207648_10024722 3300026089 Bacteria 5358
970 Ga0207648_10028555 3300026089 Bacteria 4945
971 Ga0207648_10033330 3300026089 Bacteria 4543
972 Ga0207648_10069438 3300026089 Bacteria 3070
973 Ga0207648_10071055 3300026089 Bacteria 3034
974 Ga0207648_10072700 3300026089 Bacteria 2997
975 Ga0207648_10096223 3300026089 Bacteria 2591
976 Ga0207648_10107786 3300026089 Bacteria 2445
977 Ga0207648_10140668 3300026089 Bacteria 2127
978 Ga0207648_10261584 3300026089 Bacteria 1544
979 Ga0207648_10442163 3300026089 Bacteria 1183
980 Ga0207676_10000321 3300026095 Bacteria 41273
981 Ga0207676_10004019 3300026095 Bacteria 10379
982 Ga0207676_10011985 3300026095 Bacteria 6204
983 Ga0207676_10014275 3300026095 Bacteria 5711
984 Ga0207676_10028133 3300026095 Bacteria 4196
985 Ga0207676_10069331 3300026095 Bacteria 2823
986 Ga0207676_10081234 3300026095 Bacteria 2633
987 Ga0207676_10081493 3300026095 Bacteria 2629
988 Ga0207676_10091044 3300026095 Bacteria 2505
989 Ga0207676_10104687 3300026095 Bacteria 2354
990 Ga0207676_10153053 3300026095 Bacteria 1989
991 Ga0207676_10340100 3300026095 Bacteria 1384
992 Ga0207676_10987628 3300026095 Bacteria 829
993 Ga0207674_10021022 3300026116 Bacteria 7038
994 Ga0207674_10030420 3300026116 Bacteria 5676
995 Ga0207674_10149967 3300026116 Bacteria 2289
996 Ga0207675_100000483 3300026118 Bacteria 38723
997 Ga0207675_100001346 3300026118 Bacteria 24652
998 Ga0207675_100005511 3300026118 Bacteria 12106
999 Ga0207675_100008701 3300026118 Bacteria 9541
1000 Ga0207675_100050176 3300026118 Bacteria 3893
1001 Ga0207675_100061354 3300026118 Bacteria 3510
1002 Ga0207675_100107857 3300026118 Bacteria 2626
1003 Ga0207675_100744898 3300026118 Bacteria 991
1004 Ga0207675_100984949 3300026118 Bacteria 861
1005 Ga0207683_10000560 3300026121 Bacteria 34398
1006 Ga0207683_10001777 3300026121 Bacteria 19086
1007 Ga0207683_10008933 3300026121 Bacteria 8537
1008 Ga0207683_10013769 3300026121 Bacteria 6897
1009 Ga0207683_10018350 3300026121 Bacteria 5967
1010 Ga0207683_10054978 3300026121 Bacteria 3491
1011 Ga0207683_10070423 3300026121 Bacteria 3090
1012 Ga0207683_10089135 3300026121 Bacteria 2745
1013 Ga0207683_10122968 3300026121 Bacteria 2331
1014 Ga0207683_10204178 3300026121 Bacteria 1797
1015 Ga0207683_10311791 3300026121 Bacteria 1440
1016 Ga0207683_10379781 3300026121 Bacteria 1299
1017 Ga0207683_10644585 3300026121 Bacteria 981
1018 Ga0207698_10002785 3300026142 Bacteria 10434
1019 Ga0207698_10012873 3300026142 Bacteria 5495
1020 Ga0207698_10028423 3300026142 Bacteria 3987
1021 Ga0207698_10074651 3300026142 Bacteria 2706
1022 Ga0207698_10077876 3300026142 Bacteria 2660
1023 Ga0207698_10108288 3300026142 Bacteria 2322
1024 Ga0207698_10172749 3300026142 Bacteria 1905
1025 Ga0207698_10520713 3300026142 Bacteria 1160
1026 Ga0207698_10543536 3300026142 Bacteria 1137
1027 Ga0209813_10012456 3300027866 Bacteria 2248
1028 Ga0209974_10015378 3300027876 Unclassified 2541
1029 Ga0207428_10006397 3300027907 Bacteria 10886
1030 Ga0207428_10011690 3300027907 Bacteria 7741
1031 Ga0207428_10197016 3300027907 Bacteria 1516
1032 Ga0268266_10068538 3300028379 Bacteria 3072
1033 Ga0268266_10288593 3300028379 Bacteria 1527
1034 Ga0268265_10005960 3300028380 Bacteria 8298
1035 Ga0268265_10024509 3300028380 Bacteria 4270
1036 Ga0268265_10030690 3300028380 Bacteria 3874
1037 Ga0268265_10035646 3300028380 Unclassified 3638
1038 Ga0268265_10280095 3300028380 Bacteria 1492
1039 Ga0268265_10305026 3300028380 Bacteria 1435
1040 Ga0268265_10606338 3300028380 Bacteria 1047
1041 Ga0268265_10609114 3300028380 Bacteria 1045
1042 Ga0268265_10814190 3300028380 Bacteria 911
1043 Ga0268264_10003429 3300028381 Bacteria 13675
1044 Ga0268264_10007734 3300028381 Bacteria 8950
1045 Ga0268264_10007952 3300028381 Bacteria 8823
1046 Ga0268264_10010012 3300028381 Bacteria 7850
1047 Ga0268264_10014230 3300028381 Bacteria 6542
1048 Ga0268264_10078660 3300028381 Bacteria 2812
1049 Ga0268264_10086946 3300028381 Bacteria 2687
1050 Ga0268264_10103717 3300028381 Bacteria 2477
1051 Ga0268264_10484929 3300028381 Unclassified 1203
1052 Ga0268264_10525619 3300028381 Unclassified 1157
1053 Ga0268264_10693446 3300028381 Bacteria 1011
1054 Ga0268264_10753303 3300028381 Bacteria 970
1055 Ga0268264_10876919 3300028381 Unclassified 900
1056 Ga0265334_10009731 3300028573 Bacteria 4062
1057 Ga0307515_10000160 3300028794 Bacteria 164789
1058 Ga0265332_10072373 3300031238 Bacteria 1467
1059 Ga0265329_10031847 3300031242 Bacteria 1711
1060 Ga0265340_10004883 3300031247 Bacteria 7461
1061 Ga0307408_100130640 3300031548 Bacteria 1959
1062 Ga0265314_10006621 3300031711 Bacteria 10193
1063 Ga0265342_10247687 3300031712 Bacteria 952
1064 Ga0307516_10253258 3300031730 Bacteria 1454
1065 Ga0307405_10005946 3300031731 Bacteria 5953
1066 Ga0307405_10010162 3300031731 Bacteria 4860
1067 Ga0307405_10369385 3300031731 Bacteria 1113
1068 Ga0307406_10141937 3300031901 Bacteria 1701
1069 Ga0307406_10169780 3300031901 Bacteria 1577
1070 Ga0307407_10130493 3300031903 Bacteria 1607
1071 Ga0307412_10191360 3300031911 Bacteria 1547
1072 Ga0307409_100004657 3300031995 Bacteria 7752
1073 Ga0307409_100018572 3300031995 Bacteria 4680
1074 Ga0307409_100859528 3300031995 Bacteria 918
1075 Ga0307416_100002875 3300032002 Bacteria 10032
1076 Ga0307416_100308414 3300032002 Bacteria 1578
1077 Ga0307416_100501579 3300032002 Bacteria 1278
1078 Ga0307416_101973357 3300032002 Unclassified 686
1079 Ga0307414_10085825 3300032004 Bacteria 2321
1080 Ga0307414_10111654 3300032004 Bacteria 2082
1081 Ga0307411_10004827 3300032005 Bacteria 6537
1082 Ga0307415_100000806 3300032126 Bacteria 14247
1083 Ga0307415_100412129 3300032126 Bacteria 1157
1084 Ga0373944_0035774 3300035089 Bacteria 1515
1085 Ga0373944_0099205 3300035089 Bacteria 982
1086 Ga0373944_0122343 3300035089 Bacteria 898
1087 Ga0373944_0129615 3300035089 Bacteria 876
1088 Ga0373923_0029877 3300035111 Bacteria 2188
1089 Ga0373923_0053421 3300035111 Bacteria 1699
1090 Ga0373923_0056872 3300035111 Bacteria 1653
1091 Ga0373932_0055888 3300035112 Bacteria 1185
1092 Ga0373932_0080226 3300035112 Bacteria 1029
1093 Ga0373936_0005518 3300035113 Bacteria 4772
1094 Ga0373936_0108097 3300035113 Bacteria 1179
1095 Ga0373936_0124783 3300035113 Unclassified 1103
1096 Ga0373945_0055611 3300035116 Bacteria 1466
1097 Ga0373953_0008470 3300035117 Bacteria 3494
1098 Ga0373953_0015026 3300035117 Bacteria 2796
1099 Ga0373953_0017420 3300035117 Bacteria 2640
1100 Ga0373953_0038239 3300035117 Bacteria 1897
1101 Ga0373953_0071143 3300035117 Bacteria 1435
1102 Ga0373954_0008753 3300035118 Bacteria 4450
1103 Ga0373954_0013064 3300035118 Bacteria 3696
1104 Ga0373954_0026046 3300035118 Bacteria 2678
1105 Ga0373954_0049248 3300035118 Bacteria 1975
1106 Ga0373954_0060709 3300035118 Bacteria 1784
1107 Ga0373956_0013019 3300035119 Bacteria 3457
1108 Ga0373956_0015251 3300035119 Bacteria 3215
1109 Ga0373956_0073290 3300035119 Bacteria 1564
1110 Ga0373956_0078215 3300035119 Bacteria 1515
1111 Ga0373956_0081138 3300035119 Bacteria 1489
1112 Ga0373957_0022587 3300035120 Bacteria 2242
1113 Ga0373957_0028787 3300035120 Bacteria 2026
1114 Ga0373957_0030865 3300035120 Bacteria 1966
1115 Ga0373957_0122860 3300035120 Bacteria 1052
1116 Ga0373960_0128479 3300035121 Bacteria 848
1117 Ga0373943_0016215 3300035170 Bacteria 3395
1118 Ga0373943_0027792 3300035170 Bacteria 2661
1119 Ga0373943_0052145 3300035170 Bacteria 2016
1120 Ga0373943_0089570 3300035170 Bacteria 1591
1121 Ga0373943_0149243 3300035170 Bacteria 1265
1122 Ga0373946_0016567 3300035171 Bacteria 2809
1123 Ga0373946_0055669 3300035171 Bacteria 1668
1124 Ga0373946_0094870 3300035171 Bacteria 1328
1125 Ga0373955_0005149 3300035172 Bacteria 5848
1126 Ga0373955_0005891 3300035172 Bacteria 5541
1127 Ga0373955_0016144 3300035172 Bacteria 3670
1128 Ga0373955_0019232 3300035172 Bacteria 3409
1129 Ga0373955_0283010 3300035172 Bacteria 998
1130 Ga0373924_0004699 3300035410 Bacteria 4792
1131 Ga0373931_0030260 3300035691 Bacteria 2786
1132 Ga0373931_0202044 3300035691 Bacteria 1188
1133 Ga0373935_0022627 3300035692 Bacteria 3856
1134 Ga0373935_0097459 3300035692 Bacteria 1934
1135 Ga0373935_0291398 3300035692 Bacteria 1151
1136 Ga0373927_0031072 3300035695 Bacteria 3483
1137 Ga0373927_0044913 3300035695 Bacteria 2858
1138 Ga0373927_0215762 3300035695 Bacteria 1260
1139 Ga0373927_0299437 3300035695 Bacteria 1058
1140 Ga0373933_0002809 3300035724 Bacteria 9730
1141 Ga0373933_0017560 3300035724 Bacteria 4014
1142 Ga0373933_0022005 3300035724 Bacteria 3627
1143 Ga0373933_0046627 3300035724 Bacteria 2574
1144 Ga0373947_0016734 3300035725 Bacteria 4213
1145 Ga0373947_0017986 3300035725 Bacteria 4067
1146 Ga0373937_0027458 3300036401 Bacteria 5147
1147 Ga0373937_0029937 3300036401 Bacteria 4931
1148 Ga0373937_0039848 3300036401 Bacteria 4281
1149 Ga0373937_0107371 3300036401 Bacteria 2595
1150 Ga0373937_0144363 3300036401 Bacteria 2227
1151 Ga0373937_0185947 3300036401 Bacteria 1951
1152 Ga0373937_0194369 3300036401 Bacteria 1907
1153 Ga0373937_0230801 3300036401 Unclassified 1743
1154 Ga0373937_0472803 3300036401 Bacteria 1190
1155 Ga0373937_1154884 3300036401 Bacteria 723
1156 Ga0373925_0000590 3300037068 Bacteria 34985
1157 Ga0373925_0014725 3300037068 Bacteria 5650
1158 Ga0373925_0049162 3300037068 Bacteria 3143
1159 Ga0373925_0086835 3300037068 Bacteria 2387
1160 Ga0373925_0344590 3300037068 Bacteria 1209
1161 Ga0395905_0131297 3300037471 Bacteria 2356
1162 Ga0395905_0285391 3300037471 Bacteria 1537
1163 Ga0436365_0044041 3300039437 Bacteria 6594
1164 Ga0436365_0509827 3300039437 Bacteria 16068
1165 Ga0436365_0654623 3300039437 Bacteria 4824
1166 Ga0436365_1188319 3300039437 Bacteria 4916
1167 Ga0436365_1580088 3300039437 Bacteria 2139
1168 Ga0451802_2192821 3300041460 Bacteria 721
1169 Ga0451807_1243004 3300041486 Bacteria 689
1170 Ga0451853_3113361 3300041512 Bacteria 856
1171 Ga0439459_0034393 3300042438 Bacteria 1048
1172 Ga0439464_0029458 3300042439 Bacteria 1534
1173 Ga0451577_0089001 3300042876 Bacteria 2755
1174 Ga0451577_0206572 3300042876 Bacteria 1774
1175 Ga0453683_0389002 3300044673 Unclassified 898
1176 Ga0466966_0022936 3300044684 Bacteria 4090
1177 Ga0466961_0140868 3300044693 Bacteria 1510
1178 Ga0453684_0152163 3300044712 Bacteria 2748
1179 Ga0466957_0007806 3300044842 Bacteria 6061
1180 Ga0495592_0004280 3300046454 Bacteria 10436
1181 Ga0495629_0004517 3300046459 Bacteria 10406
1182 Ga0495629_0036914 3300046459 Bacteria 3447
1183 Ga0495641_0008028 3300046461 Bacteria 6500
1184 Ga0495651_0013540 3300046462 Bacteria 6308
1185 Ga0495651_0108139 3300046462 Bacteria 2060
1186 Ga0495653_0054127 3300046463 Bacteria 3067
1187 Ga0495653_0138294 3300046463 Bacteria 1716
1188 Ga0495580_0010020 3300046472 Bacteria 7411
1189 Ga0495580_0041252 3300046472 Bacteria 3291
1190 Ga0495580_0097474 3300046472 Bacteria 2045
1191 Ga0495582_0006591 3300046473 Bacteria 6446
1192 Ga0495582_0037452 3300046473 Bacteria 2668
1193 Ga0495582_0146696 3300046473 Bacteria 1339
1194 Ga0495639_0009584 3300046475 Bacteria 4156
1195 Ga0495639_0027364 3300046475 Bacteria 2523
1196 Ga0495662_0011736 3300046476 Bacteria 4282
1197 Ga0495662_0013757 3300046476 Bacteria 3939
1198 Ga0495664_0005933 3300046477 Bacteria 6727
1199 Ga0495664_0022044 3300046477 Bacteria 3685
1200 Ga0495664_0165746 3300046477 Unclassified 1341
1201 Ga0495594_0249068 3300046499 Bacteria 1012
1202 Ga0495594_0277272 3300046499 Bacteria 955
1203 Ga0495583_0190637 3300046506 Bacteria 836
1204 Ga0495608_0047993 3300046511 Bacteria 2837
1205 Ga0495608_0111049 3300046511 Bacteria 1763
1206 Ga0495610_0038677 3300046512 Bacteria 2420
1207 Ga0495618_0072506 3300046514 Bacteria 2191
1208 Ga0495628_0048888 3300046516 Bacteria 3350
1209 Ga0495628_0048954 3300046516 Bacteria 3348
1210 Ga0495628_0592273 3300046516 Bacteria 793
1211 Ga0495630_0002675 3300046517 Bacteria 12352
1212 Ga0495630_0097748 3300046517 Bacteria 2220
1213 Ga0495630_0462378 3300046517 Bacteria 972
1214 Ga0495630_0503402 3300046517 Bacteria 929
1215 Ga0495630_0603413 3300046517 Unclassified 841
1216 Ga0495632_0008154 3300046519 Bacteria 6475
1217 Ga0495666_0007756 3300046526 Bacteria 5372
1218 Ga0495642_0076167 3300046528 Bacteria 1408
1219 Ga0495652_0040636 3300046529 Bacteria 4020
1220 Ga0495652_0128538 3300046529 Bacteria 2009
1221 Ga0495665_0012575 3300046531 Bacteria 4582
1222 Ga0495640_0086011 3300046533 Bacteria 2082
1223 Ga0495586_0028955 3300046535 Bacteria 2964
1224 Ga0495586_0156708 3300046535 Bacteria 1283
1225 Ga0495587_0012025 3300046536 Bacteria 5466
1226 Ga0495587_0016689 3300046536 Bacteria 4566
1227 Ga0495587_0247090 3300046536 Unclassified 1003
1228 Ga0495598_0061443 3300046537 Bacteria 1160
1229 Ga0495598_0072410 3300046537 Bacteria 1088
1230 Ga0495598_0197933 3300046537 Bacteria 724
1231 Ga0495621_0064307 3300046539 Bacteria 1338
1232 Ga0495621_0099235 3300046539 Bacteria 1106
1233 Ga0495645_0006456 3300046543 Bacteria 8136
1234 Ga0495645_0010359 3300046543 Bacteria 6533
1235 Ga0495667_0005937 3300046559 Bacteria 8265
1236 Ga0495667_0027975 3300046559 Bacteria 3796
1237 Ga0495667_0029290 3300046559 Bacteria 3705
1238 Ga0495667_0031510 3300046559 Bacteria 3558
1239 Ga0495667_0130112 3300046559 Unclassified 1624
1240 Ga0495634_0018098 3300046642 Bacteria 5019
1241 Ga0495634_0093565 3300046642 Bacteria 1949
1242 Ga0495634_0326900 3300046642 Bacteria 922
1243 Ga0495634_0440742 3300046642 Bacteria 770
