F493014

General Info

Members Datasets Scaffolds Average Seq Length
1324 384 2648 284

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_1016639|Ga0436360_1016639_1254_2117
Length 282
Sequence MTATPAPLPTRFARLVKIEHTVFALPFAYVGAFLAVGGTPTAHDLLWITLAMVGARSLAMALNRLIDRGIDARNPRTAGREIPSGQLSIAQVVLFCAASLALFLAAVWQLDPLVHRLWPIPVAGFVVYPYLKRVTWLCHLWLGAVDGLAPVGAWVAITGKLVLGAAVALWVAGFDFFYALFDLDVDRREGLHSIATEFGVRGAFTGARLAHLATVACLVAAGLGLSVGALYWIGVAAVAGLLAYEHSLVRPDDLRRLDTAFFTMNGVISVVFAVFVILDQAT

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
114 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
174 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
175 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
176 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
177 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
180 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
181 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
182 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
183 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
184 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
185 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
186 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
187 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
188 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
189 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
193 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
194 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
197 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
198 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
199 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
206 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
207 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
208 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
209 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
210 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
211 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
212 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
213 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
214 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
215 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
216 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
217 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
228 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
231 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
232 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
233 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
234 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
235 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
236 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
237 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
238 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
239 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
240 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
241 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
242 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
243 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
244 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
245 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
246 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
247 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
248 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
249 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
250 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
251 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
252 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
253 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
254 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
255 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
256 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
257 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
262 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
263 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
264 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
265 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
266 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
267 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
268 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
269 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
270 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
271 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
272 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
273 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
276 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
277 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
278 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
279 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
280 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
281 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
282 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
283 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
284 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
285 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
286 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
287 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
288 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
289 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
290 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
291 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
292 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
293 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
294 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
295 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
296 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
297 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
298 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
299 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
300 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
301 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
304 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
305 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
306 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
307 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
310 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
311 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
312 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
313 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
314 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
315 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
316 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
317 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
318 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
319 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
320 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
321 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
322 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
323 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
324 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
325 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
326 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
327 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
328 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
329 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
330 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
335 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
336 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
351 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
352 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
353 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
354 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
355 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
356 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
357 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
358 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
359 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
360 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
361 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
362 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
363 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
364 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
366 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
367 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
368 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
369 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
370 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
371 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
372 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
373 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
374 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
375 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
376 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
377 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
378 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
379 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
380 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
381 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
382 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
383 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
384 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 17.3
Rhizosphere 82.4
Stem 0
Stem Tuber 0
Unclassified 2.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_1016639 3300039438 Bacteria 9656
2 JGI25407J50210_10009508 3300003373 Bacteria 2464
3 Ga0070658_10012791 3300005327 Bacteria 6733
4 Ga0070658_10063646 3300005327 Bacteria 3007
5 Ga0070658_10114397 3300005327 Bacteria 2237
6 Ga0070658_10149871 3300005327 Bacteria 1952
7 Ga0070658_10169244 3300005327 Bacteria 1835
8 Ga0070683_100005050 3300005329 Bacteria 10955
9 Ga0070683_100026240 3300005329 Bacteria 5242
10 Ga0070683_100053877 3300005329 Bacteria 3728
11 Ga0070683_100073457 3300005329 Bacteria 3193
12 Ga0070683_100102836 3300005329 Bacteria 2691
13 Ga0070683_100165566 3300005329 Bacteria 2097
14 Ga0070690_100358059 3300005330 Bacteria 1061
15 Ga0070670_100232271 3300005331 Bacteria 1605