1244 Ga0495635_0006436 3300046663 Bacteria 8188
1245 Ga0495635_0019453 3300046663 Bacteria 4733
1246 Ga0495635_0083582 3300046663 Bacteria 2185
1247 Ga0495635_0405620 3300046663 Unclassified 905
1248 Ga0495657_0042533 3300046675 Bacteria 3101
1249 Ga0495657_0231640 3300046675 Bacteria 1117
1250 Ga0495599_0022453 3300046678 Bacteria 3939
1251 Ga0495599_0090840 3300046678 Bacteria 1905
1252 Ga0495599_0134449 3300046678 Bacteria 1535
1253 Ga0495623_0052908 3300046679 Bacteria 2565
1254 Ga0495647_0003744 3300046681 Bacteria 4885
1255 Ga0495647_0018180 3300046681 Bacteria 2498
1256 Ga0495647_0066163 3300046681 Bacteria 1437
1257 Ga0495658_0015569 3300046683 Bacteria 3902
1258 Ga0495658_0032824 3300046683 Bacteria 2837
1259 Ga0495658_0052053 3300046683 Bacteria 2321
1260 Ga0495658_0052117 3300046683 Bacteria 2319
1261 Ga0495658_0121369 3300046683 Bacteria 1581
1262 Ga0495658_0263794 3300046683 Bacteria 1084
1263 Ga0495669_0041118 3300046684 Bacteria 2052
1264 Ga0495613_0124840 3300046689 Bacteria 1846
1265 Ga0495613_0213592 3300046689 Bacteria 1356
1266 Ga0495624_0138155 3300046690 Bacteria 1493
1267 Ga0495624_0395440 3300046690 Bacteria 830
1268 Ga0495649_0002253 3300046694 Bacteria 13702
1269 Ga0495589_0280508 3300046794 Bacteria 775
1270 Ga0495600_0006964 3300046809 Bacteria 6897
1271 Ga0495600_0078997 3300046809 Bacteria 2148
1272 Ga0495600_0344134 3300046809 Bacteria 935
1273 Ga0495660_0031107 3300046810 Bacteria 3003
1274 Ga0495581_0293479 3300047315 Bacteria 950
1275 Ga0495604_0031779 3300047317 Bacteria 4186
1276 Ga0495604_0120134 3300047317 Bacteria 1903
1277 Ga0495604_0370748 3300047317 Bacteria 948
1278 Ga0495674_0002348 3300047319 Bacteria 18570
1279 Ga0495674_0100401 3300047319 Bacteria 2463
1280 Ga0495674_0488673 3300047319 Unclassified 986
1281 Ga0495674_0835783 3300047319 Bacteria 714
1282 Ga0495680_0009463 3300047322 Bacteria 8763
1283 Ga0495680_0095135 3300047322 Bacteria 2227
1284 Ga0495680_0131659 3300047322 Bacteria 1837
1285 Ga0495680_0196178 3300047322 Unclassified 1450
1286 Ga0495675_0091819 3300047444 Bacteria 1905
1287 Ga0495684_0037006 3300047471 Bacteria 3741
1288 Ga0495684_0044127 3300047471 Bacteria 3413
1289 Ga0495684_0090417 3300047471 Bacteria 2319
1290 Ga0495684_0214035 3300047471 Bacteria 1415
1291 Ga0495686_0380268 3300047472 Bacteria 762
1292 Ga0495593_0076227 3300047673 Bacteria 1738
1293 Ga0495602_0111055 3300048088 Bacteria 2227
1294 Ga0495614_0023691 3300048089 Bacteria 2650
1295 Ga0495614_0168839 3300048089 Bacteria 981
1296 Ga0495615_0007312 3300048090 Bacteria 2091
1297 Ga0495626_0060463 3300048091 Bacteria 1726
1298 Ga0496100_0676073 3300048903 Bacteria 805
1299 Ga0496101_0182373 3300048904 Bacteria 1617
1300 Ga0496101_0266465 3300048904 Bacteria 1337
1301 Ga0496102_0050224 3300048905 Bacteria 3797
1302 Ga0496103_0276486 3300048906 Bacteria 1080
1303 Ga0496104_0015350 3300048907 Bacteria 6936
1304 Ga0496104_0396043 3300048907 Bacteria 1293
1305 Ga0496105_0011726 3300048908 Bacteria 6937
1306 Ga0496105_0093632 3300048908 Bacteria 2481
1307 Ga0496105_0465107 3300048908 Bacteria 997
1308 Ga0496106_0005518 3300048909 Bacteria 9359
1309 Ga0496106_0169668 3300048909 Unclassified 1729
1310 Ga0496106_0467593 3300048909 Bacteria 1013
1311 Ga0496107_0043478 3300048910 Bacteria 3228
1312 Ga0496108_0080524 3300048911 Bacteria 2759
1313 Ga0496108_0146506 3300048911 Bacteria 2036
1314 Ga0496108_0262943 3300048911 Bacteria 1502
1315 Ga0496108_1565426 3300048911 Unclassified 546
1316 Ga0496109_0066764 3300048912 Bacteria 3295
1317 Ga0496109_0355518 3300048912 Bacteria 1384
1318 Ga0496109_0430597 3300048912 Bacteria 1246
1319 Ga0496109_0642153 3300048912 Bacteria 998
1320 Ga0496110_0033803 3300048913 Bacteria 4426
1321 Ga0496112_0014655 3300048915 Bacteria 7285
1322 Ga0496113_0036349 3300048916 Bacteria 3608
1323 Ga0496113_0698034 3300048916 Unclassified 810
1324 Ga0496114_0052127 3300048917 Bacteria 3408
1325 Ga0496114_0166002 3300048917 Bacteria 1922
1326 Ga0496114_0210490 3300048917 Bacteria 1705
1327 Ga0496114_0455773 3300048917 Bacteria 1132
1328 Ga0496114_0528971 3300048917 Bacteria 1042
1329 Ga0496115_0018119 3300048918 Bacteria 5398
1330 Ga0496115_0281847 3300048918 Bacteria 1364
1331 Ga0501033_0144320 3300049570 Bacteria 1720
1332 Ga0501036_0432085 3300049572 Bacteria 1098
1333 Ga0501047_0049714 3300049581 Bacteria 4048
1334 Ga0501073_0239206 3300049589 Bacteria 1254
1335 Ga0501044_0208215 3300049823 Bacteria 1911
1336 Ga0501044_0266065 3300049823 Bacteria 1652
1337 Ga0501044_0943172 3300049823 Bacteria 736
1338 nmdc:mga03683_17420_c1 3300050489 Bacteria 2719
1339 nmdc:mga03683_26951_c1 3300050489 Bacteria 2272
1340 nmdc:mga03683_4319_c1 3300050489 Bacteria 4699
1341 nmdc:mga03683_6208_c1 3300050489 Bacteria 4078
1342 nmdc:mga03683_84605_c1 3300050489 Bacteria 1375
1343 nmdc:mga03n38_124702_c1 3300050490 Bacteria 1270
1344 nmdc:mga03n38_218743_c1 3300050490 Bacteria 993
1345 nmdc:mga03n38_462454_c1 3300050490 Bacteria 707
1346 nmdc:mga00v17_280796_c1 3300050491 Bacteria 1081
1347 nmdc:mga00v17_81764_c1 3300050491 Bacteria 2018
1348 nmdc:mga0yw44_44615_c1 3300050492 Bacteria 2652
1349 nmdc:mga0yw44_479291_c1 3300050492 Unclassified 844
1350 nmdc:mga0yw44_59622_c1 3300050492 Bacteria 2335
1351 nmdc:mga0k408_123467_c1 3300050493 Bacteria 1535
1352 nmdc:mga0k408_213302_c1 3300050493 Bacteria 1153
1353 nmdc:mga0k408_6670_c1 3300050493 Bacteria 3085
1354 nmdc:mga06z11_161470_c1 3300050494 Bacteria 1281
1355 nmdc:mga06z11_199255_c1 3300050494 Bacteria 1162
1356 nmdc:mga06z11_27223_c1 3300050494 Bacteria 2732
1357 nmdc:mga06z11_81624_c1 3300050494 Bacteria 1736
1358 nmdc:mga07m45_16943_c1 3300050496 Bacteria 3906
1359 nmdc:mga07m45_178719_c1 3300050496 Bacteria 1234
1360 nmdc:mga07m45_70388_c1 3300050496 Bacteria 1990
1361 nmdc:mga07m45_81342_c1 3300050496 Bacteria 1849
1362 nmdc:mga09592_240195_c1 3300050508 Bacteria 1570
1363 nmdc:mga08y16_1170550_c1 3300050511 Bacteria 741
1364 nmdc:mga08y16_16406_c1 3300050511 Bacteria 7787
1365 nmdc:mga08y16_256430_c1 3300050511 Bacteria 1806
1366 nmdc:mga08y16_41859_c1 3300050511 Bacteria 4797
1367 nmdc:mga08y16_5508_c1 3300050511 Bacteria 13243
1368 nmdc:mga08y16_730642_c1 3300050511 Bacteria 987
1369 nmdc:mga0n895_31413_c1 3300050512 Bacteria 5085
1370 nmdc:mga0n895_613323_c1 3300050512 Bacteria 1089
1371 nmdc:mga0rr50_120913_c1 3300050513 Bacteria 2084
1372 nmdc:mga0rr50_218741_c1 3300050513 Bacteria 1572
1373 nmdc:mga0sz30_130066_c1 3300050516 Bacteria 1109
1374 nmdc:mga0sz30_36350_c1 3300050516 Bacteria 2058
1375 nmdc:mga0sz30_55071_c1 3300050516 Bacteria 1692
1376 nmdc:mga0sz30_880_c1 3300050516 Bacteria 10810
1377 Ga0495601_0026485 3300053077 Bacteria 3580
1378 Ga0495601_0254150 3300053077 Bacteria 1147
1379 Ga0500610_0153470 3300053079 Bacteria 1152
1380 Ga0495595_0001216 3300053084 Bacteria 10017
1381 Ga0495595_0214727 3300053084 Bacteria 959
1382 Ga0495619_0003508 3300053085 Bacteria 10115
1383 Ga0495619_0008409 3300053085 Bacteria 6527
1384 Ga0495619_0125877 3300053085 Bacteria 1758
1385 Ga0495619_0220802 3300053085 Bacteria 1313
1386 Ga0500644_0136476 3300053088 Bacteria 971
1387 Ga0500646_0002991 3300053090 Bacteria 4337
1388 Ga0500641_0000921 3300053096 Bacteria 10489
1389 Ga0500642_0113679 3300053130 Bacteria 1265
1390 Ga0500568_0020600 3300053139 Bacteria 2849
1391 Ga0500616_0002479 3300053153 Bacteria 15306
1392 Ga0500616_0003288 3300053153 Bacteria 12474

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048911 Ga0496108_1565426 Ga0496108_1565426_79_525 148
2 3300031911 Ga0307412_10191360 Ga0307412_101913602 168
3 3300037068 Ga0373925_0086835 Ga0373925_0086835_1523_2140 171
4 3300046459 Ga0495629_0036914 Ga0495629_0036914_2229_2846 171
5 3300046506 Ga0495583_0190637 Ga0495583_0190637_39_653 171
6 3300046512 Ga0495610_0038677 Ga0495610_0038677_1719_2333 171
7 3300046519 Ga0495632_0008154 Ga0495632_0008154_5665_6279 171
8 3300046642 Ga0495634_0440742 Ga0495634_0440742_81_698 171
9 3300046683 Ga0495658_0052117 Ga0495658_0052117_1114_1731 171
10 3300046694 Ga0495649_0002253 Ga0495649_0002253_3449_4063 171
11 3300046810 Ga0495660_0031107 Ga0495660_0031107_1442_2056 171
12 3300047472 Ga0495686_0380268 Ga0495686_0380268_64_678 171
13 3300048091 Ga0495626_0060463 Ga0495626_0060463_153_767 171
14 3300005355 Ga0070671_100079418 Ga0070671_1000794184 177
15 3300006353 Ga0075370_10348858 Ga0075370_103488581 177
16 3300005331 Ga0070670_100008848 Ga0070670_1000088484 178
17 3300005364 Ga0070673_100077006 Ga0070673_1000770062 178
18 3300005456 Ga0070678_100015721 Ga0070678_1000157212 178
19 3300005543 Ga0070672_100006960 Ga0070672_1000069602 178
20 3300005618 Ga0068864_100003424 Ga0068864_1000034246 178
21 3300006237 Ga0097621_100527554 Ga0097621_1005275542 178
22 3300006358 Ga0068871_100029581 Ga0068871_1000295816 178
23 3300013308 Ga0157375_10003501 Ga0157375_100035012 178
24 3300014325 Ga0163163_10415278 Ga0163163_104152782 178
25 3300014969 Ga0157376_10732408 Ga0157376_107324082 178
26 3300025893 Ga0207682_10043767 Ga0207682_100437672 178
27 3300025925 Ga0207650_10027703 Ga0207650_100277031 178
28 3300025931 Ga0207644_10175505 Ga0207644_101755052 178
29 3300025940 Ga0207691_10004195 Ga0207691_100041951 178
30 3300026121 Ga0207683_10013769 Ga0207683_100137698 178
31 3300009553 Ga0105249_10046417 Ga0105249_100464172 180
32 3300031730 Ga0307516_10253258 Ga0307516_102532582 180
33 3300005338 Ga0068868_100300109 Ga0068868_1003001092 181
34 3300005340 Ga0070689_100154692 Ga0070689_1001546923 181
35 3300006178 Ga0075367_10174635 Ga0075367_101746352 181
36 3300025908 Ga0207643_10285415 Ga0207643_102854152 181
37 3300025936 Ga0207670_10114383 Ga0207670_101143831 181
38 3300025923 Ga0207681_10276361 Ga0207681_102763612 182
39 3300026121 Ga0207683_10018350 Ga0207683_100183502 182
40 3300031731 Ga0307405_10005946 Ga0307405_100059463 182
41 3300031901 Ga0307406_10169780 Ga0307406_101697802 182
42 3300031995 Ga0307409_100004657 Ga0307409_1000046576 182
43 3300032002 Ga0307416_100002875 Ga0307416_1000028752 182
44 3300032126 Ga0307415_100000806 Ga0307415_10000080612 182
45 3300035170 Ga0373943_0027792 Ga0373943_0027792_676_1296 182
46 3300035695 Ga0373927_0215762 Ga0373927_0215762_188_808 182
47 3300005718 Ga0068866_10001518 Ga0068866_100015187 183
48 3300005719 Ga0068861_100714402 Ga0068861_1007144022 183
49 3300005844 Ga0068862_100032782 Ga0068862_1000327825 183
50 3300005844 Ga0068862_100529992 Ga0068862_1005299922 183
51 3300006844 Ga0075428_100006182 Ga0075428_1000061824 183
52 3300006880 Ga0075429_100013984 Ga0075429_1000139843 183
53 3300009094 Ga0111539_10074827 Ga0111539_100748273 183
54 3300026118 Ga0207675_100984949 Ga0207675_1009849492 183
55 3300027907 Ga0207428_10011690 Ga0207428_100116903 183
56 3300028380 Ga0268265_10035646 Ga0268265_100356465 183
57 3300035171 Ga0373946_0094870 Ga0373946_0094870_299_919 183
58 3300050508 nmdc:mga09592_240195_c1 nmdc:mga09592_240195_c1_139_756 183
59 3300050511 nmdc:mga08y16_16406_c1 nmdc:mga08y16_16406_c1_1589_2206 183
60 3300006038 Ga0075365_10096040 Ga0075365_100960403 185
61 3300006042 Ga0075368_10251754 Ga0075368_102517541 185
62 3300009094 Ga0111539_10292169 Ga0111539_102921694 185
63 3300025901 Ga0207688_10241584 Ga0207688_102415842 185
64 3300050494 nmdc:mga06z11_161470_c1 nmdc:mga06z11_161470_c1_484_1101 185
65 3300050511 nmdc:mga08y16_256430_c1 nmdc:mga08y16_256430_c1_715_1332 185
66 3300006038 Ga0075365_10052880 Ga0075365_100528802 186
67 3300006048 Ga0075363_100103163 Ga0075363_1001031632 186
68 3300006051 Ga0075364_10181388 Ga0075364_101813882 186
69 3300006177 Ga0075362_10095200 Ga0075362_100952002 186
70 3300006178 Ga0075367_10012591 Ga0075367_100125913 186
71 3300006195 Ga0075366_10019894 Ga0075366_100198942 186
72 3300027866 Ga0209813_10012456 Ga0209813_100124562 186
73 3300050489 nmdc:mga03683_84605_c1 nmdc:mga03683_84605_c1_358_975 186
74 3300050490 nmdc:mga03n38_462454_c1 nmdc:mga03n38_462454_c1_53_670 186
75 3300050491 nmdc:mga00v17_280796_c1 nmdc:mga00v17_280796_c1_190_807 186
76 3300050493 nmdc:mga0k408_213302_c1 nmdc:mga0k408_213302_c1_211_828 186
77 3300050494 nmdc:mga06z11_27223_c1 nmdc:mga06z11_27223_c1_1631_2248 186
78 3300050496 nmdc:mga07m45_178719_c1 nmdc:mga07m45_178719_c1_211_828 186
79 3300050516 nmdc:mga0sz30_130066_c1 nmdc:mga0sz30_130066_c1_282_899 186
80 3300025938 Ga0207704_10178347 Ga0207704_101783473 189
81 3300035171 Ga0373946_0016567 Ga0373946_0016567_12_581 189
82 3300046529 Ga0495652_0128538 Ga0495652_0128538_1400_1969 189
83 3300053085 Ga0495619_0220802 Ga0495619_0220802_13_582 189
84 3300048088 Ga0495602_0111055 Ga0495602_0111055_1645_2217 190
85 3300046516 Ga0495628_0592273 Ga0495628_0592273_20_595 191
86 3300006177 Ga0075362_10042937 Ga0075362_100429372 192
87 3300050489 nmdc:mga03683_17420_c1 nmdc:mga03683_17420_c1_1006_1623 192
88 3300009094 Ga0111539_11358265 Ga0111539_113582652 193
89 3300027876 Ga0209974_10015378 Ga0209974_100153781 193
90 3300035119 Ga0373956_0078215 Ga0373956_0078215_813_1394 193
91 3300050511 nmdc:mga08y16_1170550_c1 nmdc:mga08y16_1170550_c1_73_681 193
92 3300005840 Ga0068870_10069691 Ga0068870_100696913 195
93 3300005444 Ga0070694_100375254 Ga0070694_1003752541 197
94 3300035112 Ga0373932_0080226 Ga0373932_0080226_213_830 197
95 3300035121 Ga0373960_0128479 Ga0373960_0128479_189_806 197
96 3300048912 Ga0496109_0642153 Ga0496109_0642153_61_678 197
97 3300028380 Ga0268265_10280095 Ga0268265_102800952 198
98 3300005329 Ga0070683_100596475 Ga0070683_1005964752 200
99 3300005985 Ga0081539_10084453 Ga0081539_100844533 201
100 3300005347 Ga0070668_100207112 Ga0070668_1002071122 202
101 3300005457 Ga0070662_100449161 Ga0070662_1004491612 202
102 3300005617 Ga0068859_100091360 Ga0068859_1000913602 202
103 3300005719 Ga0068861_100028906 Ga0068861_1000289063 202
104 3300005841 Ga0068863_100030397 Ga0068863_1000303976 202
105 3300005841 Ga0068863_100049754 Ga0068863_1000497543 202
106 3300005841 Ga0068863_100140627 Ga0068863_1001406274 202
107 3300005842 Ga0068858_100061660 Ga0068858_1000616604 202
108 3300006175 Ga0070712_100097376 Ga0070712_1000973763 202
109 3300006237 Ga0097621_100118849 Ga0097621_1001188492 202
110 3300006931 Ga0097620_100091362 Ga0097620_1000913622 202
111 3300009098 Ga0105245_10001111 Ga0105245_100011114 202
112 3300009101 Ga0105247_10021332 Ga0105247_100213323 202
113 3300009177 Ga0105248_10271262 Ga0105248_102712623 202
114 3300009177 Ga0105248_11421995 Ga0105248_114219952 202
115 3300009553 Ga0105249_10305316 Ga0105249_103053162 202
116 3300009553 Ga0105249_10394366 Ga0105249_103943661 202
117 3300013296 Ga0157374_10006996 Ga0157374_100069966 202
118 3300013297 Ga0157378_10004340 Ga0157378_100043403 202
119 3300013297 Ga0157378_10717327 Ga0157378_107173271 202
120 3300013308 Ga0157375_10108232 Ga0157375_101082322 202
121 3300014325 Ga0163163_10053567 Ga0163163_100535672 202
122 3300014968 Ga0157379_10100652 Ga0157379_101006524 202
123 3300017792 Ga0163161_10066616 Ga0163161_100666162 202
124 3300025907 Ga0207645_10059685 Ga0207645_100596852 202
125 3300025931 Ga0207644_10037450 Ga0207644_100374503 202
126 3300025933 Ga0207706_10302887 Ga0207706_103028872 202
127 3300025941 Ga0207711_10043400 Ga0207711_100434003 202
128 3300025941 Ga0207711_10107322 Ga0207711_101073223 202
129 3300025942 Ga0207689_10456658 Ga0207689_104566582 202
130 3300025960 Ga0207651_10031339 Ga0207651_100313394 202
131 3300025986 Ga0207658_10247004 Ga0207658_102470042 202
132 3300026023 Ga0207677_10207634 Ga0207677_102076342 202
133 3300026035 Ga0207703_10784358 Ga0207703_107843581 202
134 3300026088 Ga0207641_10024043 Ga0207641_100240432 202
135 3300026088 Ga0207641_10238900 Ga0207641_102389002 202
136 3300026089 Ga0207648_10028555 Ga0207648_100285554 202
137 3300028381 Ga0268264_10010012 Ga0268264_100100122 202
138 3300035113 Ga0373936_0124783 Ga0373936_0124783_252_860 202
139 3300035117 Ga0373953_0038239 Ga0373953_0038239_467_1075 202
140 3300035119 Ga0373956_0073290 Ga0373956_0073290_377_985 202
141 3300035695 Ga0373927_0031072 Ga0373927_0031072_1181_1789 202
142 3300035724 Ga0373933_0002809 Ga0373933_0002809_6780_7388 202
143 3300036401 Ga0373937_0027458 Ga0373937_0027458_884_1492 202
144 3300037068 Ga0373925_0344590 Ga0373925_0344590_138_746 202
145 3300041460 Ga0451802_2192821 Ga0451802_2192821_83_691 202
146 3300046517 Ga0495630_0503402 Ga0495630_0503402_117_725 202
147 3300046559 Ga0495667_0027975 Ga0495667_0027975_1263_1871 202
148 3300047317 Ga0495604_0370748 Ga0495604_0370748_59_667 202
149 3300047322 Ga0495680_0196178 Ga0495680_0196178_246_854 202
150 3300005331 Ga0070670_100571397 Ga0070670_1005713971 203
151 3300005618 Ga0068864_100020314 Ga0068864_1000203142 203
152 3300005841 Ga0068863_100181017 Ga0068863_1001810173 203
153 3300005843 Ga0068860_100103930 Ga0068860_1001039302 203
154 3300009177 Ga0105248_10293267 Ga0105248_102932671 203
155 3300009553 Ga0105249_10185072 Ga0105249_101850722 203
156 3300013296 Ga0157374_10272739 Ga0157374_102727391 203
157 3300014325 Ga0163163_10150794 Ga0163163_101507943 203
158 3300014326 Ga0157380_10179158 Ga0157380_101791582 203
159 3300026095 Ga0207676_10340100 Ga0207676_103401002 203
160 3300026118 Ga0207675_100744898 Ga0207675_1007448982 203
161 3300041512 Ga0451853_3113361 Ga0451853_3113361_55_666 203
162 3300005334 Ga0068869_100774744 Ga0068869_1007747442 204
163 3300005436 Ga0070713_100003830 Ga0070713_1000038303 204
164 3300005456 Ga0070678_100035836 Ga0070678_1000358362 204
165 3300005459 Ga0068867_100267203 Ga0068867_1002672032 204
166 3300005616 Ga0068852_100317066 Ga0068852_1003170662 204
167 3300005843 Ga0068860_100313456 Ga0068860_1003134562 204
168 3300006038 Ga0075365_10359992 Ga0075365_103599922 204
169 3300006175 Ga0070712_100366472 Ga0070712_1003664722 204
170 3300006175 Ga0070712_100596943 Ga0070712_1005969431 204
171 3300006871 Ga0075434_100054329 Ga0075434_1000543294 204
172 3300009093 Ga0105240_10205508 Ga0105240_102055082 204
173 3300009093 Ga0105240_10579172 Ga0105240_105791722 204
174 3300009098 Ga0105245_10501028 Ga0105245_105010282 204
175 3300009176 Ga0105242_10192379 Ga0105242_101923792 204
176 3300009177 Ga0105248_11035308 Ga0105248_110353082 204
177 3300009545 Ga0105237_10195445 Ga0105237_101954452 204
178 3300009553 Ga0105249_10480297 Ga0105249_104802972 204
179 3300010375 Ga0105239_10025477 Ga0105239_100254772 204
180 3300010375 Ga0105239_10209395 Ga0105239_102093952 204
181 3300013296 Ga0157374_10432518 Ga0157374_104325182 204
182 3300013306 Ga0163162_10325056 Ga0163162_103250562 204
183 3300013308 Ga0157375_11092619 Ga0157375_110926192 204
184 3300014325 Ga0163163_11477447 Ga0163163_114774471 204
185 3300014326 Ga0157380_11105266 Ga0157380_111052661 204
186 3300025913 Ga0207695_10150303 Ga0207695_101503032 204
187 3300025927 Ga0207687_10449556 Ga0207687_104495561 204
188 3300025940 Ga0207691_10314871 Ga0207691_103148712 204
189 3300025942 Ga0207689_10133953 Ga0207689_101339531 204
190 3300025942 Ga0207689_10913004 Ga0207689_109130042 204
191 3300026023 Ga0207677_10158782 Ga0207677_101587823 204
192 3300026035 Ga0207703_10495232 Ga0207703_104952321 204
193 3300026041 Ga0207639_10401536 Ga0207639_104015362 204
194 3300026089 Ga0207648_10261584 Ga0207648_102615843 204
195 3300026121 Ga0207683_10054978 Ga0207683_100549782 204
196 3300026142 Ga0207698_10074651 Ga0207698_100746512 204
197 3300028380 Ga0268265_10814190 Ga0268265_108141902 204
198 3300028381 Ga0268264_10753303 Ga0268264_107533031 204
199 3300031238 Ga0265332_10072373 Ga0265332_100723731 204
200 3300032002 Ga0307416_101973357 Ga0307416_1019733571 204
201 3300032126 Ga0307415_100412129 Ga0307415_1004121291 204
202 3300035089 Ga0373944_0129615 Ga0373944_0129615_244_858 204
203 3300035111 Ga0373923_0029877 Ga0373923_0029877_846_1460 204
204 3300035112 Ga0373932_0055888 Ga0373932_0055888_32_646 204
205 3300035113 Ga0373936_0005518 Ga0373936_0005518_3364_3978 204
206 3300035117 Ga0373953_0008470 Ga0373953_0008470_1222_1836 204
207 3300035118 Ga0373954_0008753 Ga0373954_0008753_1437_2051 204
208 3300035119 Ga0373956_0013019 Ga0373956_0013019_1186_1800 204
209 3300035120 Ga0373957_0022587 Ga0373957_0022587_959_1573 204
210 3300035170 Ga0373943_0089570 Ga0373943_0089570_632_1246 204
211 3300035172 Ga0373955_0016144 Ga0373955_0016144_1258_1872 204
212 3300035410 Ga0373924_0004699 Ga0373924_0004699_943_1557 204
213 3300035692 Ga0373935_0022627 Ga0373935_0022627_702_1316 204
214 3300035724 Ga0373933_0017560 Ga0373933_0017560_1652_2266 204
215 3300036401 Ga0373937_0144363 Ga0373937_0144363_477_1091 204
216 3300037068 Ga0373925_0014725 Ga0373925_0014725_3780_4394 204
217 3300039437 Ga0436365_1188319 Ga0436365_1188319_1493_2107 204
218 3300044684 Ga0466966_0022936 Ga0466966_0022936_2881_3495 204
219 3300044693 Ga0466961_0140868 Ga0466961_0140868_274_888 204
220 3300044842 Ga0466957_0007806 Ga0466957_0007806_995_1609 204
221 3300046454 Ga0495592_0004280 Ga0495592_0004280_3359_3973 204
222 3300046461 Ga0495641_0008028 Ga0495641_0008028_760_1374 204
223 3300046462 Ga0495651_0013540 Ga0495651_0013540_2680_3294 204
224 3300046463 Ga0495653_0054127 Ga0495653_0054127_1016_1630 204
225 3300046472 Ga0495580_0041252 Ga0495580_0041252_2201_2815 204
226 3300046473 Ga0495582_0037452 Ga0495582_0037452_1576_2190 204
227 3300046475 Ga0495639_0009584 Ga0495639_0009584_874_1488 204
228 3300046476 Ga0495662_0013757 Ga0495662_0013757_2548_3162 204
229 3300046477 Ga0495664_0022044 Ga0495664_0022044_2343_2957 204
230 3300046511 Ga0495608_0047993 Ga0495608_0047993_1383_1997 204
231 3300046514 Ga0495618_0072506 Ga0495618_0072506_1101_1715 204
232 3300046516 Ga0495628_0048888 Ga0495628_0048888_898_1512 204
233 3300046517 Ga0495630_0002675 Ga0495630_0002675_10454_11068 204
234 3300046517 Ga0495630_0462378 Ga0495630_0462378_293_907 204
235 3300046526 Ga0495666_0007756 Ga0495666_0007756_3622_4236 204
236 3300046528 Ga0495642_0076167 Ga0495642_0076167_172_786 204
237 3300046531 Ga0495665_0012575 Ga0495665_0012575_63_677 204
238 3300046533 Ga0495640_0086011 Ga0495640_0086011_1201_1815 204
239 3300046535 Ga0495586_0028955 Ga0495586_0028955_1279_1893 204
240 3300046536 Ga0495587_0012025 Ga0495587_0012025_3614_4228 204
241 3300046537 Ga0495598_0197933 Ga0495598_0197933_13_627 204
242 3300046539 Ga0495621_0064307 Ga0495621_0064307_283_897 204
243 3300046559 Ga0495667_0031510 Ga0495667_0031510_1286_1900 204
244 3300046642 Ga0495634_0018098 Ga0495634_0018098_753_1367 204
245 3300046663 Ga0495635_0019453 Ga0495635_0019453_2636_3250 204
246 3300046675 Ga0495657_0042533 Ga0495657_0042533_1732_2346 204
247 3300046675 Ga0495657_0231640 Ga0495657_0231640_143_757 204
248 3300046678 Ga0495599_0022453 Ga0495599_0022453_809_1423 204
249 3300046681 Ga0495647_0018180 Ga0495647_0018180_1149_1763 204
250 3300046683 Ga0495658_0032824 Ga0495658_0032824_748_1362 204
251 3300046684 Ga0495669_0041118 Ga0495669_0041118_1039_1653 204
252 3300046689 Ga0495613_0124840 Ga0495613_0124840_756_1370 204
253 3300046689 Ga0495613_0213592 Ga0495613_0213592_731_1345 204
254 3300046690 Ga0495624_0138155 Ga0495624_0138155_101_715 204
255 3300046809 Ga0495600_0006964 Ga0495600_0006964_3615_4229 204
256 3300046809 Ga0495600_0344134 Ga0495600_0344134_24_638 204
257 3300047315 Ga0495581_0293479 Ga0495581_0293479_85_699 204
258 3300047317 Ga0495604_0031779 Ga0495604_0031779_1649_2263 204
259 3300047319 Ga0495674_0002348 Ga0495674_0002348_16674_17288 204
260 3300047322 Ga0495680_0095135 Ga0495680_0095135_477_1091 204
261 3300047322 Ga0495680_0131659 Ga0495680_0131659_336_950 204
262 3300047444 Ga0495675_0091819 Ga0495675_0091819_105_719 204
263 3300047471 Ga0495684_0044127 Ga0495684_0044127_2097_2711 204
264 3300048090 Ga0495615_0007312 Ga0495615_0007312_834_1448 204
265 3300050512 nmdc:mga0n895_31413_c1 nmdc:mga0n895_31413_c1_3859_4473 204
266 3300050513 nmdc:mga0rr50_120913_c1 nmdc:mga0rr50_120913_c1_1124_1738 204
267 3300053084 Ga0495595_0001216 Ga0495595_0001216_8463_9077 204
268 3300053085 Ga0495619_0008409 Ga0495619_0008409_5243_5857 204
269 3300053085 Ga0495619_0125877 Ga0495619_0125877_20_634 204
270 3300053090 Ga0500646_0002991 Ga0500646_0002991_3108_3722 204
271 3300005327 Ga0070658_10049814 Ga0070658_100498142 205
272 3300005327 Ga0070658_10133088 Ga0070658_101330881 205
273 3300005328 Ga0070676_10010662 Ga0070676_100106625 205
274 3300005328 Ga0070676_10041156 Ga0070676_100411562 205
275 3300005329 Ga0070683_100035241 Ga0070683_1000352413 205
276 3300005329 Ga0070683_100226345 Ga0070683_1002263452 205
277 3300005329 Ga0070683_100435698 Ga0070683_1004356982 205
278 3300005329 Ga0070683_100467880 Ga0070683_1004678801 205
279 3300005330 Ga0070690_100035580 Ga0070690_1000355803 205
280 3300005330 Ga0070690_100043557 Ga0070690_1000435572 205
281 3300005330 Ga0070690_100151202 Ga0070690_1001512022 205
282 3300005330 Ga0070690_100435508 Ga0070690_1004355082 205
283 3300005331 Ga0070670_100002172 Ga0070670_10000217210 205
284 3300005331 Ga0070670_100036146 Ga0070670_1000361463 205
285 3300005331 Ga0070670_100093106 Ga0070670_1000931063 205
286 3300005331 Ga0070670_100227509 Ga0070670_1002275092 205
287 3300005331 Ga0070670_100231835 Ga0070670_1002318351 205
288 3300005333 Ga0070677_10000814 Ga0070677_100008149 205
289 3300005333 Ga0070677_10223186 Ga0070677_102231861 205
290 3300005334 Ga0068869_100002058 Ga0068869_1000020587 205
291 3300005334 Ga0068869_100055323 Ga0068869_1000553233 205
292 3300005334 Ga0068869_100162812 Ga0068869_1001628122 205
293 3300005334 Ga0068869_100463087 Ga0068869_1004630872 205
294 3300005335 Ga0070666_10001703 Ga0070666_100017039 205
295 3300005335 Ga0070666_10005247 Ga0070666_100052474 205
296 3300005335 Ga0070666_10120407 Ga0070666_101204073 205
297 3300005335 Ga0070666_10351886 Ga0070666_103518862 205
298 3300005336 Ga0070680_100008942 Ga0070680_1000089426 205
299 3300005337 Ga0070682_100054562 Ga0070682_1000545624 205
300 3300005337 Ga0070682_100770820 Ga0070682_1007708202 205
301 3300005338 Ga0068868_100006642 Ga0068868_1000066426 205
302 3300005338 Ga0068868_100008658 Ga0068868_1000086587 205
303 3300005338 Ga0068868_100066024 Ga0068868_1000660244 205
304 3300005338 Ga0068868_100305766 Ga0068868_1003057662 205
305 3300005338 Ga0068868_100396024 Ga0068868_1003960242 205
306 3300005338 Ga0068868_100651852 Ga0068868_1006518522 205
307 3300005339 Ga0070660_100013273 Ga0070660_1000132736 205
308 3300005339 Ga0070660_100023637 Ga0070660_1000236375 205
309 3300005339 Ga0070660_100046225 Ga0070660_1000462253 205
310 3300005340 Ga0070689_100005624 Ga0070689_1000056244 205
311 3300005340 Ga0070689_100151778 Ga0070689_1001517783 205
312 3300005340 Ga0070689_100222407 Ga0070689_1002224072 205
313 3300005340 Ga0070689_100237983 Ga0070689_1002379832 205
314 3300005343 Ga0070687_100057827 Ga0070687_1000578271 205
315 3300005343 Ga0070687_100084953 Ga0070687_1000849532 205