16 Ga0068869_100284701 3300005334 Bacteria 1330
17 Ga0068869_100307646 3300005334 Bacteria 1282
18 Ga0070666_10245088 3300005335 Bacteria 1268
19 Ga0070680_100006253 3300005336 Bacteria 9033
20 Ga0070680_100032586 3300005336 Bacteria 4195
21 Ga0070680_100064314 3300005336 Bacteria 3006
22 Ga0070680_100290897 3300005336 Bacteria 1385
23 Ga0070680_100458681 3300005336 Bacteria 1089
24 Ga0070682_100043893 3300005337 Bacteria 2765
25 Ga0070682_100045211 3300005337 Bacteria 2728
26 Ga0070682_100068968 3300005337 Bacteria 2257
27 Ga0068868_100060097 3300005338 Bacteria 3008
28 Ga0068868_100154711 3300005338 Bacteria 1890
29 Ga0068868_100175254 3300005338 Bacteria 1777
30 Ga0070660_100024614 3300005339 Bacteria 4466
31 Ga0070660_100045847 3300005339 Bacteria 3349
32 Ga0070660_100046194 3300005339 Bacteria 3337
33 Ga0070660_100046949 3300005339 Bacteria 3311
34 Ga0070660_100052003 3300005339 Bacteria 3156
35 Ga0070660_100270999 3300005339 Bacteria 1387
36 Ga0070689_100008221 3300005340 Bacteria 7337
37 Ga0070691_10068259 3300005341 Bacteria 1721
38 Ga0070661_100012445 3300005344 Bacteria 5951
39 Ga0070661_100109628 3300005344 Bacteria 2060
40 Ga0070661_100445191 3300005344 Bacteria 1030
41 Ga0070692_10004619 3300005345 Bacteria 5767
42 Ga0070692_10140230 3300005345 Bacteria 1367
43 Ga0070675_100161683 3300005354 Bacteria 1926
44 Ga0070671_100032295 3300005355 Bacteria 4328
45 Ga0070671_100093187 3300005355 Bacteria 2524
46 Ga0070674_100230187 3300005356 Bacteria 1446
47 Ga0070674_100445881 3300005356 Unclassified 1067
48 Ga0070673_100547224 3300005364 Bacteria 1051
49 Ga0070659_100031564 3300005366 Bacteria 4104
50 Ga0070667_100002001 3300005367 Bacteria 18056
51 Ga0070703_10002554 3300005406 Bacteria 5245
52 Ga0070703_10030854 3300005406 Bacteria 1618
53 Ga0070709_10028844 3300005434 Bacteria 3313
54 Ga0070709_10034021 3300005434 Bacteria 3087
55 Ga0070714_100004198 3300005435 Bacteria 10846
56 Ga0070714_100004838 3300005435 Bacteria 10221
57 Ga0070714_100023312 3300005435 Bacteria 5083
58 Ga0070714_100025095 3300005435 Bacteria 4917
59 Ga0070714_100072969 3300005435 Bacteria 2973
60 Ga0070714_100089467 3300005435 Bacteria 2695
61 Ga0070714_100254802 3300005435 Bacteria 1624
62 Ga0070714_100281644 3300005435 Bacteria 1545
63 Ga0070714_100298449 3300005435 Unclassified 1501
64 Ga0070714_100374294 3300005435 Bacteria 1341
65 Ga0070714_100573408 3300005435 Bacteria 1082
66 Ga0070713_100001060 3300005436 Bacteria 17565
67 Ga0070713_100017251 3300005436 Bacteria 5455
68 Ga0070713_100114537 3300005436 Bacteria 2356
69 Ga0070713_100170226 3300005436 Bacteria 1951
70 Ga0070710_10000443 3300005437 Bacteria 19486
71 Ga0070710_10171620 3300005437 Bacteria 1351
72 Ga0070701_10188709 3300005438 Bacteria 1212
73 Ga0070711_100011889 3300005439 Bacteria 5417
74 Ga0070711_100013538 3300005439 Bacteria 5122
75 Ga0070711_100021588 3300005439 Bacteria 4165
76 Ga0070711_100061153 3300005439 Bacteria 2621
77 Ga0070711_100206347 3300005439 Bacteria 1519
78 Ga0070711_100485727 3300005439 Bacteria 1016
79 Ga0070705_100001980 3300005440 Bacteria 10456
80 Ga0070705_100013747 3300005440 Bacteria 4146
81 Ga0070705_100018179 3300005440 Bacteria 3680
82 Ga0070700_100015619 3300005441 Bacteria 4310
83 Ga0070694_100038984 3300005444 Bacteria 3160
84 Ga0070708_100034217 3300005445 Bacteria 4420
85 Ga0070708_100220947 3300005445 Bacteria 1777
86 Ga0070663_100372014 3300005455 Bacteria 1162
87 Ga0070678_100002713 3300005456 Bacteria 9771
88 Ga0070678_100127047 3300005456 Bacteria 2020
89 Ga0070678_100139922 3300005456 Bacteria 1935
90 Ga0070681_10009404 3300005458 Bacteria 9617
91 Ga0070681_10017738 3300005458 Bacteria 7114
92 Ga0070681_10036127 3300005458 Bacteria 4963
93 Ga0070681_10057635 3300005458 Bacteria 3865
94 Ga0070681_10065039 3300005458 Bacteria 3616
95 Ga0070681_10083232 3300005458 Bacteria 3153
96 Ga0070681_10123323 3300005458 Bacteria 2524
97 Ga0070681_10164387 3300005458 Bacteria 2142
98 Ga0070681_10186406 3300005458 Bacteria 1995
99 Ga0068867_100000913 3300005459 Bacteria 20051
100 Ga0068867_100171456 3300005459 Bacteria 1719
101 Ga0068867_100260382 3300005459 Bacteria 1414
102 Ga0070685_10247899 3300005466 Unclassified 1178
103 Ga0070706_100046484 3300005467 Bacteria 4007
104 Ga0070706_100085657 3300005467 Bacteria 2920
105 Ga0070706_100198366 3300005467 Bacteria 1875
106 Ga0070706_100354329 3300005467 Bacteria 1368
107 Ga0070707_100002712 3300005468 Bacteria 16848
108 Ga0070707_100011501 3300005468 Bacteria 8253
109 Ga0070707_100155777 3300005468 Bacteria 2225
110 Ga0070707_100177888 3300005468 Bacteria 2074
111 Ga0070707_100297321 3300005468 Bacteria 1569
112 Ga0070707_100459801 3300005468 Bacteria 1233
113 Ga0070707_100503600 3300005468 Bacteria 1173
114 Ga0070698_100000853 3300005471 Bacteria 33433
115 Ga0070698_100015615 3300005471 Bacteria 8020
116 Ga0070698_100034960 3300005471 Bacteria 5197
117 Ga0070698_100063612 3300005471 Bacteria 3720
118 Ga0070698_100182169 3300005471 Bacteria 2039
119 Ga0070679_100003423 3300005530 Bacteria 14526
120 Ga0070679_100052984 3300005530 Bacteria 4039
121 Ga0070679_100112160 3300005530 Bacteria 2713
122 Ga0070679_100120333 3300005530 Bacteria 2610
123 Ga0070679_100156760 3300005530 Bacteria 2251
124 Ga0070679_100198244 3300005530 Bacteria 1974
125 Ga0070684_100000762 3300005535 Bacteria 22333
126 Ga0070684_100001409 3300005535 Bacteria 17288
127 Ga0070684_100029473 3300005535 Bacteria 4651
128 Ga0070684_100034824 3300005535 Bacteria 4307
129 Ga0070684_100044526 3300005535 Bacteria 3839
130 Ga0070684_100050892 3300005535 Bacteria 3599
131 Ga0070684_100081507 3300005535 Bacteria 2863
132 Ga0070684_100117734 3300005535 Bacteria 2387
133 Ga0070684_100119746 3300005535 Bacteria 2368
134 Ga0070684_100126232 3300005535 Bacteria 2305
135 Ga0070684_100172123 3300005535 Bacteria 1967
136 Ga0070697_100064098 3300005536 Bacteria 3001
137 Ga0070697_100170162 3300005536 Bacteria 1843
138 Ga0068853_100005764 3300005539 Bacteria 9750
139 Ga0068853_100179062 3300005539 Bacteria 1922
140 Ga0068853_100297938 3300005539 Bacteria 1490
141 Ga0070672_100036775 3300005543 Bacteria 3733
142 Ga0070686_100033420 3300005544 Bacteria 3161
143 Ga0070686_100105273 3300005544 Bacteria 1912
144 Ga0070695_100017454 3300005545 Bacteria 4352
145 Ga0070695_100084342 3300005545 Bacteria 2107
146 Ga0070696_100004176 3300005546 Bacteria 9624
147 Ga0070696_100034805 3300005546 Bacteria 3466
148 Ga0070693_100015388 3300005547 Bacteria 3938
149 Ga0070693_100069223 3300005547 Bacteria 2073
150 Ga0070693_100261239 3300005547 Bacteria 1152
151 Ga0070665_100013762 3300005548 Bacteria 8140
152 Ga0070704_100217705 3300005549 Bacteria 1551
153 Ga0068855_100023527 3300005563 Bacteria 7376
154 Ga0068855_100034915 3300005563 Bacteria 5992
155 Ga0068855_100101071 3300005563 Bacteria 3319
156 Ga0068855_100246350 3300005563 Bacteria 1995
157 Ga0068855_100472521 3300005563 Bacteria 1366
158 Ga0068855_100490321 3300005563 Bacteria 1336
159 Ga0070664_100104597 3300005564 Bacteria 2465
160 Ga0068857_100001692 3300005577 Bacteria 17733
161 Ga0068857_100043413 3300005577 Bacteria 3988
162 Ga0068857_100051612 3300005577 Bacteria 3650
163 Ga0068857_100278651 3300005577 Bacteria 1538
164 Ga0068854_100149252 3300005578 Bacteria 1801
165 Ga0068854_100162977 3300005578 Bacteria 1728
166 Ga0068856_100002581 3300005614 Bacteria 18656
167 Ga0068856_100043969 3300005614 Bacteria 4394
168 Ga0068856_100335162 3300005614 Bacteria 1531
169 Ga0068856_100384501 3300005614 Bacteria 1423
170 Ga0070702_100044121 3300005615 Bacteria 2515
171 Ga0070702_100151165 3300005615 Bacteria 1490
172 Ga0068852_100320981 3300005616 Bacteria 1504
173 Ga0068864_100025713 3300005618 Bacteria 4961
174 Ga0068866_10002623 3300005718 Bacteria 7431
175 Ga0068866_10091584 3300005718 Bacteria 1657
176 Ga0068861_100157244 3300005719 Bacteria 1871
177 Ga0068861_100237372 3300005719 Bacteria 1549
178 Ga0081455_10018767 3300005937 Bacteria 6563
179 Ga0081455_10055952 3300005937 Bacteria 3352
180 Ga0081538_10000100 3300005981 Bacteria 83917
181 Ga0081538_10016467 3300005981 Bacteria 5664
182 Ga0081540_1004488 3300005983 Bacteria 10610
183 Ga0081539_10000095 3300005985 Bacteria 204474
184 Ga0081539_10001005 3300005985 Bacteria 52334
185 Ga0070717_10005467 3300006028 Bacteria 9275
186 Ga0070717_10005558 3300006028 Bacteria 9196
187 Ga0070717_10030563 3300006028 Bacteria 4327
188 Ga0075365_10064967 3300006038 Bacteria 2445
189 Ga0075432_10044418 3300006058 Bacteria 1558
190 Ga0070715_10001395 3300006163 Bacteria 6980
191 Ga0070715_10005089 3300006163 Bacteria 4362
192 Ga0070715_10020497 3300006163 Bacteria 2551
193 Ga0070716_100005635 3300006173 Bacteria 6082
194 Ga0070712_100033918 3300006175 Bacteria 3457
195 Ga0070712_100040695 3300006175 Bacteria 3187
196 Ga0070712_100054382 3300006175 Bacteria 2799
197 Ga0070712_100131276 3300006175 Bacteria 1899
198 Ga0070712_100263968 3300006175 Bacteria 1381
199 Ga0070712_100345452 3300006175 Unclassified 1216
200 Ga0097621_100002459 3300006237 Bacteria 12676
201 Ga0097621_100105826 3300006237 Bacteria 2372
202 Ga0097621_100376153 3300006237 Bacteria 1268
203 Ga0068871_100145601 3300006358 Bacteria 2017
204 Ga0068871_100208963 3300006358 Bacteria 1688
205 Ga0075428_100005327 3300006844 Bacteria 14298
206 Ga0075431_100476000 3300006847 Bacteria 1242
207 Ga0075433_10002265 3300006852 Bacteria 14625
208 Ga0075433_10033469 3300006852 Bacteria 4406
209 Ga0075434_100001294 3300006871 Bacteria 20866
210 Ga0075434_100009463 3300006871 Bacteria 9085
211 Ga0075434_100162060 3300006871 Bacteria 2256
212 Ga0075434_100182287 3300006871 Bacteria 2120
213 Ga0075434_100489407 3300006871 Bacteria 1251
214 Ga0075434_100515776 3300006871 Bacteria 1216
215 Ga0068865_100012648 3300006881 Bacteria 5318
216 Ga0075436_100000915 3300006914 Bacteria 19663
217 Ga0075436_100009752 3300006914 Bacteria 6571
218 Ga0075436_100011075 3300006914 Bacteria 6186
219 Ga0075436_100083343 3300006914 Bacteria 2218
220 Ga0075436_100173171 3300006914 Bacteria 1524
221 Ga0075435_100001243 3300007076 Bacteria 16320
222 Ga0075435_100030849 3300007076 Bacteria 4218
223 Ga0075435_100082018 3300007076 Bacteria 2650
224 Ga0105240_10017296 3300009093 Bacteria 9720
225 Ga0105240_10106166 3300009093 Bacteria 3407
226 Ga0105240_10180778 3300009093 Bacteria 2489
227 Ga0105240_10250352 3300009093 Bacteria 2049
228 Ga0105240_10351008 3300009093 Bacteria 1673
229 Ga0105240_10625444 3300009093 Bacteria 1183
230 Ga0111539_10001300 3300009094 Bacteria 33359
231 Ga0111539_10003648 3300009094 Bacteria 20271