316 3300005344 Ga0070661_100031619 Ga0070661_1000316194 205
317 3300005344 Ga0070661_100043639 Ga0070661_1000436394 205
318 3300005344 Ga0070661_100235112 Ga0070661_1002351122 205
319 3300005345 Ga0070692_10074424 Ga0070692_100744242 205
320 3300005347 Ga0070668_100022440 Ga0070668_1000224405 205
321 3300005347 Ga0070668_100061317 Ga0070668_1000613173 205
322 3300005347 Ga0070668_100128183 Ga0070668_1001281834 205
323 3300005347 Ga0070668_100144423 Ga0070668_1001444233 205
324 3300005353 Ga0070669_100016690 Ga0070669_1000166904 205
325 3300005353 Ga0070669_100031009 Ga0070669_1000310094 205
326 3300005353 Ga0070669_100105977 Ga0070669_1001059773 205
327 3300005353 Ga0070669_100176716 Ga0070669_1001767163 205
328 3300005354 Ga0070675_100000052 Ga0070675_1000000529 205
329 3300005354 Ga0070675_100004275 Ga0070675_1000042759 205
330 3300005354 Ga0070675_100026770 Ga0070675_1000267704 205
331 3300005354 Ga0070675_100027411 Ga0070675_1000274112 205
332 3300005354 Ga0070675_100187478 Ga0070675_1001874782 205
333 3300005354 Ga0070675_100261480 Ga0070675_1002614802 205
334 3300005355 Ga0070671_100005537 Ga0070671_1000055373 205
335 3300005355 Ga0070671_100010020 Ga0070671_1000100204 205
336 3300005355 Ga0070671_100016646 Ga0070671_1000166463 205
337 3300005355 Ga0070671_100220525 Ga0070671_1002205252 205
338 3300005355 Ga0070671_100472643 Ga0070671_1004726432 205
339 3300005356 Ga0070674_100005400 Ga0070674_1000054007 205
340 3300005356 Ga0070674_100016918 Ga0070674_1000169183 205
341 3300005356 Ga0070674_100038652 Ga0070674_1000386521 205
342 3300005356 Ga0070674_100083679 Ga0070674_1000836793 205
343 3300005356 Ga0070674_100101002 Ga0070674_1001010022 205
344 3300005356 Ga0070674_100234545 Ga0070674_1002345451 205
345 3300005364 Ga0070673_100000303 Ga0070673_1000003033 205
346 3300005364 Ga0070673_100019920 Ga0070673_1000199205 205
347 3300005364 Ga0070673_100023699 Ga0070673_1000236992 205
348 3300005364 Ga0070673_100027600 Ga0070673_1000276005 205
349 3300005364 Ga0070673_100104626 Ga0070673_1001046261 205
350 3300005364 Ga0070673_100117927 Ga0070673_1001179271 205
351 3300005364 Ga0070673_100226514 Ga0070673_1002265142 205
352 3300005364 Ga0070673_100355580 Ga0070673_1003555802 205
353 3300005364 Ga0070673_100436084 Ga0070673_1004360842 205
354 3300005364 Ga0070673_100889032 Ga0070673_1008890321 205
355 3300005365 Ga0070688_100007711 Ga0070688_1000077115 205
356 3300005365 Ga0070688_100206228 Ga0070688_1002062282 205
357 3300005365 Ga0070688_100267689 Ga0070688_1002676892 205
358 3300005365 Ga0070688_100382589 Ga0070688_1003825892 205
359 3300005366 Ga0070659_100026061 Ga0070659_1000260615 205
360 3300005366 Ga0070659_100326417 Ga0070659_1003264172 205
361 3300005366 Ga0070659_100407900 Ga0070659_1004079001 205
362 3300005366 Ga0070659_100534320 Ga0070659_1005343202 205
363 3300005367 Ga0070667_100001254 Ga0070667_1000012547 205
364 3300005367 Ga0070667_100045960 Ga0070667_1000459602 205
365 3300005367 Ga0070667_100065157 Ga0070667_1000651575 205
366 3300005367 Ga0070667_100115430 Ga0070667_1001154303 205
367 3300005367 Ga0070667_100161722 Ga0070667_1001617222 205
368 3300005367 Ga0070667_100274956 Ga0070667_1002749562 205
369 3300005434 Ga0070709_10023596 Ga0070709_100235963 205
370 3300005434 Ga0070709_10857996 Ga0070709_108579961 205
371 3300005435 Ga0070714_100021890 Ga0070714_1000218906 205
372 3300005435 Ga0070714_100163557 Ga0070714_1001635571 205
373 3300005435 Ga0070714_100219001 Ga0070714_1002190012 205
374 3300005436 Ga0070713_100047855 Ga0070713_1000478553 205
375 3300005436 Ga0070713_100135490 Ga0070713_1001354903 205
376 3300005437 Ga0070710_10024419 Ga0070710_100244192 205
377 3300005438 Ga0070701_10311422 Ga0070701_103114221 205
378 3300005439 Ga0070711_100008755 Ga0070711_1000087552 205
379 3300005439 Ga0070711_100224729 Ga0070711_1002247292 205
380 3300005439 Ga0070711_100786928 Ga0070711_1007869281 205
381 3300005440 Ga0070705_100009497 Ga0070705_1000094972 205
382 3300005441 Ga0070700_100034984 Ga0070700_1000349842 205
383 3300005445 Ga0070708_100022225 Ga0070708_1000222252 205
384 3300005455 Ga0070663_100022766 Ga0070663_1000227662 205
385 3300005455 Ga0070663_100093451 Ga0070663_1000934512 205
386 3300005455 Ga0070663_100265449 Ga0070663_1002654492 205
387 3300005456 Ga0070678_100000797 Ga0070678_1000007977 205
388 3300005456 Ga0070678_100003598 Ga0070678_1000035983 205
389 3300005456 Ga0070678_100006120 Ga0070678_1000061206 205
390 3300005456 Ga0070678_100111427 Ga0070678_1001114274 205
391 3300005457 Ga0070662_100043586 Ga0070662_1000435862 205
392 3300005457 Ga0070662_100047108 Ga0070662_1000471084 205
393 3300005457 Ga0070662_100051111 Ga0070662_1000511114 205
394 3300005458 Ga0070681_10105138 Ga0070681_101051382 205
395 3300005458 Ga0070681_10271800 Ga0070681_102718003 205
396 3300005458 Ga0070681_10606637 Ga0070681_106066371 205
397 3300005459 Ga0068867_100000902 Ga0068867_1000009024 205
398 3300005459 Ga0068867_100041892 Ga0068867_1000418922 205
399 3300005459 Ga0068867_100054591 Ga0068867_1000545914 205
400 3300005459 Ga0068867_100075518 Ga0068867_1000755182 205
401 3300005459 Ga0068867_100102610 Ga0068867_1001026104 205
402 3300005459 Ga0068867_100264724 Ga0068867_1002647241 205
403 3300005459 Ga0068867_100946931 Ga0068867_1009469311 205
404 3300005466 Ga0070685_10008871 Ga0070685_100088712 205
405 3300005466 Ga0070685_10125960 Ga0070685_101259603 205
406 3300005468 Ga0070707_100012864 Ga0070707_1000128646 205
407 3300005471 Ga0070698_100571059 Ga0070698_1005710592 205
408 3300005518 Ga0070699_100035398 Ga0070699_1000353985 205
409 3300005530 Ga0070679_100666073 Ga0070679_1006660731 205
410 3300005535 Ga0070684_100113721 Ga0070684_1001137213 205
411 3300005535 Ga0070684_100221409 Ga0070684_1002214092 205
412 3300005535 Ga0070684_100278719 Ga0070684_1002787191 205
413 3300005535 Ga0070684_100860737 Ga0070684_1008607372 205
414 3300005536 Ga0070697_100020195 Ga0070697_1000201954 205
415 3300005539 Ga0068853_100073348 Ga0068853_1000733484 205
416 3300005539 Ga0068853_100322628 Ga0068853_1003226282 205
417 3300005539 Ga0068853_100750297 Ga0068853_1007502971 205
418 3300005543 Ga0070672_100000798 Ga0070672_1000007982 205
419 3300005543 Ga0070672_100027855 Ga0070672_1000278553 205
420 3300005543 Ga0070672_100028576 Ga0070672_1000285762 205
421 3300005543 Ga0070672_100066652 Ga0070672_1000666523 205
422 3300005543 Ga0070672_100120747 Ga0070672_1001207473 205
423 3300005543 Ga0070672_100259354 Ga0070672_1002593542 205
424 3300005543 Ga0070672_100521499 Ga0070672_1005214991 205
425 3300005543 Ga0070672_100906558 Ga0070672_1009065582 205
426 3300005544 Ga0070686_100097745 Ga0070686_1000977452 205
427 3300005545 Ga0070695_100867496 Ga0070695_1008674961 205
428 3300005546 Ga0070696_100031832 Ga0070696_1000318322 205
429 3300005546 Ga0070696_100031923 Ga0070696_1000319233 205
430 3300005547 Ga0070693_100010214 Ga0070693_1000102146 205
431 3300005547 Ga0070693_100113498 Ga0070693_1001134982 205
432 3300005548 Ga0070665_100019248 Ga0070665_1000192482 205
433 3300005548 Ga0070665_100267280 Ga0070665_1002672801 205
434 3300005548 Ga0070665_100383750 Ga0070665_1003837501 205
435 3300005548 Ga0070665_100903397 Ga0070665_1009033971 205
436 3300005563 Ga0068855_100005168 Ga0068855_10000516816 205
437 3300005563 Ga0068855_100010690 Ga0068855_1000106903 205
438 3300005563 Ga0068855_100015678 Ga0068855_1000156786 205
439 3300005564 Ga0070664_100059096 Ga0070664_1000590963 205
440 3300005564 Ga0070664_100418135 Ga0070664_1004181352 205
441 3300005564 Ga0070664_100733651 Ga0070664_1007336511 205
442 3300005564 Ga0070664_100789185 Ga0070664_1007891852 205
443 3300005578 Ga0068854_100007769 Ga0068854_1000077696 205
444 3300005578 Ga0068854_100022062 Ga0068854_1000220624 205
445 3300005578 Ga0068854_100024272 Ga0068854_1000242723 205
446 3300005578 Ga0068854_100083257 Ga0068854_1000832573 205
447 3300005614 Ga0068856_100050898 Ga0068856_1000508984 205
448 3300005614 Ga0068856_100061938 Ga0068856_1000619385 205
449 3300005614 Ga0068856_100083041 Ga0068856_1000830414 205
450 3300005614 Ga0068856_100813528 Ga0068856_1008135283 205
451 3300005614 Ga0068856_100857542 Ga0068856_1008575422 205
452 3300005614 Ga0068856_101628058 Ga0068856_1016280581 205
453 3300005615 Ga0070702_100004222 Ga0070702_1000042225 205
454 3300005615 Ga0070702_100030011 Ga0070702_1000300114 205
455 3300005616 Ga0068852_100016659 Ga0068852_1000166594 205
456 3300005616 Ga0068852_100037494 Ga0068852_1000374943 205
457 3300005616 Ga0068852_100043256 Ga0068852_1000432565 205
458 3300005616 Ga0068852_100593693 Ga0068852_1005936931 205
459 3300005616 Ga0068852_100662574 Ga0068852_1006625742 205
460 3300005617 Ga0068859_100000624 Ga0068859_10000062410 205
461 3300005617 Ga0068859_100016297 Ga0068859_1000162972 205
462 3300005617 Ga0068859_100044040 Ga0068859_1000440404 205
463 3300005617 Ga0068859_100102462 Ga0068859_1001024622 205
464 3300005617 Ga0068859_100662110 Ga0068859_1006621102 205
465 3300005618 Ga0068864_100000276 Ga0068864_10000027638 205
466 3300005618 Ga0068864_100002127 Ga0068864_1000021276 205
467 3300005618 Ga0068864_100012120 Ga0068864_1000121206 205
468 3300005618 Ga0068864_100040362 Ga0068864_1000403624 205
469 3300005618 Ga0068864_100330621 Ga0068864_1003306212 205
470 3300005718 Ga0068866_10011885 Ga0068866_100118855 205
471 3300005719 Ga0068861_100026369 Ga0068861_1000263695 205
472 3300005719 Ga0068861_100169994 Ga0068861_1001699942 205
473 3300005719 Ga0068861_100204832 Ga0068861_1002048322 205
474 3300005719 Ga0068861_100206540 Ga0068861_1002065403 205
475 3300005719 Ga0068861_100259840 Ga0068861_1002598402 205
476 3300005719 Ga0068861_100363229 Ga0068861_1003632292 205
477 3300005719 Ga0068861_100770162 Ga0068861_1007701622 205
478 3300005834 Ga0068851_10001648 Ga0068851_100016486 205
479 3300005834 Ga0068851_10102376 Ga0068851_101023762 205
480 3300005834 Ga0068851_10417453 Ga0068851_104174531 205
481 3300005840 Ga0068870_10038813 Ga0068870_100388132 205
482 3300005840 Ga0068870_10065408 Ga0068870_100654082 205
483 3300005840 Ga0068870_10230813 Ga0068870_102308132 205
484 3300005841 Ga0068863_100006992 Ga0068863_10000699210 205
485 3300005841 Ga0068863_100008763 Ga0068863_1000087639 205
486 3300005841 Ga0068863_100036114 Ga0068863_1000361145 205
487 3300005841 Ga0068863_100096502 Ga0068863_1000965022 205
488 3300005841 Ga0068863_100312475 Ga0068863_1003124752 205
489 3300005841 Ga0068863_100320012 Ga0068863_1003200122 205
490 3300005842 Ga0068858_100000234 Ga0068858_10000023450 205
491 3300005842 Ga0068858_100000924 Ga0068858_1000009248 205
492 3300005842 Ga0068858_100219416 Ga0068858_1002194162 205
493 3300005842 Ga0068858_100375835 Ga0068858_1003758352 205
494 3300005842 Ga0068858_100814800 Ga0068858_1008148001 205
495 3300005842 Ga0068858_100848991 Ga0068858_1008489912 205
496 3300005843 Ga0068860_100019548 Ga0068860_1000195483 205
497 3300005843 Ga0068860_100061976 Ga0068860_1000619765 205
498 3300005843 Ga0068860_100077578 Ga0068860_1000775784 205
499 3300005843 Ga0068860_100345047 Ga0068860_1003450472 205
500 3300005843 Ga0068860_100572420 Ga0068860_1005724202 205
501 3300005843 Ga0068860_100695704 Ga0068860_1006957041 205
502 3300005844 Ga0068862_100197931 Ga0068862_1001979312 205
503 3300005844 Ga0068862_100213805 Ga0068862_1002138052 205
504 3300005844 Ga0068862_100482462 Ga0068862_1004824622 205
505 3300005844 Ga0068862_100622379 Ga0068862_1006223792 205
506 3300006038 Ga0075365_10267691 Ga0075365_102676912 205
507 3300006042 Ga0075368_10153505 Ga0075368_101535052 205
508 3300006048 Ga0075363_100136826 Ga0075363_1001368262 205
509 3300006051 Ga0075364_10352541 Ga0075364_103525412 205
510 3300006051 Ga0075364_10446241 Ga0075364_104462412 205
511 3300006163 Ga0070715_10010927 Ga0070715_100109272 205
512 3300006173 Ga0070716_100009552 Ga0070716_1000095525 205
513 3300006175 Ga0070712_100008817 Ga0070712_1000088172 205
514 3300006175 Ga0070712_100017504 Ga0070712_1000175042 205
515 3300006177 Ga0075362_10005333 Ga0075362_100053333 205
516 3300006177 Ga0075362_10005967 Ga0075362_100059674 205
517 3300006178 Ga0075367_10139978 Ga0075367_101399782 205
518 3300006186 Ga0075369_10036834 Ga0075369_100368343 205
519 3300006186 Ga0075369_10064569 Ga0075369_100645692 205
520 3300006186 Ga0075369_10320753 Ga0075369_103207531 205
521 3300006195 Ga0075366_10031327 Ga0075366_100313273 205
522 3300006195 Ga0075366_10127684 Ga0075366_101276841 205
523 3300006237 Ga0097621_100004591 Ga0097621_1000045917 205
524 3300006237 Ga0097621_100006870 Ga0097621_1000068703 205
525 3300006237 Ga0097621_100020158 Ga0097621_1000201582 205
526 3300006237 Ga0097621_100029079 Ga0097621_1000290793 205
527 3300006237 Ga0097621_100034367 Ga0097621_1000343673 205
528 3300006237 Ga0097621_100103730 Ga0097621_1001037302 205
529 3300006237 Ga0097621_100154110 Ga0097621_1001541102 205
530 3300006237 Ga0097621_100205269 Ga0097621_1002052693 205
531 3300006353 Ga0075370_10018987 Ga0075370_100189874 205
532 3300006353 Ga0075370_10055867 Ga0075370_100558673 205
533 3300006353 Ga0075370_10145897 Ga0075370_101458972 205
534 3300006358 Ga0068871_100024554 Ga0068871_1000245542 205
535 3300006358 Ga0068871_100102400 Ga0068871_1001024002 205
536 3300006358 Ga0068871_100135206 Ga0068871_1001352064 205
537 3300006844 Ga0075428_100521001 Ga0075428_1005210011 205
538 3300006871 Ga0075434_100812744 Ga0075434_1008127441 205
539 3300006881 Ga0068865_100018810 Ga0068865_1000188106 205
540 3300006881 Ga0068865_100102657 Ga0068865_1001026573 205
541 3300006881 Ga0068865_100138270 Ga0068865_1001382702 205
542 3300006881 Ga0068865_100603630 Ga0068865_1006036302 205
543 3300006931 Ga0097620_100000624 Ga0097620_10000062429 205
544 3300006931 Ga0097620_100016298 Ga0097620_1000162982 205
545 3300006931 Ga0097620_100044039 Ga0097620_1000440394 205
546 3300006931 Ga0097620_100102457 Ga0097620_1001024572 205
547 3300006931 Ga0097620_100662111 Ga0097620_1006621112 205
548 3300007076 Ga0075435_100196086 Ga0075435_1001960862 205
549 3300007076 Ga0075435_100609163 Ga0075435_1006091631 205
550 3300009093 Ga0105240_10003248 Ga0105240_1000324824 205
551 3300009093 Ga0105240_10007090 Ga0105240_1000709010 205
552 3300009093 Ga0105240_10073994 Ga0105240_100739942 205
553 3300009093 Ga0105240_10079875 Ga0105240_100798752 205
554 3300009094 Ga0111539_10000843 Ga0111539_1000084311 205
555 3300009094 Ga0111539_10038829 Ga0111539_100388293 205
556 3300009094 Ga0111539_11091154 Ga0111539_110911542 205
557 3300009094 Ga0111539_11296358 Ga0111539_112963581 205
558 3300009098 Ga0105245_10008875 Ga0105245_100088756 205
559 3300009098 Ga0105245_10028235 Ga0105245_100282355 205
560 3300009098 Ga0105245_10272887 Ga0105245_102728872 205
561 3300009148 Ga0105243_10063969 Ga0105243_100639693 205
562 3300009148 Ga0105243_11225858 Ga0105243_112258581 205
563 3300009174 Ga0105241_10005538 Ga0105241_100055387 205
564 3300009174 Ga0105241_10046342 Ga0105241_100463425 205
565 3300009174 Ga0105241_10070452 Ga0105241_100704525 205
566 3300009174 Ga0105241_10162908 Ga0105241_101629082 205
567 3300009174 Ga0105241_10531548 Ga0105241_105315481 205
568 3300009176 Ga0105242_10003508 Ga0105242_1000350813 205
569 3300009176 Ga0105242_10005080 Ga0105242_100050804 205
570 3300009176 Ga0105242_10065729 Ga0105242_100657293 205
571 3300009176 Ga0105242_10103031 Ga0105242_101030312 205
572 3300009176 Ga0105242_10103729 Ga0105242_101037293 205
573 3300009177 Ga0105248_10002960 Ga0105248_100029608 205
574 3300009177 Ga0105248_10060540 Ga0105248_100605403 205
575 3300009177 Ga0105248_10069128 Ga0105248_100691284 205
576 3300009177 Ga0105248_10153088 Ga0105248_101530882 205
577 3300009177 Ga0105248_10276887 Ga0105248_102768872 205
578 3300009177 Ga0105248_10804644 Ga0105248_108046442 205
579 3300009545 Ga0105237_10074389 Ga0105237_100743892 205
580 3300009545 Ga0105237_10880908 Ga0105237_108809081 205
581 3300009551 Ga0105238_10003229 Ga0105238_1000322914 205
582 3300009551 Ga0105238_10007314 Ga0105238_100073148 205
583 3300009551 Ga0105238_10079856 Ga0105238_100798565 205
584 3300009553 Ga0105249_10027279 Ga0105249_100272795 205
585 3300009553 Ga0105249_10148811 Ga0105249_101488112 205
586 3300009553 Ga0105249_10252688 Ga0105249_102526882 205
587 3300009553 Ga0105249_10423051 Ga0105249_104230512 205
588 3300009553 Ga0105249_10863030 Ga0105249_108630301 205
589 3300009553 Ga0105249_10910345 Ga0105249_109103452 205
590 3300010375 Ga0105239_10893522 Ga0105239_108935221 205
591 3300011119 Ga0105246_10025128 Ga0105246_100251285 205
592 3300011119 Ga0105246_10091560 Ga0105246_100915602 205
593 3300013100 Ga0157373_10009014 Ga0157373_100090146 205
594 3300013100 Ga0157373_10159750 Ga0157373_101597502 205
595 3300013100 Ga0157373_10187106 Ga0157373_101871063 205
596 3300013102 Ga0157371_10250389 Ga0157371_102503892 205
597 3300013102 Ga0157371_10482331 Ga0157371_104823312 205
598 3300013104 Ga0157370_10066629 Ga0157370_100666293 205
599 3300013105 Ga0157369_10019958 Ga0157369_100199584 205
600 3300013105 Ga0157369_10507692 Ga0157369_105076922 205
601 3300013296 Ga0157374_10022540 Ga0157374_100225406 205
602 3300013296 Ga0157374_10026815 Ga0157374_100268155 205
603 3300013296 Ga0157374_10189755 Ga0157374_101897553 205
604 3300013297 Ga0157378_10019984 Ga0157378_100199844 205
605 3300013297 Ga0157378_10123389 Ga0157378_101233891 205
606 3300013297 Ga0157378_10200723 Ga0157378_102007232 205
607 3300013297 Ga0157378_10344738 Ga0157378_103447382 205
608 3300013297 Ga0157378_10620335 Ga0157378_106203352 205
609 3300013306 Ga0163162_10024400 Ga0163162_100244004 205
610 3300013306 Ga0163162_10028267 Ga0163162_100282676 205
611 3300013306 Ga0163162_10147725 Ga0163162_101477253 205
612 3300013306 Ga0163162_10246651 Ga0163162_102466513 205
613 3300013306 Ga0163162_10475790 Ga0163162_104757902 205
614 3300013307 Ga0157372_10011095 Ga0157372_100110956 205
615 3300013307 Ga0157372_10015598 Ga0157372_100155988 205
616 3300013307 Ga0157372_10948903 Ga0157372_109489032 205
617 3300013308 Ga0157375_10135007 Ga0157375_101350072 205
618 3300013308 Ga0157375_10156651 Ga0157375_101566511 205
619 3300013308 Ga0157375_10247183 Ga0157375_102471833 205
620 3300013308 Ga0157375_10276577 Ga0157375_102765772 205
621 3300013308 Ga0157375_10786263 Ga0157375_107862632 205
622 3300013308 Ga0157375_10944947 Ga0157375_109449472 205
623 3300013308 Ga0157375_11032393 Ga0157375_110323931 205
624 3300014325 Ga0163163_10004376 Ga0163163_100043768 205
625 3300014325 Ga0163163_10048308 Ga0163163_100483084 205
626 3300014325 Ga0163163_10764308 Ga0163163_107643081 205
627 3300014325 Ga0163163_11249630 Ga0163163_112496301 205
628 3300014326 Ga0157380_10371448 Ga0157380_103714482 205
629 3300014326 Ga0157380_10639787 Ga0157380_106397872 205
630 3300014326 Ga0157380_11031430 Ga0157380_110314301 205
631 3300014326 Ga0157380_11455553 Ga0157380_114555531 205
632 3300014745 Ga0157377_10003662 Ga0157377_100036626 205
633 3300014745 Ga0157377_10067610 Ga0157377_100676103 205
634 3300014745 Ga0157377_10129540 Ga0157377_101295402 205
635 3300014968 Ga0157379_10019828 Ga0157379_100198283 205
636 3300014968 Ga0157379_10672952 Ga0157379_106729522 205
637 3300014969 Ga0157376_10018103 Ga0157376_100181033 205
638 3300014969 Ga0157376_10019374 Ga0157376_100193744 205
639 3300014969 Ga0157376_10020678 Ga0157376_100206785 205
640 3300014969 Ga0157376_10043564 Ga0157376_100435643 205
641 3300014969 Ga0157376_10080736 Ga0157376_100807363 205
642 3300017792 Ga0163161_10000916 Ga0163161_100009166 205
643 3300017792 Ga0163161_10031777 Ga0163161_100317774 205
644 3300017792 Ga0163161_10040746 Ga0163161_100407464 205
645 3300017792 Ga0163161_10388032 Ga0163161_103880322 205
646 3300021384 Ga0213876_10035613 Ga0213876_100356132 205
647 3300021384 Ga0213876_10047600 Ga0213876_100476002 205
648 3300021384 Ga0213876_10068993 Ga0213876_100689932 205
649 3300025315 Ga0207697_10066718 Ga0207697_100667182 205
650 3300025315 Ga0207697_10103713 Ga0207697_101037132 205
651 3300025321 Ga0207656_10003595 Ga0207656_100035956 205
652 3300025321 Ga0207656_10071725 Ga0207656_100717252 205
653 3300025321 Ga0207656_10300258 Ga0207656_103002581 205
654 3300025893 Ga0207682_10000329 Ga0207682_100003293 205
655 3300025893 Ga0207682_10150543 Ga0207682_101505432 205
656 3300025893 Ga0207682_10187870 Ga0207682_101878702 205
657 3300025898 Ga0207692_10016684 Ga0207692_100166843 205
658 3300025898 Ga0207692_10327473 Ga0207692_103274732 205
659 3300025899 Ga0207642_10010710 Ga0207642_100107102 205
660 3300025900 Ga0207710_10049759 Ga0207710_100497592 205
661 3300025901 Ga0207688_10059984 Ga0207688_100599843 205
662 3300025901 Ga0207688_10487200 Ga0207688_104872001 205
663 3300025903 Ga0207680_10004953 Ga0207680_100049532 205
664 3300025903 Ga0207680_10023548 Ga0207680_100235485 205
665 3300025903 Ga0207680_10100309 Ga0207680_101003092 205
666 3300025903 Ga0207680_10168620 Ga0207680_101686201 205
667 3300025903 Ga0207680_10288047 Ga0207680_102880471 205
668 3300025903 Ga0207680_10604148 Ga0207680_106041482 205
669 3300025905 Ga0207685_10013464 Ga0207685_100134644 205
670 3300025906 Ga0207699_10019156 Ga0207699_100191564 205
671 3300025906 Ga0207699_10034841 Ga0207699_100348412 205
672 3300025906 Ga0207699_10211612 Ga0207699_102116121 205
673 3300025906 Ga0207699_10240946 Ga0207699_102409462 205
674 3300025907 Ga0207645_10026093 Ga0207645_100260934 205
675 3300025907 Ga0207645_10065787 Ga0207645_100657872 205
676 3300025907 Ga0207645_10093611 Ga0207645_100936112 205
677 3300025907 Ga0207645_10221979 Ga0207645_102219792 205
678 3300025908 Ga0207643_10031257 Ga0207643_100312572 205
679 3300025909 Ga0207705_10120670 Ga0207705_101206701 205
680 3300025909 Ga0207705_10415343 Ga0207705_104153431 205
681 3300025911 Ga0207654_10004656 Ga0207654_100046565 205
682 3300025911 Ga0207654_10093092 Ga0207654_100930922 205
683 3300025912 Ga0207707_10019946 Ga0207707_100199463 205
684 3300025912 Ga0207707_10204272 Ga0207707_102042722 205
685 3300025913 Ga0207695_10005746 Ga0207695_1000574610 205
686 3300025914 Ga0207671_10230247 Ga0207671_102302472 205
687 3300025915 Ga0207693_10026174 Ga0207693_100261745 205
688 3300025915 Ga0207693_10170228 Ga0207693_101702282 205
689 3300025915 Ga0207693_10425997 Ga0207693_104259972 205
690 3300025916 Ga0207663_10193340 Ga0207663_101933402 205
691 3300025917 Ga0207660_10159303 Ga0207660_101593032 205
692 3300025918 Ga0207662_10040287 Ga0207662_100402872 205
693 3300025918 Ga0207662_10355616 Ga0207662_103556162 205
694 3300025919 Ga0207657_10012272 Ga0207657_100122723 205
695 3300025919 Ga0207657_10030358 Ga0207657_100303583 205
696 3300025919 Ga0207657_10153815 Ga0207657_101538152 205
697 3300025920 Ga0207649_10135307 Ga0207649_101353072 205
698 3300025920 Ga0207649_10157102 Ga0207649_101571023 205
699 3300025921 Ga0207652_10015622 Ga0207652_100156224 205
700 3300025923 Ga0207681_10032065 Ga0207681_100320654 205
701 3300025923 Ga0207681_10093002 Ga0207681_100930021 205
702 3300025923 Ga0207681_10272628 Ga0207681_102726282 205
703 3300025923 Ga0207681_10390286 Ga0207681_103902862 205
704 3300025924 Ga0207694_10047121 Ga0207694_100471213 205
705 3300025924 Ga0207694_10087647 Ga0207694_100876473 205
706 3300025924 Ga0207694_10117973 Ga0207694_101179733 205
707 3300025924 Ga0207694_10128220 Ga0207694_101282203 205
708 3300025924 Ga0207694_10205113 Ga0207694_102051132 205
709 3300025924 Ga0207694_10295820 Ga0207694_102958202 205
710 3300025925 Ga0207650_10003311 Ga0207650_100033115 205
711 3300025925 Ga0207650_10054664 Ga0207650_100546643 205
712 3300025925 Ga0207650_10069804 Ga0207650_100698043 205
713 3300025925 Ga0207650_10092270 Ga0207650_100922704 205
714 3300025925 Ga0207650_10260732 Ga0207650_102607322 205
715 3300025925 Ga0207650_10310586 Ga0207650_103105862 205
716 3300025925 Ga0207650_10332166 Ga0207650_103321662 205
717 3300025925 Ga0207650_11053292 Ga0207650_110532921 205
718 3300025926 Ga0207659_10000208 Ga0207659_1000020818 205
719 3300025926 Ga0207659_10000550 Ga0207659_100005505 205
720 3300025926 Ga0207659_10098086 Ga0207659_100980863 205
721 3300025926 Ga0207659_10114234 Ga0207659_101142343 205
722 3300025926 Ga0207659_10656001 Ga0207659_106560012 205
723 3300025927 Ga0207687_10000792 Ga0207687_1000079216 205
724 3300025927 Ga0207687_10021109 Ga0207687_100211092 205
725 3300025927 Ga0207687_10027398 Ga0207687_100273984 205
726 3300025927 Ga0207687_10028889 Ga0207687_100288894 205
727 3300025928 Ga0207700_10009373 Ga0207700_100093735 205
728 3300025928 Ga0207700_10014071 Ga0207700_100140712 205
729 3300025929 Ga0207664_10006563 Ga0207664_100065638 205
730 3300025929 Ga0207664_10027779 Ga0207664_100277796 205
731 3300025929 Ga0207664_10206308 Ga0207664_102063082 205
732 3300025929 Ga0207664_10388050 Ga0207664_103880502 205
733 3300025931 Ga0207644_10003606 Ga0207644_100036065 205
734 3300025931 Ga0207644_10007409 Ga0207644_100074094 205
735 3300025931 Ga0207644_10019469 Ga0207644_100194692 205
736 3300025931 Ga0207644_10152086 Ga0207644_101520863 205
737 3300025931 Ga0207644_10367073 Ga0207644_103670731 205
738 3300025931 Ga0207644_10599957 Ga0207644_105999572 205
739 3300025932 Ga0207690_10006774 Ga0207690_100067745 205
740 3300025932 Ga0207690_10029877 Ga0207690_100298775 205
741 3300025932 Ga0207690_10059676 Ga0207690_100596762 205
742 3300025933 Ga0207706_10004915 Ga0207706_100049154 205
743 3300025933 Ga0207706_10019569 Ga0207706_100195693 205
744 3300025933 Ga0207706_10022997 Ga0207706_100229973 205
745 3300025933 Ga0207706_10079466 Ga0207706_100794662 205
746 3300025934 Ga0207686_10000643 Ga0207686_100006439 205
747 3300025934 Ga0207686_10017105 Ga0207686_100171052 205
748 3300025934 Ga0207686_10098304 Ga0207686_100983043 205
749 3300025934 Ga0207686_10334074 Ga0207686_103340742 205
750 3300025936 Ga0207670_10004198 Ga0207670_100041983 205
751 3300025936 Ga0207670_10005369 Ga0207670_100053694 205
752 3300025936 Ga0207670_10507121 Ga0207670_105071212 205
753 3300025937 Ga0207669_10001373 Ga0207669_100013735 205
754 3300025937 Ga0207669_10030571 Ga0207669_100305712 205
755 3300025937 Ga0207669_10190329 Ga0207669_101903292 205
756 3300025937 Ga0207669_10235453 Ga0207669_102354532 205
757 3300025937 Ga0207669_10562958 Ga0207669_105629581 205
758 3300025938 Ga0207704_10023542 Ga0207704_100235422 205
759 3300025938 Ga0207704_10271942 Ga0207704_102719422 205
760 3300025939 Ga0207665_10006482 Ga0207665_100064825 205
761 3300025939 Ga0207665_10007475 Ga0207665_100074754 205
762 3300025940 Ga0207691_10000090 Ga0207691_1000009038 205
763 3300025940 Ga0207691_10041152 Ga0207691_100411523 205
764 3300025940 Ga0207691_10079035 Ga0207691_100790354 205
765 3300025940 Ga0207691_10082412 Ga0207691_100824123 205
766 3300025940 Ga0207691_10117592 Ga0207691_101175922 205
767 3300025940 Ga0207691_10133967 Ga0207691_101339673 205
768 3300025940 Ga0207691_10707717 Ga0207691_107077171 205