232 Ga0111539_10031645 3300009094 Bacteria 6427
233 Ga0111539_10038970 3300009094 Bacteria 5731
234 Ga0111539_10144163 3300009094 Bacteria 2788
235 Ga0111539_10178854 3300009094 Bacteria 2478
236 Ga0111539_10189315 3300009094 Bacteria 2401
237 Ga0111539_10199717 3300009094 Bacteria 2332
238 Ga0111539_10204142 3300009094 Unclassified 2304
239 Ga0111539_10288660 3300009094 Bacteria 1909
240 Ga0105245_10007177 3300009098 Bacteria 9767
241 Ga0105245_10016075 3300009098 Bacteria 6520
242 Ga0105245_10020104 3300009098 Bacteria 5853
243 Ga0105245_10028370 3300009098 Bacteria 4937
244 Ga0105245_10076745 3300009098 Bacteria 3045
245 Ga0105245_10077410 3300009098 Bacteria 3032
246 Ga0105245_10088218 3300009098 Bacteria 2849
247 Ga0105245_10146073 3300009098 Bacteria 2231
248 Ga0105245_10415010 3300009098 Bacteria 1348
249 Ga0105247_10206780 3300009101 Bacteria 1322
250 Ga0114129_10000141 3300009147 Bacteria 75420
251 Ga0114129_10016454 3300009147 Bacteria 10527
252 Ga0114129_10032839 3300009147 Bacteria 7333
253 Ga0114129_10125768 3300009147 Bacteria 3525
254 Ga0114129_10229065 3300009147 Unclassified 2503
255 Ga0114129_10518272 3300009147 Bacteria 1555
256 Ga0114129_10601237 3300009147 Bacteria 1425
257 Ga0114129_10623426 3300009147 Bacteria 1395
258 Ga0114129_10752386 3300009147 Bacteria 1247
259 Ga0105243_10031341 3300009148 Bacteria 4099
260 Ga0105243_10246127 3300009148 Bacteria 1594
261 Ga0105243_10633861 3300009148 Bacteria 1034
262 Ga0105241_10716541 3300009174 Bacteria 915
263 Ga0105242_10074064 3300009176 Bacteria 2832
264 Ga0105242_10389512 3300009176 Bacteria 1297
265 Ga0105248_10016541 3300009177 Bacteria 8123
266 Ga0105248_10430215 3300009177 Bacteria 1487
267 Ga0105248_10437885 3300009177 Bacteria 1472
268 Ga0105248_10551715 3300009177 Bacteria 1300
269 Ga0105237_10105826 3300009545 Bacteria 2805
270 Ga0105238_10091694 3300009551 Bacteria 3026
271 Ga0105238_10198028 3300009551 Bacteria 1984
272 Ga0105249_10001857 3300009553 Bacteria 18327
273 Ga0105239_10158940 3300010375 Bacteria 2524
274 Ga0105239_10196554 3300010375 Bacteria 2259
275 Ga0105239_10261355 3300010375 Bacteria 1945
276 Ga0105239_10284997 3300010375 Bacteria 1860
277 Ga0105246_10088817 3300011119 Bacteria 2222
278 Ga0105246_10098245 3300011119 Bacteria 2126
279 Ga0157371_10204373 3300013102 Bacteria 1417
280 Ga0157370_10015040 3300013104 Bacteria 7888
281 Ga0157370_10086075 3300013104 Bacteria 2953
282 Ga0157370_10153386 3300013104 Bacteria 2143
283 Ga0157369_10002742 3300013105 Bacteria 21036
284 Ga0157369_10017773 3300013105 Bacteria 7985
285 Ga0157369_10018104 3300013105 Bacteria 7901
286 Ga0157369_10035760 3300013105 Bacteria 5445
287 Ga0157369_10037107 3300013105 Bacteria 5338
288 Ga0157369_10149428 3300013105 Bacteria 2469
289 Ga0157369_10198355 3300013105 Bacteria 2107
290 Ga0157374_10020353 3300013296 Bacteria 5885
291 Ga0157374_10023645 3300013296 Bacteria 5499
292 Ga0157374_10085634 3300013296 Bacteria 2997
293 Ga0157378_10110998 3300013297 Bacteria 2514
294 Ga0157378_10191417 3300013297 Bacteria 1929
295 Ga0157378_10448914 3300013297 Bacteria 1279
296 Ga0163162_10032238 3300013306 Bacteria 5202
297 Ga0163162_10467857 3300013306 Unclassified 1392
298 Ga0157372_10080466 3300013307 Bacteria 3686
299 Ga0157372_10270207 3300013307 Bacteria 1975
300 Ga0157372_10352083 3300013307 Bacteria 1716
301 Ga0157375_10006585 3300013308 Bacteria 10110
302 Ga0157375_10045939 3300013308 Bacteria 4254
303 Ga0157375_10055423 3300013308 Bacteria 3909
304 Ga0157375_10300275 3300013308 Bacteria 1769
305 Ga0157375_10539078 3300013308 Bacteria 1329
306 Ga0157380_10001429 3300014326 Bacteria 15632
307 Ga0157377_10006457 3300014745 Bacteria 5598
308 Ga0157379_10119773 3300014968 Bacteria 2367
309 Ga0157376_10013193 3300014969 Bacteria 6157
310 Ga0157376_10114055 3300014969 Unclassified 2384
311 Ga0182007_10017644 3300015262 Bacteria 2602
312 Ga0197907_10740994 3300020069 Bacteria 1510
313 Ga0206356_10116221 3300020070 Bacteria 6173
314 Ga0206354_10232504 3300020081 Bacteria 1655
315 Ga0206353_11057617 3300020082 Bacteria 1090
316 Ga0206353_11605935 3300020082 Bacteria 7901
317 Ga0206353_11689011 3300020082 Bacteria 14322
318 Ga0213873_10033604 3300021358 Bacteria 1288
319 Ga0213871_10014400 3300021441 Bacteria 1875
320 Ga0207692_10006335 3300025898 Bacteria 4797
321 Ga0207692_10008917 3300025898 Bacteria 4169
322 Ga0207692_10068773 3300025898 Bacteria 1858
323 Ga0207692_10238382 3300025898 Bacteria 1085
324 Ga0207642_10200029 3300025899 Bacteria 1103
325 Ga0207688_10065403 3300025901 Bacteria 2055
326 Ga0207688_10102295 3300025901 Bacteria 1656
327 Ga0207680_10005081 3300025903 Bacteria 6267
328 Ga0207685_10001417 3300025905 Bacteria 5007
329 Ga0207685_10006373 3300025905 Bacteria 3209
330 Ga0207685_10033087 3300025905 Bacteria 1866
331 Ga0207699_10018015 3300025906 Bacteria 3733
332 Ga0207699_10155265 3300025906 Bacteria 1518
333 Ga0207699_10183722 3300025906 Bacteria 1407
334 Ga0207699_10309108 3300025906 Bacteria 1106
335 Ga0207643_10027055 3300025908 Bacteria 3179
336 Ga0207705_10137243 3300025909 Bacteria 1824
337 Ga0207705_10139465 3300025909 Bacteria 1810
338 Ga0207705_10149333 3300025909 Bacteria 1750
339 Ga0207684_10028521 3300025910 Bacteria 4756
340 Ga0207684_10103641 3300025910 Bacteria 2432
341 Ga0207684_10128772 3300025910 Bacteria 2173
342 Ga0207684_10467349 3300025910 Bacteria 1083
343 Ga0207707_10008396 3300025912 Bacteria 8961
344 Ga0207707_10030466 3300025912 Bacteria 4719
345 Ga0207707_10050817 3300025912 Bacteria 3610
346 Ga0207707_10065380 3300025912 Bacteria 3168
347 Ga0207707_10250954 3300025912 Unclassified 1537
348 Ga0207695_10009300 3300025913 Bacteria 12161
349 Ga0207695_10052410 3300025913 Bacteria 4275
350 Ga0207695_10216587 3300025913 Bacteria 1824
351 Ga0207695_10246270 3300025913 Archaea 1687
352 Ga0207693_10000468 3300025915 Bacteria 36863
353 Ga0207693_10003383 3300025915 Bacteria 13623
354 Ga0207693_10008117 3300025915 Bacteria 8606
355 Ga0207693_10015138 3300025915 Bacteria 6191
356 Ga0207693_10023335 3300025915 Bacteria 4912
357 Ga0207693_10069335 3300025915 Bacteria 2759
358 Ga0207693_10189074 3300025915 Bacteria 1621
359 Ga0207693_10273778 3300025915 Bacteria 1323
360 Ga0207693_10359449 3300025915 Bacteria 1139
361 Ga0207663_10057469 3300025916 Bacteria 2451
362 Ga0207663_10243328 3300025916 Bacteria 1320
363 Ga0207663_10414183 3300025916 Unclassified 1033
364 Ga0207663_10421374 3300025916 Bacteria 1025
365 Ga0207660_10130370 3300025917 Bacteria 1913
366 Ga0207660_10136895 3300025917 Bacteria 1869
367 Ga0207660_10460566 3300025917 Archaea 1029
368 Ga0207657_10000988 3300025919 Bacteria 30190
369 Ga0207657_10004731 3300025919 Bacteria 14370
370 Ga0207657_10009308 3300025919 Bacteria 9893
371 Ga0207657_10015573 3300025919 Bacteria 7360
372 Ga0207657_10024561 3300025919 Bacteria 5574
373 Ga0207657_10069096 3300025919 Bacteria 2999
374 Ga0207657_10336348 3300025919 Bacteria 1192
375 Ga0207649_10024155 3300025920 Bacteria 3530
376 Ga0207652_10045065 3300025921 Bacteria 3759
377 Ga0207652_10080258 3300025921 Bacteria 2852
378 Ga0207652_10092179 3300025921 Bacteria 2665
379 Ga0207652_10382396 3300025921 Unclassified 1270
380 Ga0207646_10001768 3300025922 Bacteria 26172
381 Ga0207646_10002982 3300025922 Bacteria 19556
382 Ga0207646_10005974 3300025922 Bacteria 12694
383 Ga0207646_10236098 3300025922 Bacteria 1652
384 Ga0207646_10272986 3300025922 Bacteria 1528
385 Ga0207646_10347720 3300025922 Bacteria 1340
386 Ga0207646_10478170 3300025922 Bacteria 1123
387 Ga0207681_10237340 3300025923 Bacteria 1418
388 Ga0207694_10176027 3300025924 Bacteria 1734
389 Ga0207694_10193388 3300025924 Bacteria 1653
390 Ga0207650_10041410 3300025925 Bacteria 3375
391 Ga0207659_10079179 3300025926 Bacteria 2424
392 Ga0207687_10060558 3300025927 Bacteria 2671
393 Ga0207687_10084981 3300025927 Bacteria 2295
394 Ga0207687_10160259 3300025927 Bacteria 1726
395 Ga0207687_10384413 3300025927 Unclassified 1151
396 Ga0207687_10575582 3300025927 Bacteria 947
397 Ga0207700_10000039 3300025928 Bacteria 102496
398 Ga0207700_10033783 3300025928 Bacteria 3663
399 Ga0207700_10158959 3300025928 Bacteria 1875
400 Ga0207700_10187583 3300025928 Bacteria 1736
401 Ga0207700_10310088 3300025928 Bacteria 1365
402 Ga0207700_10418481 3300025928 Bacteria 1177
403 Ga0207700_10439943 3300025928 Bacteria 1148
404 Ga0207664_10011034 3300025929 Bacteria 6401
405 Ga0207664_10018300 3300025929 Bacteria 5155
406 Ga0207664_10022691 3300025929 Bacteria 4692
407 Ga0207664_10040296 3300025929 Bacteria 3631
408 Ga0207664_10044151 3300025929 Bacteria 3489
409 Ga0207664_10049096 3300025929 Bacteria 3321
410 Ga0207664_10064076 3300025929 Bacteria 2938
411 Ga0207664_10072301 3300025929 Bacteria 2780
412 Ga0207664_10075761 3300025929 Bacteria 2721
413 Ga0207664_10107716 3300025929 Bacteria 2312
414 Ga0207664_10109430 3300025929 Bacteria 2296
415 Ga0207664_10132209 3300025929 Bacteria 2102
416 Ga0207664_10146176 3300025929 Bacteria 2005
417 Ga0207664_10258378 3300025929 Bacteria 1522
418 Ga0207664_10311446 3300025929 Bacteria 1387
419 Ga0207664_10352322 3300025929 Bacteria 1303
420 Ga0207644_10037229 3300025931 Bacteria 3422
421 Ga0207644_10385391 3300025931 Bacteria 1144
422 Ga0207690_10167735 3300025932 Bacteria 1642
423 Ga0207690_10191423 3300025932 Bacteria 1547
424 Ga0207706_10044731 3300025933 Bacteria 3923
425 Ga0207706_10048942 3300025933 Bacteria 3737
426 Ga0207686_10004740 3300025934 Bacteria 7296
427 Ga0207686_10148042 3300025934 Bacteria 1631
428 Ga0207686_10296150 3300025934 Unclassified 1200
429 Ga0207686_10350092 3300025934 Bacteria 1112
430 Ga0207709_10001987 3300025935 Bacteria 13317
431 Ga0207709_10041853 3300025935 Bacteria 2752
432 Ga0207709_10056938 3300025935 Bacteria 2422
433 Ga0207670_10005003 3300025936 Bacteria 7223
434 Ga0207669_10325134 3300025937 Bacteria 1179
435 Ga0207704_10068925 3300025938 Bacteria 2232
436 Ga0207704_10086150 3300025938 Archaea 2048
437 Ga0207665_10002358 3300025939 Bacteria 12754
438 Ga0207665_10022233 3300025939 Bacteria 4171
439 Ga0207665_10099705 3300025939 Bacteria 2026
440 Ga0207691_10008985 3300025940 Bacteria 9584
441 Ga0207691_10381473 3300025940 Unclassified 1203
442 Ga0207711_10284281 3300025941 Bacteria 1524
443 Ga0207711_10387493 3300025941 Bacteria 1297
444 Ga0207711_10547669 3300025941 Bacteria 1079
445 Ga0207661_10003288 3300025944 Bacteria 11218
446 Ga0207661_10009282 3300025944 Bacteria 7050
447 Ga0207661_10035675 3300025944 Bacteria 3877
448 Ga0207661_10082038 3300025944 Bacteria 2665