769 3300025940 Ga0207691_10905309 Ga0207691_109053091 205
770 3300025941 Ga0207711_10000841 Ga0207711_1000084128 205
771 3300025941 Ga0207711_10009601 Ga0207711_100096016 205
772 3300025941 Ga0207711_10018649 Ga0207711_100186494 205
773 3300025941 Ga0207711_10025126 Ga0207711_100251266 205
774 3300025941 Ga0207711_10084690 Ga0207711_100846902 205
775 3300025941 Ga0207711_10111814 Ga0207711_101118143 205
776 3300025942 Ga0207689_10007229 Ga0207689_100072296 205
777 3300025942 Ga0207689_10015321 Ga0207689_100153213 205
778 3300025942 Ga0207689_10022306 Ga0207689_100223063 205
779 3300025942 Ga0207689_10189385 Ga0207689_101893852 205
780 3300025944 Ga0207661_10159661 Ga0207661_101596613 205
781 3300025945 Ga0207679_10038530 Ga0207679_100385303 205
782 3300025945 Ga0207679_10213221 Ga0207679_102132211 205
783 3300025945 Ga0207679_10378601 Ga0207679_103786012 205
784 3300025945 Ga0207679_10700353 Ga0207679_107003532 205
785 3300025945 Ga0207679_10912343 Ga0207679_109123431 205
786 3300025949 Ga0207667_10009857 Ga0207667_100098577 205
787 3300025949 Ga0207667_10038078 Ga0207667_100380782 205
788 3300025949 Ga0207667_10260843 Ga0207667_102608432 205
789 3300025949 Ga0207667_10960485 Ga0207667_109604851 205
790 3300025960 Ga0207651_10000418 Ga0207651_1000041819 205
791 3300025960 Ga0207651_10005645 Ga0207651_100056454 205
792 3300025960 Ga0207651_10018832 Ga0207651_100188323 205
793 3300025960 Ga0207651_10058095 Ga0207651_100580953 205
794 3300025960 Ga0207651_10065131 Ga0207651_100651314 205
795 3300025960 Ga0207651_10254556 Ga0207651_102545562 205
796 3300025960 Ga0207651_10532121 Ga0207651_105321212 205
797 3300025960 Ga0207651_10598010 Ga0207651_105980102 205
798 3300025960 Ga0207651_10800761 Ga0207651_108007612 205
799 3300025960 Ga0207651_10887207 Ga0207651_108872072 205
800 3300025961 Ga0207712_10069778 Ga0207712_100697783 205
801 3300025961 Ga0207712_10142901 Ga0207712_101429011 205
802 3300025972 Ga0207668_10029388 Ga0207668_100293882 205
803 3300025972 Ga0207668_10109780 Ga0207668_101097802 205
804 3300025981 Ga0207640_10009528 Ga0207640_100095284 205
805 3300025986 Ga0207658_10002727 Ga0207658_1000272711 205
806 3300025986 Ga0207658_10068554 Ga0207658_100685542 205
807 3300025986 Ga0207658_10097663 Ga0207658_100976634 205
808 3300025986 Ga0207658_10158315 Ga0207658_101583152 205
809 3300025986 Ga0207658_10252193 Ga0207658_102521932 205
810 3300025986 Ga0207658_10455142 Ga0207658_104551422 205
811 3300025986 Ga0207658_10480928 Ga0207658_104809282 205
812 3300026023 Ga0207677_10000387 Ga0207677_100003877 205
813 3300026023 Ga0207677_10003024 Ga0207677_100030246 205
814 3300026023 Ga0207677_10004900 Ga0207677_100049004 205
815 3300026023 Ga0207677_10203476 Ga0207677_102034762 205
816 3300026023 Ga0207677_10521616 Ga0207677_105216162 205
817 3300026023 Ga0207677_10613869 Ga0207677_106138692 205
818 3300026023 Ga0207677_11009010 Ga0207677_110090101 205
819 3300026035 Ga0207703_10001201 Ga0207703_1000120112 205
820 3300026035 Ga0207703_10001656 Ga0207703_100016567 205
821 3300026035 Ga0207703_10315870 Ga0207703_103158702 205
822 3300026035 Ga0207703_10796765 Ga0207703_107967652 205
823 3300026041 Ga0207639_10005944 Ga0207639_100059446 205
824 3300026041 Ga0207639_10541135 Ga0207639_105411352 205
825 3300026067 Ga0207678_10009908 Ga0207678_100099084 205
826 3300026067 Ga0207678_10047155 Ga0207678_100471554 205
827 3300026075 Ga0207708_10016794 Ga0207708_100167944 205
828 3300026075 Ga0207708_10572825 Ga0207708_105728252 205
829 3300026078 Ga0207702_10005967 Ga0207702_1000596712 205
830 3300026078 Ga0207702_10049228 Ga0207702_100492283 205
831 3300026078 Ga0207702_10276483 Ga0207702_102764832 205
832 3300026078 Ga0207702_10410535 Ga0207702_104105353 205
833 3300026088 Ga0207641_10000752 Ga0207641_100007522 205
834 3300026088 Ga0207641_10039963 Ga0207641_100399635 205
835 3300026088 Ga0207641_10122809 Ga0207641_101228094 205
836 3300026088 Ga0207641_10145654 Ga0207641_101456542 205
837 3300026088 Ga0207641_10217394 Ga0207641_102173942 205
838 3300026088 Ga0207641_10325957 Ga0207641_103259572 205
839 3300026089 Ga0207648_10011188 Ga0207648_100111884 205
840 3300026089 Ga0207648_10033330 Ga0207648_100333306 205
841 3300026089 Ga0207648_10069438 Ga0207648_100694384 205
842 3300026089 Ga0207648_10071055 Ga0207648_100710553 205
843 3300026089 Ga0207648_10096223 Ga0207648_100962233 205
844 3300026089 Ga0207648_10442163 Ga0207648_104421631 205
845 3300026095 Ga0207676_10000321 Ga0207676_1000032114 205
846 3300026095 Ga0207676_10004019 Ga0207676_1000401910 205
847 3300026095 Ga0207676_10011985 Ga0207676_100119853 205
848 3300026095 Ga0207676_10069331 Ga0207676_100693313 205
849 3300026095 Ga0207676_10091044 Ga0207676_100910443 205
850 3300026095 Ga0207676_10153053 Ga0207676_101530532 205
851 3300026116 Ga0207674_10021022 Ga0207674_100210224 205
852 3300026116 Ga0207674_10030420 Ga0207674_100304203 205
853 3300026116 Ga0207674_10149967 Ga0207674_101499673 205
854 3300026118 Ga0207675_100005511 Ga0207675_1000055114 205
855 3300026118 Ga0207675_100050176 Ga0207675_1000501763 205
856 3300026118 Ga0207675_100061354 Ga0207675_1000613542 205
857 3300026118 Ga0207675_100107857 Ga0207675_1001078573 205
858 3300026121 Ga0207683_10000560 Ga0207683_1000056018 205
859 3300026121 Ga0207683_10001777 Ga0207683_1000177713 205
860 3300026121 Ga0207683_10008933 Ga0207683_100089338 205
861 3300026121 Ga0207683_10122968 Ga0207683_101229683 205
862 3300026121 Ga0207683_10204178 Ga0207683_102041782 205
863 3300026121 Ga0207683_10379781 Ga0207683_103797811 205
864 3300026121 Ga0207683_10644585 Ga0207683_106445851 205
865 3300026142 Ga0207698_10002785 Ga0207698_100027855 205
866 3300026142 Ga0207698_10012873 Ga0207698_100128736 205
867 3300026142 Ga0207698_10108288 Ga0207698_101082882 205
868 3300026142 Ga0207698_10520713 Ga0207698_105207132 205
869 3300026142 Ga0207698_10543536 Ga0207698_105435362 205
870 3300027907 Ga0207428_10006397 Ga0207428_100063977 205
871 3300028379 Ga0268266_10068538 Ga0268266_100685384 205
872 3300028379 Ga0268266_10288593 Ga0268266_102885932 205
873 3300028380 Ga0268265_10024509 Ga0268265_100245092 205
874 3300028380 Ga0268265_10305026 Ga0268265_103050262 205
875 3300028380 Ga0268265_10606338 Ga0268265_106063382 205
876 3300028380 Ga0268265_10609114 Ga0268265_106091141 205
877 3300028381 Ga0268264_10007734 Ga0268264_100077348 205
878 3300028381 Ga0268264_10078660 Ga0268264_100786604 205
879 3300028381 Ga0268264_10086946 Ga0268264_100869464 205
880 3300028381 Ga0268264_10103717 Ga0268264_101037173 205
881 3300028381 Ga0268264_10484929 Ga0268264_104849291 205
882 3300028381 Ga0268264_10525619 Ga0268264_105256192 205
883 3300028381 Ga0268264_10693446 Ga0268264_106934462 205
884 3300028381 Ga0268264_10876919 Ga0268264_108769191 205
885 3300028573 Ga0265334_10009731 Ga0265334_100097314 205
886 3300028794 Ga0307515_10000160 Ga0307515_1000016011 205
887 3300031247 Ga0265340_10004883 Ga0265340_100048834 205
888 3300031548 Ga0307408_100130640 Ga0307408_1001306402 205
889 3300031712 Ga0265342_10247687 Ga0265342_102476872 205
890 3300031731 Ga0307405_10010162 Ga0307405_100101622 205
891 3300031731 Ga0307405_10369385 Ga0307405_103693851 205
892 3300031901 Ga0307406_10141937 Ga0307406_101419371 205
893 3300031903 Ga0307407_10130493 Ga0307407_101304931 205
894 3300031995 Ga0307409_100018572 Ga0307409_1000185724 205
895 3300031995 Ga0307409_100859528 Ga0307409_1008595282 205
896 3300032002 Ga0307416_100501579 Ga0307416_1005015792 205
897 3300032004 Ga0307414_10085825 Ga0307414_100858253 205
898 3300032004 Ga0307414_10111654 Ga0307414_101116542 205
899 3300032005 Ga0307411_10004827 Ga0307411_100048274 205
900 3300035089 Ga0373944_0035774 Ga0373944_0035774_416_1033 205
901 3300035089 Ga0373944_0099205 Ga0373944_0099205_47_664 205
902 3300035089 Ga0373944_0122343 Ga0373944_0122343_69_686 205
903 3300035111 Ga0373923_0053421 Ga0373923_0053421_999_1616 205
904 3300035111 Ga0373923_0056872 Ga0373923_0056872_362_979 205
905 3300035113 Ga0373936_0108097 Ga0373936_0108097_275_892 205
906 3300035116 Ga0373945_0055611 Ga0373945_0055611_422_1039 205
907 3300035117 Ga0373953_0015026 Ga0373953_0015026_1240_1857 205
908 3300035117 Ga0373953_0017420 Ga0373953_0017420_716_1333 205
909 3300035117 Ga0373953_0071143 Ga0373953_0071143_604_1221 205
910 3300035118 Ga0373954_0013064 Ga0373954_0013064_1005_1622 205
911 3300035118 Ga0373954_0026046 Ga0373954_0026046_777_1394 205
912 3300035118 Ga0373954_0049248 Ga0373954_0049248_190_807 205
913 3300035118 Ga0373954_0060709 Ga0373954_0060709_324_941 205
914 3300035119 Ga0373956_0015251 Ga0373956_0015251_1132_1749 205
915 3300035119 Ga0373956_0081138 Ga0373956_0081138_296_913 205
916 3300035120 Ga0373957_0028787 Ga0373957_0028787_583_1200 205
917 3300035120 Ga0373957_0030865 Ga0373957_0030865_12_629 205
918 3300035120 Ga0373957_0122860 Ga0373957_0122860_155_772 205
919 3300035170 Ga0373943_0016215 Ga0373943_0016215_2139_2756 205
920 3300035170 Ga0373943_0052145 Ga0373943_0052145_1254_1871 205
921 3300035170 Ga0373943_0149243 Ga0373943_0149243_47_664 205
922 3300035171 Ga0373946_0055669 Ga0373946_0055669_117_734 205
923 3300035172 Ga0373955_0005149 Ga0373955_0005149_5077_5694 205
924 3300035172 Ga0373955_0005891 Ga0373955_0005891_2877_3494 205
925 3300035172 Ga0373955_0019232 Ga0373955_0019232_1194_1811 205
926 3300035172 Ga0373955_0283010 Ga0373955_0283010_125_742 205
927 3300035691 Ga0373931_0030260 Ga0373931_0030260_1937_2554 205
928 3300035691 Ga0373931_0202044 Ga0373931_0202044_315_932 205
929 3300035692 Ga0373935_0097459 Ga0373935_0097459_1109_1726 205
930 3300035692 Ga0373935_0291398 Ga0373935_0291398_128_745 205
931 3300035695 Ga0373927_0044913 Ga0373927_0044913_958_1575 205
932 3300035695 Ga0373927_0299437 Ga0373927_0299437_114_731 205
933 3300035724 Ga0373933_0022005 Ga0373933_0022005_1768_2385 205
934 3300035724 Ga0373933_0046627 Ga0373933_0046627_755_1372 205
935 3300035725 Ga0373947_0016734 Ga0373947_0016734_2628_3245 205
936 3300035725 Ga0373947_0017986 Ga0373947_0017986_1945_2562 205
937 3300036401 Ga0373937_0029937 Ga0373937_0029937_2427_3044 205
938 3300036401 Ga0373937_0039848 Ga0373937_0039848_2013_2630 205
939 3300036401 Ga0373937_0107371 Ga0373937_0107371_1338_1955 205
940 3300036401 Ga0373937_0185947 Ga0373937_0185947_717_1334 205
941 3300036401 Ga0373937_0194369 Ga0373937_0194369_413_1030 205
942 3300036401 Ga0373937_0230801 Ga0373937_0230801_958_1575 205
943 3300036401 Ga0373937_0472803 Ga0373937_0472803_396_1013 205
944 3300036401 Ga0373937_1154884 Ga0373937_1154884_58_675 205
945 3300037068 Ga0373925_0000590 Ga0373925_0000590_7935_8552 205
946 3300037068 Ga0373925_0049162 Ga0373925_0049162_2326_2943 205
947 3300039437 Ga0436365_0044041 Ga0436365_0044041_5931_6548 205
948 3300039437 Ga0436365_0509827 Ga0436365_0509827_2120_2737 205
949 3300039437 Ga0436365_0654623 Ga0436365_0654623_1131_1751 205
950 3300039437 Ga0436365_1580088 Ga0436365_1580088_867_1490 205
951 3300042438 Ga0439459_0034393 Ga0439459_0034393_102_719 205
952 3300042439 Ga0439464_0029458 Ga0439464_0029458_285_902 205
953 3300042876 Ga0451577_0089001 Ga0451577_0089001_1327_1944 205
954 3300044673 Ga0453683_0389002 Ga0453683_0389002_53_670 205
955 3300044712 Ga0453684_0152163 Ga0453684_0152163_1109_1726 205
956 3300046459 Ga0495629_0004517 Ga0495629_0004517_1300_1917 205
957 3300046462 Ga0495651_0108139 Ga0495651_0108139_1033_1650 205
958 3300046463 Ga0495653_0138294 Ga0495653_0138294_1054_1671 205
959 3300046472 Ga0495580_0010020 Ga0495580_0010020_1959_2576 205
960 3300046472 Ga0495580_0097474 Ga0495580_0097474_436_1053 205
961 3300046473 Ga0495582_0006591 Ga0495582_0006591_5817_6434 205
962 3300046475 Ga0495639_0027364 Ga0495639_0027364_1296_1913 205
963 3300046476 Ga0495662_0011736 Ga0495662_0011736_150_767 205
964 3300046477 Ga0495664_0005933 Ga0495664_0005933_5986_6603 205
965 3300046477 Ga0495664_0165746 Ga0495664_0165746_238_855 205
966 3300046499 Ga0495594_0249068 Ga0495594_0249068_30_647 205
967 3300046499 Ga0495594_0277272 Ga0495594_0277272_281_898 205
968 3300046511 Ga0495608_0111049 Ga0495608_0111049_469_1086 205
969 3300046516 Ga0495628_0048954 Ga0495628_0048954_810_1427 205
970 3300046517 Ga0495630_0097748 Ga0495630_0097748_1240_1857 205
971 3300046517 Ga0495630_0603413 Ga0495630_0603413_185_802 205
972 3300046529 Ga0495652_0040636 Ga0495652_0040636_2881_3498 205
973 3300046535 Ga0495586_0156708 Ga0495586_0156708_146_763 205
974 3300046536 Ga0495587_0016689 Ga0495587_0016689_3312_3929 205
975 3300046536 Ga0495587_0247090 Ga0495587_0247090_357_974 205
976 3300046537 Ga0495598_0061443 Ga0495598_0061443_357_974 205
977 3300046537 Ga0495598_0072410 Ga0495598_0072410_459_1076 205
978 3300046539 Ga0495621_0099235 Ga0495621_0099235_19_636 205
979 3300046543 Ga0495645_0006456 Ga0495645_0006456_7345_7962 205
980 3300046543 Ga0495645_0010359 Ga0495645_0010359_2782_3399 205
981 3300046559 Ga0495667_0005937 Ga0495667_0005937_5268_5885 205
982 3300046559 Ga0495667_0029290 Ga0495667_0029290_1659_2276 205
983 3300046559 Ga0495667_0130112 Ga0495667_0130112_203_820 205
984 3300046642 Ga0495634_0093565 Ga0495634_0093565_308_925 205
985 3300046642 Ga0495634_0326900 Ga0495634_0326900_84_701 205
986 3300046663 Ga0495635_0006436 Ga0495635_0006436_7401_8018 205
987 3300046663 Ga0495635_0083582 Ga0495635_0083582_686_1303 205
988 3300046663 Ga0495635_0405620 Ga0495635_0405620_71_688 205