449 Ga0207661_10088182 3300025944 Bacteria 2578
450 Ga0207661_10135236 3300025944 Bacteria 2116
451 Ga0207661_10174694 3300025944 Bacteria 1872
452 Ga0207661_10203334 3300025944 Bacteria 1742
453 Ga0207661_10385319 3300025944 Bacteria 1269
454 Ga0207661_10516806 3300025944 Bacteria 1092
455 Ga0207679_10217655 3300025945 Bacteria 1605
456 Ga0207679_10299986 3300025945 Bacteria 1384
457 Ga0207667_10262907 3300025949 Bacteria 1764
458 Ga0207651_10269474 3300025960 Bacteria 1402
459 Ga0207640_10119282 3300025981 Unclassified 1886
460 Ga0207640_10213080 3300025981 Bacteria 1473
461 Ga0207640_10372966 3300025981 Bacteria 1154
462 Ga0207658_10002326 3300025986 Bacteria 13958
463 Ga0207658_10343087 3300025986 Unclassified 1299
464 Ga0207677_10120632 3300026023 Bacteria 1972
465 Ga0207677_10168895 3300026023 Bacteria 1708
466 Ga0207677_10250418 3300026023 Bacteria 1438
467 Ga0207677_10502275 3300026023 Bacteria 1049
468 Ga0207703_10276464 3300026035 Bacteria 1523
469 Ga0207639_10486147 3300026041 Bacteria 1126
470 Ga0207678_10191318 3300026067 Bacteria 1749
471 Ga0207708_10000400 3300026075 Bacteria 34258
472 Ga0207708_10005578 3300026075 Bacteria 9287
473 Ga0207708_10051886 3300026075 Bacteria 3124
474 Ga0207702_10107873 3300026078 Bacteria 2470
475 Ga0207702_10127857 3300026078 Bacteria 2283
476 Ga0207702_10436663 3300026078 Bacteria 1268
477 Ga0207702_10448545 3300026078 Bacteria 1251
478 Ga0207702_10507763 3300026078 Bacteria 1176
479 Ga0207641_10238689 3300026088 Bacteria 1693
480 Ga0207648_10005898 3300026089 Bacteria 12253
481 Ga0207648_10033391 3300026089 Bacteria 4539
482 Ga0207648_10061990 3300026089 Bacteria 3260
483 Ga0207648_10094073 3300026089 Bacteria 2620
484 Ga0207676_10021755 3300026095 Bacteria 4708
485 Ga0207676_10079799 3300026095 Bacteria 2655
486 Ga0207674_10003276 3300026116 Bacteria 19914
487 Ga0207674_10008281 3300026116 Bacteria 12042
488 Ga0207674_10011757 3300026116 Bacteria 9821
489 Ga0207674_10064147 3300026116 Bacteria 3706
490 Ga0207675_100004495 3300026118 Bacteria 13471
491 Ga0207675_100029762 3300026118 Bacteria 5085
492 Ga0207675_100063876 3300026118 Bacteria 3440
493 Ga0207675_100168285 3300026118 Bacteria 2094
494 Ga0207683_10000864 3300026121 Bacteria 27760
495 Ga0207683_10024235 3300026121 Bacteria 5223
496 Ga0207683_10098964 3300026121 Bacteria 2602
497 Ga0207683_10285260 3300026121 Bacteria 1509
498 Ga0207683_10724199 3300026121 Bacteria 923
499 Ga0207698_10103333 3300026142 Bacteria 2368
500 Ga0207698_10122159 3300026142 Bacteria 2206
501 Ga0207698_10176732 3300026142 Bacteria 1886
502 Ga0207428_10005934 3300027907 Bacteria 11308
503 Ga0207428_10012523 3300027907 Bacteria 7447
504 Ga0207428_10025233 3300027907 Bacteria 4976
505 Ga0207428_10111703 3300027907 Bacteria 2103
506 Ga0207428_10214319 3300027907 Bacteria 1446
507 Ga0268266_10342816 3300028379 Bacteria 1403
508 Ga0268265_10155629 3300028380 Bacteria 1934
509 Ga0265319_1000635 3300028563 Bacteria 23180
510 Ga0265318_10000338 3300028577 Bacteria 37223
511 Ga0265318_10003761 3300028577 Bacteria 7549
512 Ga0265323_10021941 3300028653 Bacteria 2443
513 Ga0265322_10054029 3300028654 Bacteria 1139
514 Ga0265336_10001093 3300028666 Bacteria 13087
515 Ga0265338_10000924 3300028800 Bacteria 49511
516 Ga0265338_10001048 3300028800 Bacteria 46186
517 Ga0265338_10007196 3300028800 Bacteria 13912
518 Ga0265338_10007510 3300028800 Bacteria 13496
519 Ga0265338_10049044 3300028800 Bacteria 3832
520 Ga0265338_10383456 3300028800 Bacteria 1005
521 Ga0265324_10035012 3300029957 Bacteria 1748
522 Ga0265330_10000327 3300031235 Bacteria 34205
523 Ga0265330_10029460 3300031235 Bacteria 2469
524 Ga0265330_10091494 3300031235 Bacteria 1306
525 Ga0265332_10006061 3300031238 Bacteria 5524
526 Ga0265332_10041282 3300031238 Bacteria 1996
527 Ga0265328_10000520 3300031239 Bacteria 17888
528 Ga0265320_10006577 3300031240 Bacteria 7306
529 Ga0265320_10101768 3300031240 Bacteria 1322
530 Ga0265325_10000102 3300031241 Bacteria 59998
531 Ga0265325_10034254 3300031241 Bacteria 2703
532 Ga0265329_10000373 3300031242 Bacteria 23681
533 Ga0265340_10002339 3300031247 Bacteria 10824
534 Ga0265339_10001624 3300031249 Bacteria 16616
535 Ga0265339_10008896 3300031249 Bacteria 6357
536 Ga0265331_10005697 3300031250 Bacteria 7474
537 Ga0265327_10008083 3300031251 Bacteria 7923
538 Ga0265327_10017059 3300031251 Bacteria 4575
539 Ga0265327_10044866 3300031251 Bacteria 2353
540 Ga0265327_10055369 3300031251 Bacteria 2049
541 Ga0265316_10021395 3300031344 Bacteria 5477
542 Ga0265316_10048991 3300031344 Bacteria 3330
543 Ga0307408_100421482 3300031548 Bacteria 1151
544 Ga0265313_10002639 3300031595 Bacteria 15258
545 Ga0265313_10005201 3300031595 Bacteria 9646
546 Ga0265313_10063101 3300031595 Bacteria 1728
547 Ga0265314_10002591 3300031711 Bacteria 18287
548 Ga0265342_10021609 3300031712 Bacteria 4105
549 Ga0265342_10042300 3300031712 Bacteria 2753
550 Ga0307405_10249309 3300031731 Unclassified 1320
551 Ga0307413_10002634 3300031824 Bacteria 7345
552 Ga0307410_10001992 3300031852 Bacteria 9620
553 Ga0307406_10050990 3300031901 Bacteria 2625
554 Ga0307406_10269187 3300031901 Unclassified 1293
555 Ga0307407_10000349 3300031903 Bacteria 13923
556 Ga0307407_10300766 3300031903 Unclassified 1118
557 Ga0307412_10007782 3300031911 Bacteria 6097
558 Ga0307409_100000397 3300031995 Bacteria 18516
559 Ga0307409_100176900 3300031995 Bacteria 1884
560 Ga0307409_100214615 3300031995 Bacteria 1732
561 Ga0307416_100005603 3300032002 Bacteria 7740
562 Ga0307416_100100631 3300032002 Bacteria 2514
563 Ga0307416_100156542 3300032002 Bacteria 2099
564 Ga0307416_100436695 3300032002 Bacteria 1358
565 Ga0307411_10012656 3300032005 Bacteria 4616
566 Ga0307415_100001163 3300032126 Bacteria 12295
567 Ga0307415_100037965 3300032126 Bacteria 3171
568 Ga0307415_100062191 3300032126 Bacteria 2588
569 Ga0373950_0005175 3300034818 Bacteria 1938
570 Ga0373959_0007706 3300034820 Bacteria 1815
571 Ga0373938_0000216 3300034957 Bacteria 8814
572 Ga0373928_0006191 3300035084 Bacteria 2298
573 Ga0373944_0004394 3300035089 Bacteria 3670
574 Ga0373944_0009886 3300035089 Bacteria 2594
575 Ga0373949_0002012 3300035090 Bacteria 5422
576 Ga0373951_0001205 3300035091 Bacteria 6839
577 Ga0373952_0012718 3300035092 Bacteria 1660
578 Ga0373932_0001256 3300035112 Bacteria 7192
579 Ga0373939_0001181 3300035114 Bacteria 6387
580 Ga0373939_0057899 3300035114 Unclassified 1224
581 Ga0373941_0000276 3300035115 Bacteria 9946
582 Ga0373941_0074329 3300035115 Bacteria 1135
583 Ga0373945_0005513 3300035116 Bacteria 4052
584 Ga0373945_0037285 3300035116 Unclassified 1744
585 Ga0373960_0000634 3300035121 Bacteria 7204
586 Ga0373943_0000198 3300035170 Bacteria 24537
587 Ga0373943_0007385 3300035170 Bacteria 4935
588 Ga0373943_0069273 3300035170 Bacteria 1783
589 Ga0373955_0027342 3300035172 Bacteria 2948
590 Ga0373962_0001041 3300035242 Bacteria 6430
591 Ga0373931_0067189 3300035691 Bacteria 1947
592 Ga0373935_0030017 3300035692 Bacteria 3367
593 Ga0373935_0041242 3300035692 Bacteria 2899
594 Ga0373935_0088079 3300035692 Bacteria 2028
595 Ga0373927_0133617 3300035695 Bacteria 1621
596 Ga0373947_0000463 3300035725 Bacteria 23167
597 Ga0373947_0002635 3300035725 Bacteria 10776
598 Ga0373947_0018309 3300035725 Bacteria 4031
599 Ga0373937_0000725 3300036401 Bacteria 28683
600 Ga0373937_0360398 3300036401 Bacteria 1378
601 Ga0373925_0002318 3300037068 Bacteria 15306
602 Ga0373925_0007695 3300037068 Bacteria 7848
603 Ga0373925_0201531 3300037068 Bacteria 1583
604 Ga0373925_0527320 3300037068 Bacteria 971
605 Ga0395899_0002568 3300037312 Bacteria 14676
606 Ga0395899_0003162 3300037312 Bacteria 13077
607 Ga0395899_0004845 3300037312 Bacteria 10480
608 Ga0395899_0008133 3300037312 Bacteria 8079
609 Ga0395899_0012840 3300037312 Bacteria 6415
610 Ga0395899_0020158 3300037312 Bacteria 5059
611 Ga0395899_0056216 3300037312 Bacteria 2909
612 Ga0395899_0060985 3300037312 Bacteria 2778
613 Ga0395899_0077652 3300037312 Bacteria 2421
614 Ga0395899_0081177 3300037312 Bacteria 2360
615 Ga0395899_0096108 3300037312 Bacteria 2143
616 Ga0395899_0145793 3300037312 Bacteria 1681
617 Ga0395899_0178560 3300037312 Bacteria 1492
618 Ga0395900_0000936 3300037418 Bacteria 38235
619 Ga0395900_0001219 3300037418 Bacteria 31689
620 Ga0395900_0001485 3300037418 Bacteria 27947
621 Ga0395900_0001640 3300037418 Bacteria 26256
622 Ga0395900_0004351 3300037418 Bacteria 15029
623 Ga0395900_0004452 3300037418 Bacteria 14842
624 Ga0395900_0011047 3300037418 Bacteria 9228
625 Ga0395900_0011339 3300037418 Bacteria 9119
626 Ga0395900_0027999 3300037418 Bacteria 5770
627 Ga0395900_0033901 3300037418 Bacteria 5254
628 Ga0395900_0041177 3300037418 Bacteria 4763
629 Ga0395900_0058494 3300037418 Bacteria 3968
630 Ga0395900_0061075 3300037418 Bacteria 3876
631 Ga0395900_0080051 3300037418 Bacteria 3357
632 Ga0395900_0083765 3300037418 Bacteria 3276
633 Ga0395900_0120566 3300037418 Bacteria 2691
634 Ga0395900_0132440 3300037418 Bacteria 2554
635 Ga0395900_0267924 3300037418 Bacteria 1704
636 Ga0395900_0367305 3300037418 Bacteria 1409
637 Ga0395900_0480990 3300037418 Bacteria 1194
638 Ga0395900_0620719 3300037418 Bacteria 1020
639 Ga0395898_0002883 3300037466 Bacteria 19614
640 Ga0395898_0004426 3300037466 Bacteria 15372
641 Ga0395898_0008367 3300037466 Bacteria 10937
642 Ga0395898_0009260 3300037466 Bacteria 10357
643 Ga0395898_0013090 3300037466 Bacteria 8553
644 Ga0395898_0013266 3300037466 Bacteria 8487
645 Ga0395898_0019282 3300037466 Bacteria 6944
646 Ga0395898_0020108 3300037466 Bacteria 6783
647 Ga0395898_0057411 3300037466 Bacteria 3793
648 Ga0395898_0058471 3300037466 Bacteria 3753
649 Ga0395898_0059459 3300037466 Bacteria 3718
650 Ga0395898_0097904 3300037466 Bacteria 2816
651 Ga0395898_0116892 3300037466 Bacteria 2555
652 Ga0395898_0121216 3300037466 Bacteria 2506
653 Ga0395898_0125066 3300037466 Bacteria 2463
654 Ga0395898_0136845 3300037466 Bacteria 2345
655 Ga0395898_0150134 3300037466 Bacteria 2230
656 Ga0395898_0248180 3300037466 Bacteria 1698
657 Ga0395898_0280186 3300037466 Bacteria 1590
658 Ga0395898_0306945 3300037466 Bacteria 1513
659 Ga0395898_0402794 3300037466 Bacteria 1304
660 Ga0395905_0000640 3300037471 Bacteria 46768
661 Ga0395905_0002737 3300037471 Bacteria 19288
662 Ga0395905_0003392 3300037471 Bacteria 17054
663 Ga0395905_0007797 3300037471 Bacteria 10619
664 Ga0395905_0010027 3300037471 Bacteria 9235
665 Ga0395905_0023445 3300037471 Bacteria 5831
666 Ga0395905_0028476 3300037471 Bacteria 5267
667 Ga0395905_0039598 3300037471 Bacteria 4422