989 3300046678 Ga0495599_0090840 Ga0495599_0090840_564_1181 205
990 3300046678 Ga0495599_0134449 Ga0495599_0134449_649_1266 205
991 3300046679 Ga0495623_0052908 Ga0495623_0052908_435_1052 205
992 3300046681 Ga0495647_0003744 Ga0495647_0003744_473_1090 205
993 3300046683 Ga0495658_0015569 Ga0495658_0015569_2770_3387 205
994 3300046683 Ga0495658_0052053 Ga0495658_0052053_528_1145 205
995 3300046683 Ga0495658_0263794 Ga0495658_0263794_186_803 205
996 3300046690 Ga0495624_0395440 Ga0495624_0395440_51_668 205
997 3300046794 Ga0495589_0280508 Ga0495589_0280508_56_673 205
998 3300046809 Ga0495600_0078997 Ga0495600_0078997_1187_1804 205
999 3300047317 Ga0495604_0120134 Ga0495604_0120134_1158_1775 205
1000 3300047319 Ga0495674_0100401 Ga0495674_0100401_349_966 205
1001 3300047319 Ga0495674_0488673 Ga0495674_0488673_311_928 205
1002 3300047319 Ga0495674_0835783 Ga0495674_0835783_40_657 205
1003 3300047322 Ga0495680_0009463 Ga0495680_0009463_4984_5601 205
1004 3300047471 Ga0495684_0037006 Ga0495684_0037006_3112_3729 205
1005 3300047471 Ga0495684_0090417 Ga0495684_0090417_1464_2081 205
1006 3300047471 Ga0495684_0214035 Ga0495684_0214035_168_785 205
1007 3300047673 Ga0495593_0076227 Ga0495593_0076227_372_989 205
1008 3300048089 Ga0495614_0023691 Ga0495614_0023691_233_850 205
1009 3300048904 Ga0496101_0182373 Ga0496101_0182373_847_1464 205
1010 3300048904 Ga0496101_0266465 Ga0496101_0266465_611_1258 205
1011 3300048905 Ga0496102_0050224 Ga0496102_0050224_1018_1635 205
1012 3300048906 Ga0496103_0276486 Ga0496103_0276486_34_651 205
1013 3300048907 Ga0496104_0015350 Ga0496104_0015350_4879_5496 205
1014 3300048908 Ga0496105_0011726 Ga0496105_0011726_1429_2046 205
1015 3300048908 Ga0496105_0093632 Ga0496105_0093632_635_1252 205
1016 3300048908 Ga0496105_0465107 Ga0496105_0465107_135_752 205
1017 3300048909 Ga0496106_0005518 Ga0496106_0005518_378_995 205
1018 3300048909 Ga0496106_0169668 Ga0496106_0169668_149_766 205
1019 3300048909 Ga0496106_0467593 Ga0496106_0467593_66_683 205
1020 3300048910 Ga0496107_0043478 Ga0496107_0043478_2243_2860 205
1021 3300048911 Ga0496108_0080524 Ga0496108_0080524_1715_2332 205
1022 3300048911 Ga0496108_0146506 Ga0496108_0146506_937_1554 205
1023 3300048912 Ga0496109_0066764 Ga0496109_0066764_671_1288 205
1024 3300048912 Ga0496109_0355518 Ga0496109_0355518_360_1007 205
1025 3300048912 Ga0496109_0430597 Ga0496109_0430597_112_729 205
1026 3300048913 Ga0496110_0033803 Ga0496110_0033803_1458_2075 205
1027 3300048915 Ga0496112_0014655 Ga0496112_0014655_2674_3291 205
1028 3300048916 Ga0496113_0036349 Ga0496113_0036349_924_1541 205
1029 3300048916 Ga0496113_0698034 Ga0496113_0698034_178_795 205
1030 3300048917 Ga0496114_0052127 Ga0496114_0052127_2597_3214 205
1031 3300048917 Ga0496114_0166002 Ga0496114_0166002_448_1065 205
1032 3300048917 Ga0496114_0210490 Ga0496114_0210490_445_1062 205
1033 3300048917 Ga0496114_0455773 Ga0496114_0455773_153_770 205
1034 3300048917 Ga0496114_0528971 Ga0496114_0528971_63_680 205
1035 3300048918 Ga0496115_0018119 Ga0496115_0018119_822_1439 205
1036 3300048918 Ga0496115_0281847 Ga0496115_0281847_44_661 205
1037 3300049570 Ga0501033_0144320 Ga0501033_0144320_821_1438 205
1038 3300049572 Ga0501036_0432085 Ga0501036_0432085_240_857 205
1039 3300049581 Ga0501047_0049714 Ga0501047_0049714_1221_1838 205
1040 3300049589 Ga0501073_0239206 Ga0501073_0239206_292_909 205
1041 3300049823 Ga0501044_0208215 Ga0501044_0208215_501_1118 205
1042 3300049823 Ga0501044_0943172 Ga0501044_0943172_22_639 205
1043 3300050489 nmdc:mga03683_4319_c1 nmdc:mga03683_4319_c1_2253_2870 205
1044 3300050489 nmdc:mga03683_6208_c1 nmdc:mga03683_6208_c1_1396_2013 205
1045 3300050490 nmdc:mga03n38_124702_c1 nmdc:mga03n38_124702_c1_49_666 205
1046 3300050490 nmdc:mga03n38_218743_c1 nmdc:mga03n38_218743_c1_202_819 205
1047 3300050491 nmdc:mga00v17_81764_c1 nmdc:mga00v17_81764_c1_866_1483 205
1048 3300050492 nmdc:mga0yw44_44615_c1 nmdc:mga0yw44_44615_c1_453_1070 205
1049 3300050492 nmdc:mga0yw44_479291_c1 nmdc:mga0yw44_479291_c1_32_649 205
1050 3300050492 nmdc:mga0yw44_59622_c1 nmdc:mga0yw44_59622_c1_1595_2212 205
1051 3300050493 nmdc:mga0k408_123467_c1 nmdc:mga0k408_123467_c1_80_697 205
1052 3300050493 nmdc:mga0k408_6670_c1 nmdc:mga0k408_6670_c1_912_1529 205
1053 3300050494 nmdc:mga06z11_199255_c1 nmdc:mga06z11_199255_c1_288_905 205
1054 3300050494 nmdc:mga06z11_81624_c1 nmdc:mga06z11_81624_c1_901_1518 205
1055 3300050496 nmdc:mga07m45_16943_c1 nmdc:mga07m45_16943_c1_1239_1856 205
1056 3300050496 nmdc:mga07m45_70388_c1 nmdc:mga07m45_70388_c1_890_1507 205
1057 3300050496 nmdc:mga07m45_81342_c1 nmdc:mga07m45_81342_c1_1035_1652 205
1058 3300050511 nmdc:mga08y16_41859_c1 nmdc:mga08y16_41859_c1_2914_3531 205
1059 3300050511 nmdc:mga08y16_5508_c1 nmdc:mga08y16_5508_c1_7901_8518 205
1060 3300050511 nmdc:mga08y16_730642_c1 nmdc:mga08y16_730642_c1_100_717 205
1061 3300050512 nmdc:mga0n895_613323_c1 nmdc:mga0n895_613323_c1_170_787 205
1062 3300050513 nmdc:mga0rr50_218741_c1 nmdc:mga0rr50_218741_c1_547_1164 205
1063 3300050516 nmdc:mga0sz30_36350_c1 nmdc:mga0sz30_36350_c1_477_1094 205
1064 3300050516 nmdc:mga0sz30_55071_c1 nmdc:mga0sz30_55071_c1_217_834 205
1065 3300050516 nmdc:mga0sz30_880_c1 nmdc:mga0sz30_880_c1_10121_10738 205
1066 3300053077 Ga0495601_0026485 Ga0495601_0026485_2794_3411 205
1067 3300053077 Ga0495601_0254150 Ga0495601_0254150_187_804 205
1068 3300053079 Ga0500610_0153470 Ga0500610_0153470_96_713 205
1069 3300053084 Ga0495595_0214727 Ga0495595_0214727_282_899 205
1070 3300053085 Ga0495619_0003508 Ga0495619_0003508_4683_5300 205
1071 3300053088 Ga0500644_0136476 Ga0500644_0136476_71_688 205
1072 3300053096 Ga0500641_0000921 Ga0500641_0000921_22_639 205
1073 3300053130 Ga0500642_0113679 Ga0500642_0113679_302_919 205
1074 3300053139 Ga0500568_0020600 Ga0500568_0020600_240_857 205
1075 3300053153 Ga0500616_0002479 Ga0500616_0002479_88_705 205
1076 3300053153 Ga0500616_0003288 Ga0500616_0003288_10515_11132 205
1077 3300005328 Ga0070676_10003182 Ga0070676_100031825 206
1078 3300005330 Ga0070690_100001778 Ga0070690_1000017787 206
1079 3300005333 Ga0070677_10061670 Ga0070677_100616702 206
1080 3300005334 Ga0068869_100000718 Ga0068869_1000007188 206
1081 3300005335 Ga0070666_10025590 Ga0070666_100255902 206
1082 3300005340 Ga0070689_100166805 Ga0070689_1001668052 206
1083 3300005343 Ga0070687_100033961 Ga0070687_1000339611 206
1084 3300005347 Ga0070668_100017219 Ga0070668_1000172194 206
1085 3300005353 Ga0070669_100001820 Ga0070669_10000182011 206
1086 3300005353 Ga0070669_100005048 Ga0070669_1000050483 206
1087 3300005354 Ga0070675_100004647 Ga0070675_1000046476 206
1088 3300005354 Ga0070675_100004941 Ga0070675_1000049416 206
1089 3300005355 Ga0070671_100071216 Ga0070671_1000712163 206
1090 3300005356 Ga0070674_100047460 Ga0070674_1000474602 206
1091 3300005366 Ga0070659_100336001 Ga0070659_1003360011 206
1092 3300005367 Ga0070667_100015480 Ga0070667_1000154802 206
1093 3300005367 Ga0070667_100322139 Ga0070667_1003221392 206
1094 3300005441 Ga0070700_100102425 Ga0070700_1001024253 206
1095 3300005457 Ga0070662_100001774 Ga0070662_1000017749 206
1096 3300005459 Ga0068867_100003876 Ga0068867_1000038768 206
1097 3300005459 Ga0068867_100018663 Ga0068867_1000186632 206
1098 3300005543 Ga0070672_100000118 Ga0070672_1000001185 206
1099 3300005543 Ga0070672_100021523 Ga0070672_1000215235 206
1100 3300005544 Ga0070686_100338564 Ga0070686_1003385642 206
1101 3300005564 Ga0070664_100911928 Ga0070664_1009119282 206
1102 3300005616 Ga0068852_100561696 Ga0068852_1005616962 206
1103 3300005617 Ga0068859_100059506 Ga0068859_1000595062 206
1104 3300005618 Ga0068864_100003971 Ga0068864_1000039716 206
1105 3300005618 Ga0068864_100038210 Ga0068864_1000382105 206
1106 3300005718 Ga0068866_10005070 Ga0068866_100050705 206
1107 3300005719 Ga0068861_100000591 Ga0068861_10000059110 206
1108 3300005719 Ga0068861_100265320 Ga0068861_1002653202 206
1109 3300005841 Ga0068863_100004257 Ga0068863_10000425710 206
1110 3300005841 Ga0068863_100034575 Ga0068863_1000345755 206
1111 3300005841 Ga0068863_100256508 Ga0068863_1002565082 206
1112 3300005841 Ga0068863_100557609 Ga0068863_1005576091 206
1113 3300005842 Ga0068858_100013394 Ga0068858_1000133945 206
1114 3300005843 Ga0068860_100005410 Ga0068860_10000541011 206
1115 3300005844 Ga0068862_100003725 Ga0068862_1000037253 206
1116 3300005844 Ga0068862_100299060 Ga0068862_1002990602 206
1117 3300006177 Ga0075362_10058195 Ga0075362_100581952 206
1118 3300006881 Ga0068865_100000824 Ga0068865_10000082415 206
1119 3300006931 Ga0097620_100059506 Ga0097620_1000595065 206
1120 3300009098 Ga0105245_10113319 Ga0105245_101133193 206
1121 3300009148 Ga0105243_10048586 Ga0105243_100485864 206
1122 3300009174 Ga0105241_11156427 Ga0105241_111564271 206
1123 3300009176 Ga0105242_10084417 Ga0105242_100844174 206
1124 3300009177 Ga0105248_11096548 Ga0105248_110965482 206
1125 3300009553 Ga0105249_10002887 Ga0105249_100028874 206
1126 3300013297 Ga0157378_10115402 Ga0157378_101154023 206
1127 3300013306 Ga0163162_10004820 Ga0163162_100048208 206
1128 3300013308 Ga0157375_10001809 Ga0157375_100018092 206
1129 3300013308 Ga0157375_10002818 Ga0157375_1000281813 206
1130 3300014326 Ga0157380_10003603 Ga0157380_100036036 206
1131 3300014968 Ga0157379_10029206 Ga0157379_100292062 206
1132 3300014969 Ga0157376_11092605 Ga0157376_110926051 206
1133 3300017792 Ga0163161_10017198 Ga0163161_100171982 206
1134 3300017792 Ga0163161_10640060 Ga0163161_106400601 206
1135 3300025315 Ga0207697_10078982 Ga0207697_100789822 206
1136 3300025899 Ga0207642_10110758 Ga0207642_101107582 206
1137 3300025903 Ga0207680_10008077 Ga0207680_100080775 206
1138 3300025903 Ga0207680_10211599 Ga0207680_102115992 206
1139 3300025907 Ga0207645_10081064 Ga0207645_100810642 206
1140 3300025918 Ga0207662_10008862 Ga0207662_100088625 206
1141 3300025923 Ga0207681_10000507 Ga0207681_1000050712 206
1142 3300025923 Ga0207681_10006599 Ga0207681_100065993 206
1143 3300025925 Ga0207650_10021972 Ga0207650_100219723 206
1144 3300025925 Ga0207650_10375384 Ga0207650_103753842 206
1145 3300025926 Ga0207659_10039891 Ga0207659_100398911 206
1146 3300025926 Ga0207659_10226754 Ga0207659_102267542 206
1147 3300025927 Ga0207687_10200001 Ga0207687_102000013 206
1148 3300025928 Ga0207700_10000044 Ga0207700_1000004445 206
1149 3300025931 Ga0207644_10065529 Ga0207644_100655293 206
1150 3300025932 Ga0207690_10315172 Ga0207690_103151722 206
1151 3300025933 Ga0207706_10009529 Ga0207706_100095293 206
1152 3300025933 Ga0207706_10029601 Ga0207706_100296012 206
1153 3300025934 Ga0207686_10048919 Ga0207686_100489192 206
1154 3300025936 Ga0207670_10231639 Ga0207670_102316392 206
1155 3300025937 Ga0207669_10007739 Ga0207669_100077396 206
1156 3300025938 Ga0207704_10006006 Ga0207704_100060066 206
1157 3300025938 Ga0207704_10052413 Ga0207704_100524132 206
1158 3300025940 Ga0207691_10002155 Ga0207691_100021557 206
1159 3300025940 Ga0207691_10005710 Ga0207691_1000571010 206
1160 3300025942 Ga0207689_10005809 Ga0207689_100058092 206
1161 3300025945 Ga0207679_10293285 Ga0207679_102932852 206
1162 3300025960 Ga0207651_10047696 Ga0207651_100476962 206
1163 3300025960 Ga0207651_10237215 Ga0207651_102372151 206
1164 3300025961 Ga0207712_10003891 Ga0207712_100038915 206
1165 3300025972 Ga0207668_10001012 Ga0207668_1000101213 206
1166 3300025972 Ga0207668_10037262 Ga0207668_100372622 206
1167 3300025986 Ga0207658_10001563 Ga0207658_100015638 206
1168 3300025986 Ga0207658_10401101 Ga0207658_104011012 206
1169 3300026035 Ga0207703_10002328 Ga0207703_100023288 206
1170 3300026075 Ga0207708_10032759 Ga0207708_100327592 206
1171 3300026088 Ga0207641_10004027 Ga0207641_100040278 206
1172 3300026088 Ga0207641_10037230 Ga0207641_100372302 206
1173 3300026088 Ga0207641_10054235 Ga0207641_100542352 206
1174 3300026088 Ga0207641_10262816 Ga0207641_102628162 206
1175 3300026089 Ga0207648_10001707 Ga0207648_100017073 206
1176 3300026089 Ga0207648_10107786 Ga0207648_101077862 206
1177 3300026095 Ga0207676_10014275 Ga0207676_100142754 206
1178 3300026095 Ga0207676_10028133 Ga0207676_100281332 206
1179 3300026095 Ga0207676_10081493 Ga0207676_100814932 206
1180 3300026095 Ga0207676_10987628 Ga0207676_109876281 206
1181 3300026118 Ga0207675_100000483 Ga0207675_1000004839 206
1182 3300028380 Ga0268265_10030690 Ga0268265_100306904 206
1183 3300028381 Ga0268264_10003429 Ga0268264_1000342911 206
1184 3300028381 Ga0268264_10007952 Ga0268264_100079525 206
1185 3300037471 Ga0395905_0131297 Ga0395905_0131297_91_711 206
1186 3300037471 Ga0395905_0285391 Ga0395905_0285391_757_1377 206
1187 3300041486 Ga0451807_1243004 Ga0451807_1243004_39_659 206
1188 3300042876 Ga0451577_0206572 Ga0451577_0206572_1005_1625 206
1189 3300046473 Ga0495582_0146696 Ga0495582_0146696_640_1260 206
1190 3300048089 Ga0495614_0168839 Ga0495614_0168839_75_695 206
1191 3300005328 Ga0070676_10124936 Ga0070676_101249362 207
1192 3300005331 Ga0070670_100071184 Ga0070670_1000711844 207
1193 3300005331 Ga0070670_100144683 Ga0070670_1001446832 207
1194 3300005331 Ga0070670_100476147 Ga0070670_1004761472 207
1195 3300005333 Ga0070677_10026212 Ga0070677_100262124 207
1196 3300005333 Ga0070677_10193458 Ga0070677_101934582 207
1197 3300005335 Ga0070666_10099296 Ga0070666_100992962 207
1198 3300005338 Ga0068868_100452159 Ga0068868_1004521592 207
1199 3300005344 Ga0070661_100469023 Ga0070661_1004690231 207