668 Ga0395905_0050522 3300037471 Bacteria 3895
669 Ga0395905_0095756 3300037471 Bacteria 2786
670 Ga0395905_0117390 3300037471 Bacteria 2500
671 Ga0395905_0117981 3300037471 Bacteria 2494
672 Ga0395905_0136848 3300037471 Bacteria 2305
673 Ga0395905_0202542 3300037471 Bacteria 1860
674 Ga0395905_0244481 3300037471 Bacteria 1676
675 Ga0395905_0364732 3300037471 Bacteria 1337
676 Ga0395901_0000978 3300038443 Bacteria 30977
677 Ga0395901_0001841 3300038443 Bacteria 21913
678 Ga0395901_0002650 3300038443 Bacteria 18087
679 Ga0395901_0002692 3300038443 Bacteria 17910
680 Ga0395901_0003282 3300038443 Bacteria 16280
681 Ga0395901_0011802 3300038443 Bacteria 8859
682 Ga0395901_0016787 3300038443 Bacteria 7460
683 Ga0395901_0016998 3300038443 Bacteria 7414
684 Ga0395901_0017797 3300038443 Bacteria 7251
685 Ga0395901_0038275 3300038443 Bacteria 4961
686 Ga0395901_0058107 3300038443 Bacteria 4023
687 Ga0395901_0069330 3300038443 Bacteria 3672
688 Ga0395901_0081251 3300038443 Bacteria 3385
689 Ga0395901_0088306 3300038443 Bacteria 3242
690 Ga0395901_0107083 3300038443 Bacteria 2934
691 Ga0395901_0117408 3300038443 Bacteria 2795
692 Ga0395901_0204796 3300038443 Bacteria 2067
693 Ga0395901_0224804 3300038443 Bacteria 1961
694 Ga0395901_0228865 3300038443 Bacteria 1941
695 Ga0395901_0232023 3300038443 Unclassified 1926
696 Ga0395901_0282032 3300038443 Bacteria 1726
697 Ga0395901_0306187 3300038443 Bacteria 1647
698 Ga0395901_0338756 3300038443 Bacteria 1554
699 Ga0395901_0452715 3300038443 Unclassified 1312
700 Ga0436360_0072764 3300039438 Bacteria 1325
701 Ga0436360_0325104 3300039438 Bacteria 8312
702 Ga0436362_0000471 3300039453 Bacteria 3860
703 Ga0439453_0004034 3300041408 Bacteria 2159
704 Ga0439431_0004459 3300041997 Bacteria 3079
705 Ga0439433_0001788 3300041999 Bacteria 4469
706 Ga0439448_0010127 3300042005 Bacteria 2788
707 Ga0439448_0050964 3300042005 Bacteria 1355
708 Ga0439454_013683 3300042011 Bacteria 1117
709 Ga0439455_0052896 3300042012 Bacteria 1064
710 Ga0439446_0009779 3300042156 Bacteria 2572
711 Ga0439434_0026494 3300042435 Bacteria 1751
712 Ga0466969_0003306 3300044656 Bacteria 8575
713 Ga0466969_0027186 3300044656 Bacteria 2930
714 Ga0466972_0036719 3300044658 Bacteria 2396
715 Ga0466965_0023576 3300044683 Bacteria 2972
716 Ga0466965_0091376 3300044683 Bacteria 1549
717 Ga0466966_0008955 3300044684 Bacteria 6632
718 Ga0466966_0039067 3300044684 Bacteria 3056
719 Ga0466961_0016940 3300044693 Bacteria 4682
720 Ga0466961_0043432 3300044693 Bacteria 2879
721 Ga0466961_0061392 3300044693 Bacteria 2389
722 Ga0466961_0136160 3300044693 Bacteria 1539
723 Ga0466961_0185539 3300044693 Bacteria 1290
724 Ga0466963_0000095 3300044694 Bacteria 31064
725 Ga0466963_0000705 3300044694 Bacteria 16314
726 Ga0466963_0000857 3300044694 Bacteria 15366
727 Ga0466963_0008069 3300044694 Bacteria 6303
728 Ga0466963_0009173 3300044694 Bacteria 5950
729 Ga0466963_0011499 3300044694 Bacteria 5390
730 Ga0466963_0014736 3300044694 Bacteria 4825
731 Ga0466963_0018021 3300044694 Bacteria 4406
732 Ga0466963_0023819 3300044694 Bacteria 3892
733 Ga0466963_0028626 3300044694 Bacteria 3579
734 Ga0466963_0030330 3300044694 Bacteria 3488
735 Ga0466963_0037276 3300044694 Bacteria 3173
736 Ga0466963_0042093 3300044694 Bacteria 2998
737 Ga0466963_0078175 3300044694 Bacteria 2236
738 Ga0466963_0083799 3300044694 Bacteria 2162
739 Ga0466963_0163639 3300044694 Bacteria 1549
740 Ga0466963_0207139 3300044694 Bacteria 1372
741 Ga0466964_0001480 3300044706 Bacteria 8039
742 Ga0466964_0001981 3300044706 Bacteria 7183
743 Ga0466964_0007054 3300044706 Bacteria 4203
744 Ga0466964_0024500 3300044706 Bacteria 2352
745 Ga0466964_0025725 3300044706 Bacteria 2300
746 Ga0466964_0128097 3300044706 Bacteria 1153
747 Ga0466964_0130877 3300044706 Bacteria 1142
748 Ga0466964_0131755 3300044706 Bacteria 1139
749 Ga0466971_0003250 3300044719 Bacteria 6933
750 Ga0466971_0015522 3300044719 Bacteria 3354
751 Ga0466971_0020860 3300044719 Bacteria 2913
752 Ga0466971_0042634 3300044719 Bacteria 2039
753 Ga0466971_0042660 3300044719 Bacteria 2038
754 Ga0466971_0219805 3300044719 Bacteria 900
755 Ga0466968_0002238 3300044735 Bacteria 7071
756 Ga0466968_0006491 3300044735 Bacteria 4411
757 Ga0466968_0018435 3300044735 Bacteria 2799
758 Ga0466968_0020838 3300044735 Bacteria 2650
759 Ga0466968_0033912 3300044735 Bacteria 2128
760 Ga0466968_0034595 3300044735 Bacteria 2109
761 Ga0466968_0044769 3300044735 Bacteria 1876
762 Ga0466968_0050752 3300044735 Bacteria 1771
763 Ga0466968_0066253 3300044735 Bacteria 1564
764 Ga0466970_0040086 3300044765 Bacteria 2486
765 Ga0466970_0108568 3300044765 Unclassified 1515
766 Ga0466957_0001672 3300044842 Bacteria 11652
767 Ga0466957_0002974 3300044842 Bacteria 9202
768 Ga0466957_0008669 3300044842 Bacteria 5790
769 Ga0466957_0015929 3300044842 Bacteria 4393
770 Ga0466957_0018921 3300044842 Bacteria 4048
771 Ga0466957_0033943 3300044842 Bacteria 3061
772 Ga0466957_0060142 3300044842 Bacteria 2329
773 Ga0466957_0096331 3300044842 Bacteria 1859
774 Ga0466957_0262522 3300044842 Bacteria 1151
775 Ga0466957_0423275 3300044842 Unclassified 914
776 Ga0466960_0004411 3300044901 Bacteria 5497
777 Ga0466960_0044665 3300044901 Bacteria 2113
778 Ga0466960_0045687 3300044901 Bacteria 2093
779 Ga0466959_0002457 3300045049 Bacteria 11851
780 Ga0466959_0005223 3300045049 Bacteria 8862
781 Ga0466959_0014268 3300045049 Bacteria 5766
782 Ga0466959_0026055 3300045049 Bacteria 4336
783 Ga0466959_0036203 3300045049 Bacteria 3647
784 Ga0466959_0045680 3300045049 Bacteria 3225
785 Ga0466959_0081935 3300045049 Bacteria 2325
786 Ga0451576_0052216 3300045051 Bacteria 4284
787 Ga0466958_0002667 3300045836 Bacteria 9029
788 Ga0466958_0004618 3300045836 Bacteria 7298
789 Ga0466958_0007167 3300045836 Bacteria 6113
790 Ga0466958_0009418 3300045836 Bacteria 5443
791 Ga0466958_0013118 3300045836 Bacteria 4711
792 Ga0466958_0041087 3300045836 Bacteria 2781
793 Ga0466958_0042172 3300045836 Bacteria 2747
794 Ga0466958_0077821 3300045836 Bacteria 2037
795 Ga0466958_0086108 3300045836 Bacteria 1939
796 Ga0466958_0102836 3300045836 Bacteria 1778
797 Ga0466958_0185700 3300045836 Bacteria 1320
798 Ga0466958_0245978 3300045836 Bacteria 1143
799 Ga0466967_0002678 3300045976 Bacteria 11240
800 Ga0466967_0008051 3300045976 Bacteria 7683
801 Ga0466967_0015896 3300045976 Bacteria 5915
802 Ga0466967_0020790 3300045976 Bacteria 5316
803 Ga0466967_0025255 3300045976 Bacteria 4897
804 Ga0466967_0028485 3300045976 Bacteria 4662
805 Ga0466967_0029109 3300045976 Bacteria 4619
806 Ga0466967_0037568 3300045976 Bacteria 4145
807 Ga0466967_0043946 3300045976 Bacteria 3871
808 Ga0466967_0056030 3300045976 Bacteria 3474
809 Ga0466967_0056885 3300045976 Bacteria 3450
810 Ga0466967_0063628 3300045976 Bacteria 3278
811 Ga0466967_0080325 3300045976 Bacteria 2942
812 Ga0466967_0098860 3300045976 Bacteria 2664
813 Ga0466967_0102239 3300045976 Bacteria 2621
814 Ga0466967_0116645 3300045976 Bacteria 2460
815 Ga0466967_0123887 3300045976 Bacteria 2392
816 Ga0466967_0140917 3300045976 Bacteria 2246
817 Ga0466967_0157618 3300045976 Bacteria 2128
818 Ga0466967_0188657 3300045976 Bacteria 1947
819 Ga0466967_0212175 3300045976 Bacteria 1836
820 Ga0466967_0218654 3300045976 Bacteria 1809
821 Ga0466967_0218956 3300045976 Bacteria 1808
822 Ga0466967_0414494 3300045976 Bacteria 1312
823 Ga0466967_0594491 3300045976 Bacteria 1092
824 Ga0466967_0755032 3300045976 Unclassified 965
825 Ga0495617_066573 3300046452 Bacteria 1187
826 Ga0495592_0000050 3300046454 Bacteria 111971
827 Ga0495592_0012008 3300046454 Bacteria 6564
828 Ga0495592_0027375 3300046454 Bacteria 4322
829 Ga0495603_0000081 3300046455 Bacteria 42501
830 Ga0495603_0005193 3300046455 Bacteria 7776
831 Ga0495603_0016668 3300046455 Bacteria 4445
832 Ga0495603_0022206 3300046455 Bacteria 3843
833 Ga0495629_0005211 3300046459 Bacteria 9734
834 Ga0495629_0154036 3300046459 Bacteria 1597
835 Ga0495641_0002133 3300046461 Bacteria 15953
836 Ga0495641_0005435 3300046461 Bacteria 8615
837 Ga0495651_0000028 3300046462 Bacteria 105473
838 Ga0495653_0005030 3300046463 Bacteria 10729
839 Ga0495653_0144677 3300046463 Bacteria 1668
840 Ga0495653_0168998 3300046463 Bacteria 1511
841 Ga0495653_0220685 3300046463 Bacteria 1274
842 Ga0495580_0013968 3300046472 Bacteria 6109
843 Ga0495580_0035292 3300046472 Bacteria 3596
844 Ga0495580_0286149 3300046472 Bacteria 1124
845 Ga0495582_0023069 3300046473 Bacteria 3404
846 Ga0495582_0027338 3300046473 Bacteria 3126
847 Ga0495582_0041322 3300046473 Bacteria 2540
848 Ga0495582_0067921 3300046473 Bacteria 1970
849 Ga0495605_0099798 3300046474 Bacteria 1336
850 Ga0495605_0101760 3300046474 Bacteria 1320
851 Ga0495639_0026021 3300046475 Bacteria 2583
852 Ga0495662_0030188 3300046476 Bacteria 2616
853 Ga0495664_0038850 3300046477 Bacteria 2810
854 Ga0495664_0206601 3300046477 Bacteria 1190
855 Ga0495584_0010750 3300046491 Bacteria 4701
856 Ga0495594_0000536 3300046499 Bacteria 19443
857 Ga0495596_0024479 3300046500 Bacteria 2443
858 Ga0495607_0032668 3300046501 Bacteria 3174
859 Ga0495608_0000555 3300046511 Bacteria 25761
860 Ga0495608_0006235 3300046511 Bacteria 8464
861 Ga0495608_0292274 3300046511 Bacteria 1010
862 Ga0495618_0011013 3300046514 Bacteria 5481
863 Ga0495618_0015268 3300046514 Bacteria 4686
864 Ga0495628_0000060 3300046516 Bacteria 87173
865 Ga0495628_0030989 3300046516 Bacteria 4326
866 Ga0495628_0217609 3300046516 Bacteria 1435
867 Ga0495628_0271208 3300046516 Bacteria 1262
868 Ga0495630_0004280 3300046517 Bacteria 10013
869 Ga0495630_0011832 3300046517 Bacteria 6323
870 Ga0495630_0043614 3300046517 Bacteria 3351
871 Ga0495630_0124813 3300046517 Bacteria 1953
872 Ga0495630_0127901 3300046517 Bacteria 1928
873 Ga0495663_0008292 3300046525 Bacteria 2877
874 Ga0495663_0063146 3300046525 Bacteria 1167
875 Ga0495666_0026341 3300046526 Bacteria 2867
876 Ga0495666_0164870 3300046526 Bacteria 1026
877 Ga0495652_0000969 3300046529 Bacteria 32863
878 Ga0495652_0020746 3300046529 Bacteria 5841
879 Ga0495652_0032336 3300046529 Bacteria 4576
880 Ga0495652_0034234 3300046529 Bacteria 4428
881 Ga0495652_0052975 3300046529 Bacteria 3459
882 Ga0495652_0276735 3300046529 Bacteria 1231
883 Ga0495652_0314676 3300046529 Bacteria 1133
884 Ga0495665_0004858 3300046531 Bacteria 7249
885 Ga0495665_0167412 3300046531 Bacteria 1145
886 Ga0495586_0000939 3300046535 Bacteria 16532
887 Ga0495587_0000062 3300046536 Bacteria 91862
888 Ga0495609_0117563 3300046538 Bacteria 1145
889 Ga0495645_0000207 3300046543 Bacteria 42086