1200 3300005353 Ga0070669_100098851 Ga0070669_1000988513 207
1201 3300005354 Ga0070675_100793101 Ga0070675_1007931011 207
1202 3300005355 Ga0070671_100329902 Ga0070671_1003299022 207
1203 3300005355 Ga0070671_100368004 Ga0070671_1003680042 207
1204 3300005356 Ga0070674_100061148 Ga0070674_1000611483 207
1205 3300005364 Ga0070673_100413039 Ga0070673_1004130392 207
1206 3300005366 Ga0070659_100291724 Ga0070659_1002917241 207
1207 3300005455 Ga0070663_100042894 Ga0070663_1000428943 207
1208 3300005456 Ga0070678_100252464 Ga0070678_1002524642 207
1209 3300005456 Ga0070678_100515891 Ga0070678_1005158912 207
1210 3300005457 Ga0070662_100091439 Ga0070662_1000914392 207
1211 3300005457 Ga0070662_100366244 Ga0070662_1003662442 207
1212 3300005459 Ga0068867_100495152 Ga0068867_1004951522 207
1213 3300005530 Ga0070679_100138104 Ga0070679_1001381043 207
1214 3300005543 Ga0070672_100200808 Ga0070672_1002008082 207
1215 3300005548 Ga0070665_100765123 Ga0070665_1007651232 207
1216 3300005564 Ga0070664_100027841 Ga0070664_1000278415 207
1217 3300005564 Ga0070664_100102327 Ga0070664_1001023272 207
1218 3300005564 Ga0070664_100195639 Ga0070664_1001956392 207
1219 3300005578 Ga0068854_100147108 Ga0068854_1001471083 207
1220 3300005578 Ga0068854_100404395 Ga0068854_1004043952 207
1221 3300005616 Ga0068852_100032601 Ga0068852_1000326015 207
1222 3300005616 Ga0068852_100139825 Ga0068852_1001398253 207
1223 3300005616 Ga0068852_100430835 Ga0068852_1004308352 207
1224 3300005834 Ga0068851_10192407 Ga0068851_101924072 207
1225 3300005841 Ga0068863_100162084 Ga0068863_1001620842 207
1226 3300006881 Ga0068865_100112702 Ga0068865_1001127022 207
1227 3300009148 Ga0105243_10376886 Ga0105243_103768862 207
1228 3300009551 Ga0105238_11269767 Ga0105238_112697671 207
1229 3300011119 Ga0105246_10419898 Ga0105246_104198981 207
1230 3300013102 Ga0157371_10155314 Ga0157371_101553143 207
1231 3300013105 Ga0157369_10501499 Ga0157369_105014992 207
1232 3300013296 Ga0157374_10308858 Ga0157374_103088583 207
1233 3300013297 Ga0157378_11506842 Ga0157378_115068421 207
1234 3300013306 Ga0163162_10591161 Ga0163162_105911611 207
1235 3300013307 Ga0157372_10726969 Ga0157372_107269692 207
1236 3300013308 Ga0157375_10102795 Ga0157375_101027953 207
1237 3300014325 Ga0163163_10074096 Ga0163163_100740964 207
1238 3300014325 Ga0163163_10866689 Ga0163163_108666892 207
1239 3300014968 Ga0157379_10390448 Ga0157379_103904483 207
1240 3300014968 Ga0157379_10812910 Ga0157379_108129102 207
1241 3300025321 Ga0207656_10118652 Ga0207656_101186522 207
1242 3300025893 Ga0207682_10009175 Ga0207682_100091756 207
1243 3300025893 Ga0207682_10010696 Ga0207682_100106964 207
1244 3300025893 Ga0207682_10050443 Ga0207682_100504432 207
1245 3300025901 Ga0207688_10071737 Ga0207688_100717372 207
1246 3300025907 Ga0207645_10131009 Ga0207645_101310092 207
1247 3300025909 Ga0207705_10328014 Ga0207705_103280142 207
1248 3300025920 Ga0207649_10167320 Ga0207649_101673202 207
1249 3300025920 Ga0207649_10641758 Ga0207649_106417582 207
1250 3300025921 Ga0207652_10102536 Ga0207652_101025362 207
1251 3300025923 Ga0207681_10370288 Ga0207681_103702882 207
1252 3300025925 Ga0207650_10008922 Ga0207650_100089225 207
1253 3300025925 Ga0207650_10071716 Ga0207650_100717162 207
1254 3300025925 Ga0207650_10204649 Ga0207650_102046492 207
1255 3300025926 Ga0207659_10111621 Ga0207659_101116213 207
1256 3300025931 Ga0207644_10413892 Ga0207644_104138922 207
1257 3300025931 Ga0207644_11041163 Ga0207644_110411631 207
1258 3300025933 Ga0207706_10052216 Ga0207706_100522164 207
1259 3300025933 Ga0207706_10167435 Ga0207706_101674352 207
1260 3300025935 Ga0207709_10199319 Ga0207709_101993192 207
1261 3300025937 Ga0207669_10504712 Ga0207669_105047122 207
1262 3300025939 Ga0207665_10100560 Ga0207665_101005603 207
1263 3300025940 Ga0207691_10047164 Ga0207691_100471642 207
1264 3300025940 Ga0207691_10063115 Ga0207691_100631153 207
1265 3300025940 Ga0207691_10513045 Ga0207691_105130452 207
1266 3300025941 Ga0207711_10397336 Ga0207711_103973362 207
1267 3300025960 Ga0207651_10215022 Ga0207651_102150222 207
1268 3300025961 Ga0207712_10259163 Ga0207712_102591632 207
1269 3300025981 Ga0207640_10132452 Ga0207640_101324523 207
1270 3300025981 Ga0207640_10601017 Ga0207640_106010171 207
1271 3300026023 Ga0207677_10162814 Ga0207677_101628143 207
1272 3300026041 Ga0207639_10472456 Ga0207639_104724562 207
1273 3300026067 Ga0207678_10087743 Ga0207678_100877431 207
1274 3300026088 Ga0207641_10213119 Ga0207641_102131193 207
1275 3300026089 Ga0207648_10072700 Ga0207648_100727004 207
1276 3300026089 Ga0207648_10140668 Ga0207648_101406682 207
1277 3300026095 Ga0207676_10104687 Ga0207676_101046872 207
1278 3300026121 Ga0207683_10311791 Ga0207683_103117912 207
1279 3300026142 Ga0207698_10028423 Ga0207698_100284233 207
1280 3300026142 Ga0207698_10172749 Ga0207698_101727492 207
1281 3300031242 Ga0265329_10031847 Ga0265329_100318472 207
1282 3300031711 Ga0265314_10006621 Ga0265314_100066215 207
1283 3300046681 Ga0495647_0066163 Ga0495647_0066163_232_855 207
1284 3300046683 Ga0495658_0121369 Ga0495658_0121369_358_981 207
1285 3300048903 Ga0496100_0676073 Ga0496100_0676073_112_735 207
1286 3300048907 Ga0496104_0396043 Ga0496104_0396043_413_1036 207
1287 3300048911 Ga0496108_0262943 Ga0496108_0262943_314_937 207
1288 3300005327 Ga0070658_10026579 Ga0070658_100265795 208
1289 3300005328 Ga0070676_10127160 Ga0070676_101271601 208
1290 3300005330 Ga0070690_100003093 Ga0070690_1000030932 208
1291 3300005334 Ga0068869_100032559 Ga0068869_1000325593 208
1292 3300005336 Ga0070680_100039551 Ga0070680_1000395511 208
1293 3300005340 Ga0070689_100001767 Ga0070689_10000176712 208
1294 3300005345 Ga0070692_10008842 Ga0070692_100088421 208
1295 3300005347 Ga0070668_100038788 Ga0070668_1000387883 208
1296 3300005355 Ga0070671_100012493 Ga0070671_1000124935 208
1297 3300005365 Ga0070688_100114923 Ga0070688_1001149232 208
1298 3300005438 Ga0070701_10033773 Ga0070701_100337731 208
1299 3300005440 Ga0070705_100046226 Ga0070705_1000462261 208
1300 3300005441 Ga0070700_100038590 Ga0070700_1000385901 208
1301 3300005456 Ga0070678_100025386 Ga0070678_1000253862 208
1302 3300005459 Ga0068867_100007205 Ga0068867_1000072055 208
1303 3300005459 Ga0068867_100008834 Ga0068867_1000088342 208
1304 3300005530 Ga0070679_100043068 Ga0070679_1000430682 208
1305 3300005543 Ga0070672_100008668 Ga0070672_1000086687 208
1306 3300005544 Ga0070686_100003723 Ga0070686_1000037239 208
1307 3300005545 Ga0070695_100063890 Ga0070695_1000638901 208
1308 3300005547 Ga0070693_100021652 Ga0070693_1000216523 208
1309 3300005549 Ga0070704_100091698 Ga0070704_1000916983 208
1310 3300005615 Ga0070702_100001533 Ga0070702_1000015332 208
1311 3300005617 Ga0068859_100077854 Ga0068859_1000778542 208
1312 3300005617 Ga0068859_100134114 Ga0068859_1001341141 208
1313 3300005618 Ga0068864_100072048 Ga0068864_1000720482 208
1314 3300005718 Ga0068866_10001469 Ga0068866_1000146912 208
1315 3300005718 Ga0068866_10015151 Ga0068866_100151514 208
1316 3300005719 Ga0068861_100042153 Ga0068861_1000421532 208
1317 3300005840 Ga0068870_10038859 Ga0068870_100388591 208
1318 3300005842 Ga0068858_100106272 Ga0068858_1001062724 208
1319 3300005842 Ga0068858_100133360 Ga0068858_1001333603 208
1320 3300005843 Ga0068860_100001386 Ga0068860_10000138612 208
1321 3300005843 Ga0068860_100290466 Ga0068860_1002904662 208
1322 3300005844 Ga0068862_100022960 Ga0068862_1000229605 208
1323 3300005844 Ga0068862_100090229 Ga0068862_1000902291 208
1324 3300006177 Ga0075362_10004154 Ga0075362_100041543 208
1325 3300006237 Ga0097621_100014225 Ga0097621_1000142255 208
1326 3300006237 Ga0097621_100495358 Ga0097621_1004953582 208
1327 3300006358 Ga0068871_100018911 Ga0068871_1000189113 208
1328 3300006358 Ga0068871_100161346 Ga0068871_1001613462 208
1329 3300006881 Ga0068865_100004561 Ga0068865_1000045615 208
1330 3300006881 Ga0068865_100330422 Ga0068865_1003304222 208
1331 3300006931 Ga0097620_100077851 Ga0097620_1000778512 208
1332 3300006931 Ga0097620_100134110 Ga0097620_1001341101 208
1333 3300009098 Ga0105245_10014490 Ga0105245_1001449010 208
1334 3300009098 Ga0105245_11056322 Ga0105245_110563222 208
1335 3300009148 Ga0105243_10009477 Ga0105243_100094779 208
1336 3300009148 Ga0105243_10051099 Ga0105243_100510995 208
1337 3300009176 Ga0105242_10006858 Ga0105242_100068582 208
1338 3300009551 Ga0105238_10561836 Ga0105238_105618363 208
1339 3300009553 Ga0105249_10011488 Ga0105249_100114887 208
1340 3300009553 Ga0105249_10047014 Ga0105249_100470144 208
1341 3300012507 Ga0157342_1027150 Ga0157342_10271501 208
1342 3300013297 Ga0157378_10001790 Ga0157378_1000179011 208
1343 3300013297 Ga0157378_10010502 Ga0157378_100105023 208
1344 3300013297 Ga0157378_10495569 Ga0157378_104955692 208
1345 3300013306 Ga0163162_11219658 Ga0163162_112196582 208
1346 3300013308 Ga0157375_10505455 Ga0157375_105054552 208
1347 3300014326 Ga0157380_10080155 Ga0157380_100801554 208
1348 3300014326 Ga0157380_10276351 Ga0157380_102763512 208
1349 3300014968 Ga0157379_10018797 Ga0157379_100187973 208
1350 3300014968 Ga0157379_10041797 Ga0157379_100417974 208
1351 3300014968 Ga0157379_10662506 Ga0157379_106625062 208
1352 3300025899 Ga0207642_10018140 Ga0207642_100181404 208
1353 3300025899 Ga0207642_10032246 Ga0207642_100322462 208
1354 3300025908 Ga0207643_10007603 Ga0207643_100076034 208
1355 3300025909 Ga0207705_10018066 Ga0207705_100180663 208
1356 3300025917 Ga0207660_10288417 Ga0207660_102884171 208
1357 3300025921 Ga0207652_10031258 Ga0207652_100312582 208
1358 3300025927 Ga0207687_10013732 Ga0207687_100137326 208
1359 3300025927 Ga0207687_10470522 Ga0207687_104705222 208
1360 3300025931 Ga0207644_10000462 Ga0207644_1000046224 208
1361 3300025934 Ga0207686_10010453 Ga0207686_100104532 208
1362 3300025935 Ga0207709_10033113 Ga0207709_100331133 208
1363 3300025936 Ga0207670_10051431 Ga0207670_100514312 208
1364 3300025937 Ga0207669_10016583 Ga0207669_100165835 208
1365 3300025938 Ga0207704_10015004 Ga0207704_100150044 208
1366 3300025938 Ga0207704_10110151 Ga0207704_101101511 208
1367 3300025940 Ga0207691_10041383 Ga0207691_100413834 208
1368 3300025942 Ga0207689_10000455 Ga0207689_1000045537 208
1369 3300025942 Ga0207689_10164469 Ga0207689_101644692 208
1370 3300025960 Ga0207651_10769242 Ga0207651_107692421 208
1371 3300025961 Ga0207712_10104219 Ga0207712_101042191 208
1372 3300025972 Ga0207668_10053463 Ga0207668_100534634 208
1373 3300026035 Ga0207703_10144546 Ga0207703_101445462 208
1374 3300026035 Ga0207703_10419271 Ga0207703_104192711 208
1375 3300026075 Ga0207708_10000339 Ga0207708_1000033922 208
1376 3300026075 Ga0207708_10089011 Ga0207708_100890112 208
1377 3300026088 Ga0207641_10433646 Ga0207641_104336462 208
1378 3300026089 Ga0207648_10001237 Ga0207648_100012377 208
1379 3300026089 Ga0207648_10003601 Ga0207648_1000360115 208
1380 3300026089 Ga0207648_10024722 Ga0207648_100247221 208
1381 3300026095 Ga0207676_10081234 Ga0207676_100812343 208
1382 3300026118 Ga0207675_100001346 Ga0207675_10000134623 208
1383 3300026118 Ga0207675_100008701 Ga0207675_1000087012 208
1384 3300026121 Ga0207683_10070423 Ga0207683_100704233 208
1385 3300026121 Ga0207683_10089135 Ga0207683_100891354 208
1386 3300026142 Ga0207698_10077876 Ga0207698_100778763 208
1387 3300027907 Ga0207428_10197016 Ga0207428_101970162 208
1388 3300028380 Ga0268265_10005960 Ga0268265_100059608 208
1389 3300028381 Ga0268264_10014230 Ga0268264_100142307 208
1390 3300032002 Ga0307416_100308414 Ga0307416_1003084141 208
1391 3300049823 Ga0501044_0266065 Ga0501044_0266065_56_682 208
1392 3300050489 nmdc:mga03683_26951_c1 nmdc:mga03683_26951_c1_1163_1792 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02211

NHase_beta_C

Nitrile hydratase beta subunit, C-terminal

104

200

0.96

PF21006

NHase_beta_N

Nitrile hydratase beta subunit, N-terminal

1

114

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dd4-assembly1.cif.gz_G thiocyanate hydrolase (scnase) from thiobacillus thioparus recombinant apo-enzyme 0.8576 110 204
7uqb-assembly1.cif.gz_T nucleoplasmic pre-60s intermediate of the nog2 containing pre-rotation state from a spb1-d52a strain with alf4 0.8431 116 206
6zj3-assembly1.cif.gz_Lh cryo-em structure of the highly atypical cytoplasmic ribosome of euglena gracilis 0.8266 116 204
6ylh-assembly1.cif.gz_T rix1-rea1 pre-60s particle - full composite structure 0.8237 116 206
8pv6-assembly1.cif.gz_LT chaetomium thermophilum pre-60s state 3 - post-5s rotation with rix1 complex with foot - composite structure 0.8224 116 204
ID Description Score Start End Superfamily
1ahjB02 Mainly Beta;Roll;SH3 type barrels.; 0.9669 106 204 2.30.30.50
4fm4D02 Mainly Beta;Roll;SH3 type barrels.; 0.9588 106 204 2.30.30.50
4fm4D02 Mainly Beta;Roll;SH3 type barrels.; 0.9313 106 204 2.30.30.50
1ahjB02 Mainly Beta;Roll;SH3 type barrels.; 0.9303 106 204 2.30.30.50
3hhtB02 Mainly Beta;Roll;SH3 type barrels.; 0.8902 111 203 2.30.30.50
ID Description Score Start End GO Terms
AF-K2DLQ1-F1-model_v4 Nitrile hydratase beta subunit domain-containing protein 0.9865 113 203
AF-A0A7W0JMP0-F1-model_v4 Nitrile hydratase subunit beta 0.977 21 93
AF-A0A523CYD7-F1-model_v4 Nitrile hydratase subunit beta 0.9572 129 204
AF-A0A6L8CLE5-F1-model_v4 Nitrile hydratase subunit beta 0.9531 116 205
AF-A0A2E0ADW7-F1-model_v4 Nitrile hydratase 0.953 123 205

Feature Viewer

pLDDT pTM Quality
88.98 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map