890 Ga0495622_0051305 3300046557 Bacteria 1914
891 Ga0495667_0029836 3300046559 Bacteria 3669
892 Ga0495667_0112698 3300046559 Bacteria 1758
893 Ga0495667_0265183 3300046559 Bacteria 1092
894 Ga0495656_0003250 3300046615 Bacteria 5481
895 Ga0495656_0072527 3300046615 Unclassified 1533
896 Ga0495656_0116517 3300046615 Bacteria 1256
897 Ga0495634_0028969 3300046642 Bacteria 3838
898 Ga0495634_0057539 3300046642 Bacteria 2594
899 Ga0495634_0168833 3300046642 Bacteria 1376
900 Ga0495611_0023526 3300046648 Bacteria 2675
901 Ga0495611_0083262 3300046648 Bacteria 1473
902 Ga0495635_0011900 3300046663 Bacteria 6097
903 Ga0495635_0029948 3300046663 Bacteria 3784
904 Ga0495635_0042176 3300046663 Bacteria 3151
905 Ga0495659_0014611 3300046664 Bacteria 2572
906 Ga0495588_0001728 3300046674 Bacteria 9298
907 Ga0495588_0150921 3300046674 Bacteria 1228
908 Ga0495657_0080872 3300046675 Bacteria 2102
909 Ga0495657_0114462 3300046675 Bacteria 1705
910 Ga0495657_0190957 3300046675 Bacteria 1252
911 Ga0495599_0000202 3300046678 Bacteria 39562
912 Ga0495599_0008974 3300046678 Bacteria 6091
913 Ga0495599_0058776 3300046678 Bacteria 2405
914 Ga0495599_0103106 3300046678 Bacteria 1778
915 Ga0495623_0000230 3300046679 Bacteria 35964
916 Ga0495646_0002084 3300046680 Bacteria 12124
917 Ga0495646_0045703 3300046680 Bacteria 2673
918 Ga0495646_0104200 3300046680 Bacteria 1622
919 Ga0495647_0004336 3300046681 Bacteria 4600
920 Ga0495647_0077696 3300046681 Bacteria 1340
921 Ga0495658_0035274 3300046683 Bacteria 2751
922 Ga0495658_0154427 3300046683 Bacteria 1412
923 Ga0495613_0010552 3300046689 Bacteria 6856
924 Ga0495613_0051296 3300046689 Bacteria 3040
925 Ga0495613_0087671 3300046689 Bacteria 2256
926 Ga0495624_0057267 3300046690 Bacteria 2450
927 Ga0495670_0028098 3300046691 Bacteria 2788
928 Ga0495671_0184627 3300046692 Unclassified 1013
929 Ga0495589_0038852 3300046794 Bacteria 2381
930 Ga0495600_0084751 3300046809 Bacteria 2068
931 Ga0495600_0116039 3300046809 Bacteria 1743
932 Ga0495604_0000262 3300047317 Bacteria 46873
933 Ga0495604_0064035 3300047317 Bacteria 2803
934 Ga0495636_0038751 3300047318 Bacteria 1973
935 Ga0495674_0021386 3300047319 Bacteria 5984
936 Ga0495674_0250500 3300047319 Bacteria 1457
937 Ga0495674_0252040 3300047319 Bacteria 1452
938 Ga0495676_0043187 3300047321 Bacteria 3693
939 Ga0495676_0070438 3300047321 Bacteria 2693
940 Ga0495676_0140485 3300047321 Bacteria 1731
941 Ga0495680_0005532 3300047322 Bacteria 11858
942 Ga0495680_0018905 3300047322 Bacteria 5834
943 Ga0495680_0040961 3300047322 Bacteria 3686
944 Ga0495680_0042745 3300047322 Bacteria 3593
945 Ga0495680_0077775 3300047322 Bacteria 2512
946 Ga0495680_0390897 3300047322 Bacteria 962
947 Ga0495675_0000020 3300047444 Bacteria 111526
948 Ga0495675_0108079 3300047444 Bacteria 1738
949 Ga0495677_0032216 3300047445 Bacteria 1909
950 Ga0495684_0004528 3300047471 Bacteria 10857
951 Ga0495684_0053036 3300047471 Bacteria 3094
952 Ga0495593_0004729 3300047673 Bacteria 8093
953 Ga0495602_0000222 3300048088 Bacteria 53050
954 Ga0495602_0053966 3300048088 Bacteria 3553
955 Ga0495614_0097223 3300048089 Bacteria 1284
956 Ga0495615_0031329 3300048090 Bacteria 1275
957 Ga0495626_0102451 3300048091 Bacteria 1247
958 Ga0496100_0002502 3300048903 Bacteria 9352
959 Ga0496100_0006709 3300048903 Bacteria 6301
960 Ga0496100_0006766 3300048903 Bacteria 6277
961 Ga0496100_0008560 3300048903 Bacteria 5709
962 Ga0496100_0009080 3300048903 Bacteria 5573
963 Ga0496100_0043658 3300048903 Bacteria 2868
964 Ga0496100_0070830 3300048903 Bacteria 2326
965 Ga0496100_0342833 3300048903 Bacteria 1127
966 Ga0496101_0001024 3300048904 Bacteria 16471
967 Ga0496101_0016140 3300048904 Bacteria 5043
968 Ga0496101_0025351 3300048904 Bacteria 4114
969 Ga0496101_0028829 3300048904 Bacteria 3879
970 Ga0496101_0064970 3300048904 Bacteria 2659
971 Ga0496101_0072660 3300048904 Bacteria 2525
972 Ga0496101_0102414 3300048904 Bacteria 2144
973 Ga0496101_0116271 3300048904 Bacteria 2018
974 Ga0496101_0125688 3300048904 Bacteria 1943
975 Ga0496101_0167865 3300048904 Bacteria 1685
976 Ga0496102_0004970 3300048905 Bacteria 11260
977 Ga0496102_0013068 3300048905 Bacteria 7189
978 Ga0496102_0022488 3300048905 Bacteria 5587
979 Ga0496102_0025477 3300048905 Bacteria 5266
980 Ga0496102_0036175 3300048905 Bacteria 4447
981 Ga0496102_0043978 3300048905 Bacteria 4051
982 Ga0496102_0046559 3300048905 Bacteria 3939
983 Ga0496102_0061013 3300048905 Bacteria 3450
984 Ga0496102_0063252 3300048905 Bacteria 3388
985 Ga0496102_0094431 3300048905 Bacteria 2771
986 Ga0496102_0121116 3300048905 Bacteria 2443
987 Ga0496102_0196366 3300048905 Unclassified 1902
988 Ga0496102_0225966 3300048905 Bacteria 1765
989 Ga0496102_0231194 3300048905 Bacteria 1743
990 Ga0496102_0262065 3300048905 Bacteria 1630
991 Ga0496102_0450957 3300048905 Bacteria 1207
992 Ga0496102_0501087 3300048905 Bacteria 1136
993 Ga0496103_0004988 3300048906 Bacteria 8006
994 Ga0496103_0009793 3300048906 Bacteria 5674
995 Ga0496103_0019236 3300048906 Bacteria 4100
996 Ga0496103_0021946 3300048906 Bacteria 3843
997 Ga0496103_0083990 3300048906 Bacteria 2005
998 Ga0496103_0105641 3300048906 Bacteria 1785
999 Ga0496103_0174562 3300048906 Bacteria 1381
1000 Ga0496103_0267710 3300048906 Bacteria 1099
1001 Ga0496104_0000332 3300048907 Bacteria 42258
1002 Ga0496104_0000865 3300048907 Bacteria 26083
1003 Ga0496104_0002338 3300048907 Bacteria 16381
1004 Ga0496104_0004406 3300048907 Bacteria 12261
1005 Ga0496104_0008182 3300048907 Bacteria 9286
1006 Ga0496104_0008226 3300048907 Bacteria 9261
1007 Ga0496104_0010957 3300048907 Bacteria 8112
1008 Ga0496104_0016855 3300048907 Bacteria 6642
1009 Ga0496104_0022478 3300048907 Bacteria 5794
1010 Ga0496104_0054582 3300048907 Bacteria 3777
1011 Ga0496104_0075027 3300048907 Bacteria 3220
1012 Ga0496104_0088948 3300048907 Bacteria 2950
1013 Ga0496104_0139359 3300048907 Bacteria 2331
1014 Ga0496104_0150024 3300048907 Bacteria 2238
1015 Ga0496104_0152100 3300048907 Bacteria 2221
1016 Ga0496104_0173096 3300048907 Bacteria 2069
1017 Ga0496104_0229696 3300048907 Bacteria 1767
1018 Ga0496104_0446068 3300048907 Bacteria 1206
1019 Ga0496104_0449124 3300048907 Bacteria 1201
1020 Ga0496104_0532983 3300048907 Bacteria 1085
1021 Ga0496105_0000775 3300048908 Bacteria 21608
1022 Ga0496105_0001042 3300048908 Bacteria 19175
1023 Ga0496105_0004368 3300048908 Bacteria 10647
1024 Ga0496105_0005606 3300048908 Bacteria 9546
1025 Ga0496105_0007386 3300048908 Bacteria 8508
1026 Ga0496105_0008547 3300048908 Bacteria 7954
1027 Ga0496105_0010597 3300048908 Bacteria 7253
1028 Ga0496105_0027093 3300048908 Bacteria 4679
1029 Ga0496105_0097710 3300048908 Bacteria 2425
1030 Ga0496105_0187969 3300048908 Bacteria 1690
1031 Ga0496105_0491751 3300048908 Bacteria 964
1032 Ga0496106_0013216 3300048909 Bacteria 6092
1033 Ga0496106_0016169 3300048909 Bacteria 5518
1034 Ga0496106_0025657 3300048909 Bacteria 4387
1035 Ga0496106_0057285 3300048909 Bacteria 2947
1036 Ga0496106_0058700 3300048909 Bacteria 2913
1037 Ga0496106_0076878 3300048909 Bacteria 2559
1038 Ga0496106_0093840 3300048909 Bacteria 2319
1039 Ga0496106_0176575 3300048909 Bacteria 1694
1040 Ga0496106_0429062 3300048909 Bacteria 1062
1041 Ga0496106_0583175 3300048909 Bacteria 896
1042 Ga0496107_0000242 3300048910 Bacteria 28631
1043 Ga0496107_0000832 3300048910 Bacteria 18003
1044 Ga0496107_0001734 3300048910 Bacteria 13705
1045 Ga0496107_0002291 3300048910 Bacteria 12358
1046 Ga0496107_0004829 3300048910 Bacteria 9150
1047 Ga0496107_0019833 3300048910 Bacteria 4747
1048 Ga0496107_0051303 3300048910 Bacteria 2975
1049 Ga0496107_0058503 3300048910 Bacteria 2787
1050 Ga0496107_0080130 3300048910 Bacteria 2381
1051 Ga0496107_0135016 3300048910 Bacteria 1823
1052 Ga0496107_0141145 3300048910 Bacteria 1780
1053 Ga0496107_0216437 3300048910 Bacteria 1425
1054 Ga0496107_0241920 3300048910 Bacteria 1343
1055 Ga0496107_0274605 3300048910 Bacteria 1254
1056 Ga0496107_0396224 3300048910 Bacteria 1027
1057 Ga0496108_0001121 3300048911 Bacteria 20955
1058 Ga0496108_0001279 3300048911 Bacteria 19702
1059 Ga0496108_0004022 3300048911 Bacteria 11798
1060 Ga0496108_0005178 3300048911 Bacteria 10538
1061 Ga0496108_0008931 3300048911 Bacteria 8122
1062 Ga0496108_0018106 3300048911 Bacteria 5763
1063 Ga0496108_0027191 3300048911 Bacteria 4721
1064 Ga0496108_0028356 3300048911 Bacteria 4631
1065 Ga0496108_0035181 3300048911 Bacteria 4163
1066 Ga0496108_0068334 3300048911 Bacteria 2998
1067 Ga0496108_0122086 3300048911 Bacteria 2235
1068 Ga0496108_0229553 3300048911 Bacteria 1614
1069 Ga0496108_0477317 3300048911 Bacteria 1089
1070 Ga0496109_0000288 3300048912 Bacteria 47831
1071 Ga0496109_0000534 3300048912 Bacteria 32226
1072 Ga0496109_0001211 3300048912 Bacteria 21471
1073 Ga0496109_0001239 3300048912 Bacteria 21163
1074 Ga0496109_0001399 3300048912 Bacteria 19990
1075 Ga0496109_0001931 3300048912 Bacteria 17224
1076 Ga0496109_0009621 3300048912 Bacteria 8243
1077 Ga0496109_0010449 3300048912 Bacteria 7931
1078 Ga0496109_0018533 3300048912 Bacteria 6114
1079 Ga0496109_0032272 3300048912 Bacteria 4707
1080 Ga0496109_0043230 3300048912 Bacteria 4084
1081 Ga0496109_0046067 3300048912 Bacteria 3959
1082 Ga0496109_0053327 3300048912 Bacteria 3687
1083 Ga0496109_0074982 3300048912 Bacteria 3110
1084 Ga0496109_0118101 3300048912 Bacteria 2469
1085 Ga0496109_0132805 3300048912 Bacteria 2324
1086 Ga0496109_0191934 3300048912 Bacteria 1920
1087 Ga0496109_0199773 3300048912 Bacteria 1879
1088 Ga0496109_0208587 3300048912 Bacteria 1837
1089 Ga0496109_0478094 3300048912 Bacteria 1176
1090 Ga0496110_0000069 3300048913 Bacteria 51597
1091 Ga0496110_0000769 3300048913 Bacteria 22239
1092 Ga0496110_0000979 3300048913 Bacteria 20042
1093 Ga0496110_0009023 3300048913 Bacteria 8047
1094 Ga0496110_0010243 3300048913 Bacteria 7615
1095 Ga0496110_0018239 3300048913 Bacteria 5881
1096 Ga0496110_0020040 3300048913 Bacteria 5639
1097 Ga0496110_0029541 3300048913 Bacteria 4719
1098 Ga0496110_0035052 3300048913 Bacteria 4351
1099 Ga0496110_0052227 3300048913 Bacteria 3592
1100 Ga0496110_0069790 3300048913 Bacteria 3112
1101 Ga0496110_0147469 3300048913 Bacteria 2129
1102 Ga0496110_0150910 3300048913 Bacteria 2104
1103 Ga0496110_0161352 3300048913 Bacteria 2032
1104 Ga0496110_0183011 3300048913 Bacteria 1903
1105 Ga0496110_0229563 3300048913 Bacteria 1688
1106 Ga0496110_0257007 3300048913 Bacteria 1590
1107 Ga0496110_0259524 3300048913 Unclassified 1581
1108 Ga0496111_0000081 3300048914 Bacteria 39898
1109 Ga0496111_0000204 3300048914 Bacteria 27767
1110 Ga0496111_0001570 3300048914 Bacteria 13189
1111 Ga0496111_0001689 3300048914 Bacteria 12867
1112 Ga0496111_0003145 3300048914 Bacteria 10157
1113 Ga0496111_0008085 3300048914 Bacteria 6945
1114 Ga0496111_0017500 3300048914 Bacteria 4956
1115 Ga0496111_0037818 3300048914 Bacteria 3455
1116 Ga0496111_0061023 3300048914 Bacteria 2733
1117 Ga0496111_0083224 3300048914 Bacteria 2338
1118 Ga0496111_0085808 3300048914 Bacteria 2302
1119 Ga0496111_0103382 3300048914 Bacteria 2095
1120 Ga0496111_0142501 3300048914 Bacteria 1776
1121 Ga0496111_0165467 3300048914 Bacteria 1642
1122 Ga0496111_0167914 3300048914 Bacteria 1630
1123 Ga0496111_0209459 3300048914 Bacteria 1448
1124 Ga0496111_0238568 3300048914 Bacteria 1350
1125 Ga0496111_0244438 3300048914 Bacteria 1333
1126 Ga0496111_0246835 3300048914 Bacteria 1325
1127 Ga0496111_0304007 3300048914 Bacteria 1182
1128 Ga0496112_0000635 3300048915 Bacteria 24368
1129 Ga0496112_0000670 3300048915 Bacteria 23864
1130 Ga0496112_0001619 3300048915 Bacteria 17429
1131 Ga0496112_0001889 3300048915 Bacteria 16523
1132 Ga0496112_0003082 3300048915 Bacteria 13654
1133 Ga0496112_0003473 3300048915 Bacteria 13038
1134 Ga0496112_0003845 3300048915 Bacteria 12539
1135 Ga0496112_0013900 3300048915 Bacteria 7448
1136 Ga0496112_0036622 3300048915 Bacteria 4787
1137 Ga0496112_0040719 3300048915 Bacteria 4543
1138 Ga0496112_0040922 3300048915 Bacteria 4533
1139 Ga0496112_0046708 3300048915 Bacteria 4248
1140 Ga0496112_0069059 3300048915 Bacteria 3490
1141 Ga0496112_0082681 3300048915 Bacteria 3175
1142 Ga0496112_0113463 3300048915 Bacteria 2681
1143 Ga0496112_0206666 3300048915 Bacteria 1921
1144 Ga0496112_0490534 3300048915 Bacteria 1164
1145 Ga0496112_0610800 3300048915 Bacteria 1022
1146 Ga0496113_0036439 3300048916 Bacteria 3604
1147 Ga0496113_0037069 3300048916 Bacteria 3576
1148 Ga0496113_0040146 3300048916 Bacteria 3447
1149 Ga0496113_0042126 3300048916 Bacteria 3372
1150 Ga0496113_0055242 3300048916 Bacteria 2976
1151 Ga0496113_0077332 3300048916 Bacteria 2544
1152 Ga0496113_0081454 3300048916 Bacteria 2481
1153 Ga0496113_0097482 3300048916 Bacteria 2275
1154 Ga0496113_0153473 3300048916 Bacteria 1818
1155 Ga0496113_0279582 3300048916 Bacteria 1334
1156 Ga0496113_0370089 3300048916 Bacteria 1150
1157 Ga0496113_0372603 3300048916 Unclassified 1146
1158 Ga0496113_0424973 3300048916 Bacteria 1067
1159 Ga0496114_0000892 3300048917 Bacteria 22279
1160 Ga0496114_0002615 3300048917 Bacteria 13736
1161 Ga0496114_0003773 3300048917 Bacteria 11681
1162 Ga0496114_0008778 3300048917 Bacteria 8008
1163 Ga0496114_0009938 3300048917 Bacteria 7562
1164 Ga0496114_0017227 3300048917 Bacteria 5829
1165 Ga0496114_0026677 3300048917 Bacteria 4731
1166 Ga0496114_0032949 3300048917 Bacteria 4267
1167 Ga0496114_0045010 3300048917 Bacteria 3664
1168 Ga0496114_0047790 3300048917 Bacteria 3559
1169 Ga0496114_0072617 3300048917 Bacteria 2894
1170 Ga0496114_0080691 3300048917 Bacteria 2747
1171 Ga0496114_0248391 3300048917 Bacteria 1565
1172 Ga0496114_0267765 3300048917 Bacteria 1505
1173 Ga0496114_0284462 3300048917 Bacteria 1458
1174 Ga0496115_0000701 3300048918 Bacteria 24832
1175 Ga0496115_0002745 3300048918 Bacteria 12643
1176 Ga0496115_0005064 3300048918 Bacteria 9582
1177 Ga0496115_0013798 3300048918 Bacteria 6118
1178 Ga0496115_0033855 3300048918 Bacteria 4036
1179 Ga0496115_0059075 3300048918 Bacteria 3087
1180 Ga0496115_0095223 3300048918 Bacteria 2437
1181 Ga0496115_0162000 3300048918 Bacteria 1849
1182 Ga0496115_0182909 3300048918 Bacteria 1732
1183 Ga0496115_0320269 3300048918 Bacteria 1268
1184 Ga0496115_0338337 3300048918 Bacteria 1229
1185 Ga0496115_0354123 3300048918 Bacteria 1197
1186 Ga0496115_0501915 3300048918 Bacteria 975
1187 Ga0496126_0014653 3300048929 Bacteria 7915
1188 Ga0501031_0008694 3300049568 Bacteria 6602
1189 Ga0501032_0008127 3300049569 Bacteria 7648
1190 Ga0501033_0068861 3300049570 Bacteria 2601
1191 Ga0501033_0111765 3300049570 Bacteria 1988
1192 Ga0501034_0039223 3300049571 Bacteria 4798
1193 Ga0501034_0058838 3300049571 Bacteria 3860
1194 Ga0501036_0020205 3300049572 Bacteria 5592
1195 Ga0501037_0061310 3300049573 Bacteria 2742
1196 Ga0501037_0281014 3300049573 Bacteria 1160
1197 Ga0501038_0045995 3300049574 Bacteria 3785
1198 Ga0501039_0017278 3300049575 Bacteria 5534
1199 Ga0501040_0001448 3300049576 Bacteria 15032
1200 Ga0501040_0297682 3300049576 Bacteria 1153
1201 Ga0501041_0002807 3300049577 Bacteria 9951
1202 Ga0501041_0019626 3300049577 Bacteria 4038
1203 Ga0501042_0011934 3300049578 Bacteria 5871
1204 Ga0501042_0046216 3300049578 Bacteria 3103
1205 Ga0501046_0000977 3300049580 Bacteria 28011
1206 Ga0501047_0009198 3300049581 Bacteria 9328
1207 Ga0501047_0009775 3300049581 Bacteria 9065
1208 Ga0501047_0014688 3300049581 Bacteria 7451
1209 Ga0501047_0152280 3300049581 Bacteria 2188
1210 Ga0501047_0226916 3300049581 Bacteria 1722
1211 Ga0501047_0242187 3300049581 Bacteria 1654
1212 Ga0501048_0002843 3300049582 Bacteria 13219
1213 Ga0501067_0068439 3300049583 Bacteria 1965
1214 Ga0501068_0004782 3300049584 Bacteria 7369
1215 Ga0501069_0020417 3300049585 Bacteria 3589
1216 Ga0501069_0045548 3300049585 Bacteria 2430
1217 Ga0501069_0055909 3300049585 Bacteria 2198
1218 Ga0501069_0071570 3300049585 Bacteria 1943
1219 Ga0501070_0000805 3300049586 Bacteria 28505
1220 Ga0501070_0055530 3300049586 Bacteria 3282
1221 Ga0501070_0219956 3300049586 Bacteria 1558
1222 Ga0501070_0243302 3300049586 Bacteria 1472
1223 Ga0501071_0035652 3300049587 Bacteria 3544
1224 Ga0501071_0074619 3300049587 Bacteria 2475
1225 Ga0501071_0169374 3300049587 Bacteria 1635
1226 Ga0501072_0003411 3300049588 Bacteria 11969
1227 Ga0501072_0254153 3300049588 Bacteria 1399
1228 Ga0501072_0298827 3300049588 Bacteria 1280
1229 Ga0501072_0299805 3300049588 Bacteria 1278
1230 Ga0501074_0008458 3300049590 Bacteria 7460
1231 Ga0501074_0020418 3300049590 Bacteria 4814
1232 Ga0501074_0131376 3300049590 Bacteria 1791
1233 Ga0501076_0002835 3300049592 Bacteria 11987
1234 Ga0501077_0002484 3300049593 Bacteria 11045
1235 Ga0501077_0007845 3300049593 Bacteria 6591
1236 Ga0501077_0274233 3300049593 Unclassified 1073
1237 Ga0501209_026745 3300049656 Bacteria 1427
1238 Ga0501079_0001222 3300049741 Bacteria 17989
1239 Ga0501079_0009336 3300049741 Bacteria 7433
1240 Ga0501079_0053739 3300049741 Bacteria 3107
1241 Ga0501079_0198124 3300049741 Bacteria 1568
1242 Ga0501080_0015795 3300049742 Bacteria 6964
1243 Ga0501080_0031460 3300049742 Bacteria 4944
1244 Ga0501080_0067996 3300049742 Bacteria 3314
1245 Ga0501080_0262950 3300049742 Bacteria 1572
1246 Ga0501081_0004722 3300049743 Bacteria 8760
1247 Ga0501081_0047579 3300049743 Bacteria 2950
1248 Ga0501083_0002114 3300049744 Bacteria 13633
1249 Ga0501083_0010944 3300049744 Bacteria 6379
1250 Ga0501083_0067448 3300049744 Bacteria 2382
1251 Ga0501044_0046555 3300049823 Bacteria 4489
1252 Ga0501044_0343162 3300049823 Bacteria 1414
1253 Ga0501044_0367068 3300049823 Bacteria 1357
1254 Ga0501045_0002001 3300049824 Bacteria 13768
1255 Ga0501045_0076746 3300049824 Bacteria 2462
1256 nmdc:mga0yw44_43770_c2 3300050492 Bacteria 1821
1257 nmdc:mga05p37_1712_c1 3300050507 Bacteria 25565
1258 nmdc:mga05p37_211685_c1 3300050507 Bacteria 2343
1259 nmdc:mga05p37_25384_c1 3300050507 Bacteria 7206
1260 nmdc:mga05p37_354762_c1 3300050507 Unclassified 1726
1261 nmdc:mga05p37_413569_c1 3300050507 Bacteria 1571
1262 nmdc:mga06r32_163303_c1 3300050510 Bacteria 2210
1263 nmdc:mga06r32_299926_c1 3300050510 Bacteria 1593
1264 nmdc:mga06r32_450801_c1 3300050510 Bacteria 1266
1265 nmdc:mga06r32_654237_c1 3300050510 Bacteria 1019
1266 nmdc:mga08y16_150129_c1 3300050511 Unclassified 2422
1267 nmdc:mga08y16_24505_c1 3300050511 Bacteria 6367
1268 nmdc:mga08y16_553167_c1 3300050511 Bacteria 1164
1269 nmdc:mga08y16_644016_c1 3300050511 Bacteria 1065
1270 nmdc:mga08y16_715336_c1 3300050511 Bacteria 1000
1271 nmdc:mga08y16_9150_c1 3300050511 Bacteria 10396
1272 nmdc:mga0n895_12180_c1 3300050512 Bacteria 7702
1273 nmdc:mga0n895_379557_c1 3300050512 Bacteria 1430
1274 nmdc:mga0n895_481382_c1 3300050512 Unclassified 1252
1275 nmdc:mga0n895_515970_c1 3300050512 Bacteria 1203
1276 nmdc:mga0n895_669600_c1 3300050512 Bacteria 1035
1277 nmdc:mga0n895_7295_c1 3300050512 Bacteria 9475
1278 nmdc:mga0rr50_34687_c1 3300050513 Bacteria 3616
1279 nmdc:mga0rr50_61838_c1 3300050513 Archaea 2822
1280 nmdc:mga0rr50_76794_c1 3300050513 Bacteria 2565
1281 nmdc:mga08x19_45480_c2 3300050514 Bacteria 2415
1282 nmdc:mga08x19_8065_c1 3300050514 Bacteria 6256
1283 nmdc:mga08x19_8700_c1 3300050514 Bacteria 6053
1284 nmdc:mga08x19_9813_c1 3300050514 Bacteria 5736
1285 nmdc:mga0a205_189643_c1 3300050515 Bacteria 1948
1286 nmdc:mga0a205_209122_c1 3300050515 Bacteria 1840
1287 nmdc:mga0a205_336084_c1 3300050515 Bacteria 1380
1288 nmdc:mga0a205_36751_c1 3300050515 Bacteria 4708
1289 Ga0495601_0000218 3300053077 Bacteria 30705
1290 Ga0495601_0053536 3300053077 Bacteria 2551
1291 Ga0495601_0116292 3300053077 Bacteria 1734
1292 Ga0495612_0007074 3300053078 Bacteria 4589
1293 Ga0495612_0056557 3300053078 Bacteria 1619
1294 Ga0495655_0000400 3300053083 Bacteria 7351
1295 Ga0495595_0004838 3300053084 Bacteria 5425
1296 Ga0495595_0013345 3300053084 Bacteria 3471
1297 Ga0495595_0030875 3300053084 Bacteria 2405
1298 Ga0495619_0011100 3300053085 Bacteria 5664
1299 Ga0495619_0026262 3300053085 Bacteria 3746
1300 Ga0495619_0066626 3300053085 Bacteria 2403
1301 Ga0495619_0083344 3300053085 Bacteria 2156
1302 Ga0495619_0102697 3300053085 Bacteria 1947
1303 Ga0495619_0187354 3300053085 Bacteria 1432
1304 Ga0495619_0226748 3300053085 Bacteria 1294
1305 Ga0500566_0054705 3300053094 Bacteria 2275
1306 Ga0501084_0052612 3300054114 Bacteria 3406
1307 Ga0501084_0153946 3300054114 Bacteria 1939
1308 Ga0501084_0421059 3300054114 Bacteria 1129
1309 Ga0590075_023342 3300059424 Bacteria 1550
1310 Ga0501082_0000690 3300060353 Bacteria 29775
1311 Ga0501082_0055589 3300060353 Bacteria 3409
1312 Ga0501082_0189328 3300060353 Bacteria 1790
1313 Ga0501082_0679284 3300060353 Bacteria 901
1314 Ga0466962_0000096 3300061719 Bacteria 35253
1315 Ga0466962_0001445 3300061719 Bacteria 11078
1316 Ga0466962_0003609 3300061719 Bacteria 7374
1317 Ga0466962_0007666 3300061719 Bacteria 5171
1318 Ga0466962_0007812 3300061719 Bacteria 5127
1319 Ga0466962_0050879 3300061719 Bacteria 1981
1320 Ga0466962_0059336 3300061719 Bacteria 1826
1321 Ga0466962_0062716 3300061719 Bacteria 1775
1322 Ga0466962_0110360 3300061719 Unclassified 1324
1323 Ga0530510_0000474 3300061734 Bacteria 25778
1324 Ga0530510_0005435 3300061734 Bacteria 8816
1325 Ga0436360_1016639
1326 JGI25407J50210_10009508
1327 Ga0070658_10012791
1328 Ga0070658_10063646
1329 Ga0070658_10114397
1330 Ga0070658_10149871
1331 Ga0070658_10169244
1332 Ga0070683_100005050
1333 Ga0070683_100026240
1334 Ga0070683_100053877
1335 Ga0070683_100073457
1336 Ga0070683_100102836
1337 Ga0070683_100165566
1338 Ga0070690_100358059
1339 Ga0070670_100232271
1340 Ga0068869_100284701
1341 Ga0068869_100307646
1342 Ga0070666_10245088
1343 Ga0070680_100006253
1344 Ga0070680_100032586
1345 Ga0070680_100064314
1346 Ga0070680_100290897
1347 Ga0070680_100458681
1348 Ga0070682_100043893
1349 Ga0070682_100045211
1350 Ga0070682_100068968
1351 Ga0068868_100060097
1352 Ga0068868_100154711
1353 Ga0068868_100175254
1354 Ga0070660_100024614
1355 Ga0070660_100045847
1356 Ga0070660_100046194
1357 Ga0070660_100046949
1358 Ga0070660_100052003
1359 Ga0070660_100270999
1360 Ga0070689_100008221
1361 Ga0070691_10068259
1362 Ga0070661_100012445
1363 Ga0070661_100109628
1364 Ga0070661_100445191
1365 Ga0070692_10004619
1366 Ga0070692_10140230
1367 Ga0070675_100161683
1368 Ga0070671_100032295
1369 Ga0070671_100093187
1370 Ga0070674_100230187
1371 Ga0070674_100445881
1372 Ga0070673_100547224
1373 Ga0070659_100031564
1374 Ga0070667_100002001
1375 Ga0070703_10002554
1376 Ga0070703_10030854
1377 Ga0070709_10028844
1378 Ga0070709_10034021
1379 Ga0070714_100004198
1380 Ga0070714_100004838
1381 Ga0070714_100023312
1382 Ga0070714_100025095
1383 Ga0070714_100072969
1384 Ga0070714_100089467
1385 Ga0070714_100254802
1386 Ga0070714_100281644
1387 Ga0070714_100298449
1388 Ga0070714_100374294
1389 Ga0070714_100573408
1390 Ga0070713_100001060
1391 Ga0070713_100017251
1392 Ga0070713_100114537
1393 Ga0070713_100170226
1394 Ga0070710_10000443
1395 Ga0070710_10171620
1396 Ga0070701_10188709
1397 Ga0070711_100011889
1398 Ga0070711_100013538
1399 Ga0070711_100021588
1400 Ga0070711_100061153
1401 Ga0070711_100206347
1402 Ga0070711_100485727
1403 Ga0070705_100001980
1404 Ga0070705_100013747
1405 Ga0070705_100018179
1406 Ga0070700_100015619
1407 Ga0070694_100038984
1408 Ga0070708_100034217
1409 Ga0070708_100220947
1410 Ga0070663_100372014
1411 Ga0070678_100002713
1412 Ga0070678_100127047
1413 Ga0070678_100139922
1414 Ga0070681_10009404
1415 Ga0070681_10017738
1416 Ga0070681_10036127
1417 Ga0070681_10057635
1418 Ga0070681_10065039
1419 Ga0070681_10083232
1420 Ga0070681_10123323
1421 Ga0070681_10164387
1422 Ga0070681_10186406
1423 Ga0068867_100000913
1424 Ga0068867_100171456
1425 Ga0068867_100260382
1426 Ga0070685_10247899
1427 Ga0070706_100046484
1428 Ga0070706_100085657
1429 Ga0070706_100198366
1430 Ga0070706_100354329
1431 Ga0070707_100002712
1432 Ga0070707_100011501
1433 Ga0070707_100155777
1434 Ga0070707_100177888
1435 Ga0070707_100297321
1436 Ga0070707_100459801
1437 Ga0070707_100503600
1438 Ga0070698_100000853
1439 Ga0070698_100015615
1440 Ga0070698_100034960
1441 Ga0070698_100063612
1442 Ga0070698_100182169
1443 Ga0070679_100003423
1444 Ga0070679_100052984
1445 Ga0070679_100112160
1446 Ga0070679_100120333
1447 Ga0070679_100156760
1448 Ga0070679_100198244
1449 Ga0070684_100000762
1450 Ga0070684_100001409
1451 Ga0070684_100029473
1452 Ga0070684_100034824
1453 Ga0070684_100044526
1454 Ga0070684_100050892
1455 Ga0070684_100081507
1456 Ga0070684_100117734
1457 Ga0070684_100119746
1458 Ga0070684_100126232
1459 Ga0070684_100172123
1460 Ga0070697_100064098
1461 Ga0070697_100170162
1462 Ga0068853_100005764
1463 Ga0068853_100179062
1464 Ga0068853_100297938
1465 Ga0070672_100036775
1466 Ga0070686_100033420
1467 Ga0070686_100105273
1468 Ga0070695_100017454
1469 Ga0070695_100084342
1470 Ga0070696_100004176
1471 Ga0070696_100034805
1472 Ga0070693_100015388
1473 Ga0070693_100069223
1474 Ga0070693_100261239
1475 Ga0070665_100013762
1476 Ga0070704_100217705
1477 Ga0068855_100023527
1478 Ga0068855_100034915
1479 Ga0068855_100101071
1480 Ga0068855_100246350
1481 Ga0068855_100472521
1482 Ga0068855_100490321
1483 Ga0070664_100104597
1484 Ga0068857_100001692
1485 Ga0068857_100043413
1486 Ga0068857_100051612
1487 Ga0068857_100278651
1488 Ga0068854_100149252
1489 Ga0068854_100162977
1490 Ga0068856_100002581
1491 Ga0068856_100043969
1492 Ga0068856_100335162
1493 Ga0068856_100384501
1494 Ga0070702_100044121
1495 Ga0070702_100151165
1496 Ga0068852_100320981
1497 Ga0068864_100025713
1498 Ga0068866_10002623
1499 Ga0068866_10091584
1500 Ga0068861_100157244
1501 Ga0068861_100237372
1502 Ga0081455_10018767
1503 Ga0081455_10055952
1504 Ga0081538_10000100
1505 Ga0081538_10016467
1506 Ga0081540_1004488
1507 Ga0081539_10000095
1508 Ga0081539_10001005
1509 Ga0070717_10005467
1510 Ga0070717_10005558
1511 Ga0070717_10030563
1512 Ga0075365_10064967
1513 Ga0075432_10044418
1514 Ga0070715_10001395
1515 Ga0070715_10005089
1516 Ga0070715_10020497
1517 Ga0070716_100005635
1518 Ga0070712_100033918
1519 Ga0070712_100040695
1520 Ga0070712_100054382
1521 Ga0070712_100131276
1522 Ga0070712_100263968
1523 Ga0070712_100345452
1524 Ga0097621_100002459
1525 Ga0097621_100105826
1526 Ga0097621_100376153
1527 Ga0068871_100145601
1528 Ga0068871_100208963
1529 Ga0075428_100005327
1530 Ga0075431_100476000
1531 Ga0075433_10002265
1532 Ga0075433_10033469
1533 Ga0075434_100001294
1534 Ga0075434_100009463
1535 Ga0075434_100162060
1536 Ga0075434_100182287
1537 Ga0075434_100489407
1538 Ga0075434_100515776
1539 Ga0068865_100012648
1540 Ga0075436_100000915
1541 Ga0075436_100009752
1542 Ga0075436_100011075
1543 Ga0075436_100083343
1544 Ga0075436_100173171
1545 Ga0075435_100001243
1546 Ga0075435_100030849
1547 Ga0075435_100082018
1548 Ga0105240_10017296
1549 Ga0105240_10106166
1550 Ga0105240_10180778
1551 Ga0105240_10250352
1552 Ga0105240_10351008
1553 Ga0105240_10625444
1554 Ga0111539_10001300
1555 Ga0111539_10003648
1556 Ga0111539_10031645
1557 Ga0111539_10038970
1558 Ga0111539_10144163
1559 Ga0111539_10178854
1560 Ga0111539_10189315
1561 Ga0111539_10199717
1562 Ga0111539_10204142
1563 Ga0111539_10288660
1564 Ga0105245_10007177
1565 Ga0105245_10016075
1566 Ga0105245_10020104
1567 Ga0105245_10028370
1568 Ga0105245_10076745
1569 Ga0105245_10077410
1570 Ga0105245_10088218
1571 Ga0105245_10146073
1572 Ga0105245_10415010
1573 Ga0105247_10206780
1574 Ga0114129_10000141
1575 Ga0114129_10016454
1576 Ga0114129_10032839
1577 Ga0114129_10125768
1578 Ga0114129_10229065
1579 Ga0114129_10518272
1580 Ga0114129_10601237
1581 Ga0114129_10623426
1582 Ga0114129_10752386
1583 Ga0105243_10031341
1584 Ga0105243_10246127
1585 Ga0105243_10633861
1586 Ga0105241_10716541
1587 Ga0105242_10074064
1588 Ga0105242_10389512
1589 Ga0105248_10016541
1590 Ga0105248_10430215
1591 Ga0105248_10437885
1592 Ga0105248_10551715
1593 Ga0105237_10105826
1594 Ga0105238_10091694
1595 Ga0105238_10198028
1596 Ga0105249_10001857
1597 Ga0105239_10158940
1598 Ga0105239_10196554
1599 Ga0105239_10261355
1600 Ga0105239_10284997
1601 Ga0105246_10088817
1602 Ga0105246_10098245
1603 Ga0157371_10204373
1604 Ga0157370_10015040
1605 Ga0157370_10086075
1606 Ga0157370_10153386
1607 Ga0157369_10002742
1608 Ga0157369_10017773
1609 Ga0157369_10018104
1610 Ga0157369_10035760
1611 Ga0157369_10037107
1612 Ga0157369_10149428
1613 Ga0157369_10198355
1614 Ga0157374_10020353
1615 Ga0157374_10023645
1616 Ga0157374_10085634
1617 Ga0157378_10110998
1618 Ga0157378_10191417
1619 Ga0157378_10448914
1620 Ga0163162_10032238
1621 Ga0163162_10467857
1622 Ga0157372_10080466
1623 Ga0157372_10270207
1624 Ga0157372_10352083
1625 Ga0157375_10006585
1626 Ga0157375_10045939
1627 Ga0157375_10055423
1628 Ga0157375_10300275
1629 Ga0157375_10539078
1630 Ga0157380_10001429
1631 Ga0157377_10006457
1632 Ga0157379_10119773
1633 Ga0157376_10013193
1634 Ga0157376_10114055
1635 Ga0182007_10017644
1636 Ga0197907_10740994
1637 Ga0206356_10116221
1638 Ga0206354_10232504
1639 Ga0206353_11057617
1640 Ga0206353_11605935
1641 Ga0206353_11689011
1642 Ga0213873_10033604
1643 Ga0213871_10014400
1644 Ga0207692_10006335
1645 Ga0207692_10008917
1646 Ga0207692_10068773
1647 Ga0207692_10238382
1648 Ga0207642_10200029
1649 Ga0207688_10065403
1650 Ga0207688_10102295
1651 Ga0207680_10005081
1652 Ga0207685_10001417
1653 Ga0207685_10006373
1654 Ga0207685_10033087
1655 Ga0207699_10018015
1656 Ga0207699_10155265
1657 Ga0207699_10183722
1658 Ga0207699_10309108
1659 Ga0207643_10027055
1660 Ga0207705_10137243
1661 Ga0207705_10139465
1662 Ga0207705_10149333
1663 Ga0207684_10028521
1664 Ga0207684_10103641
1665 Ga0207684_10128772
1666 Ga0207684_10467349
1667 Ga0207707_10008396
1668 Ga0207707_10030466
1669 Ga0207707_10050817
1670 Ga0207707_10065380
1671 Ga0207707_10250954
1672 Ga0207695_10009300
1673 Ga0207695_10052410
1674 Ga0207695_10216587
1675 Ga0207695_10246270
1676 Ga0207693_10000468
1677 Ga0207693_10003383
1678 Ga0207693_10008117
1679 Ga0207693_10015138
1680 Ga0207693_10023335
1681 Ga0207693_10069335
1682 Ga0207693_10189074
1683 Ga0207693_10273778
1684 Ga0207693_10359449
1685 Ga0207663_10057469
1686 Ga0207663_10243328
1687 Ga0207663_10414183
1688 Ga0207663_10421374
1689 Ga0207660_10130370
1690 Ga0207660_10136895
1691 Ga0207660_10460566
1692 Ga0207657_10000988
1693 Ga0207657_10004731
1694 Ga0207657_10009308
1695 Ga0207657_10015573
1696 Ga0207657_10024561
1697 Ga0207657_10069096
1698 Ga0207657_10336348
1699 Ga0207649_10024155
1700 Ga0207652_10045065
1701 Ga0207652_10080258
1702 Ga0207652_10092179
1703 Ga0207652_10382396
1704 Ga0207646_10001768
1705 Ga0207646_10002982
1706 Ga0207646_10005974
1707 Ga0207646_10236098
1708 Ga0207646_10272986
1709 Ga0207646_10347720
1710 Ga0207646_10478170
1711 Ga0207681_10237340
1712 Ga0207694_10176027
1713 Ga0207694_10193388
1714 Ga0207650_10041410
1715 Ga0207659_10079179
1716 Ga0207687_10060558
1717 Ga0207687_10084981
1718 Ga0207687_10160259
1719 Ga0207687_10384413
1720 Ga0207687_10575582
1721 Ga0207700_10000039
1722 Ga0207700_10033783
1723 Ga0207700_10158959
1724 Ga0207700_10187583
1725 Ga0207700_10310088
1726 Ga0207700_10418481
1727 Ga0207700_10439943
1728 Ga0207664_10011034
1729 Ga0207664_10018300
1730 Ga0207664_10022691
1731 Ga0207664_10040296
1732 Ga0207664_10044151
1733 Ga0207664_10049096
1734 Ga0207664_10064076
1735 Ga0207664_10072301
1736 Ga0207664_10075761
1737 Ga0207664_10107716
1738 Ga0207664_10109430
1739 Ga0207664_10132209
1740 Ga0207664_10146176
1741 Ga0207664_10258378
1742 Ga0207664_10311446
1743 Ga0207664_10352322
1744 Ga0207644_10037229
1745 Ga0207644_10385391
1746 Ga0207690_10167735
1747 Ga0207690_10191423
1748 Ga0207706_10044731
1749 Ga0207706_10048942
1750 Ga0207686_10004740
1751 Ga0207686_10148042
1752 Ga0207686_10296150
1753 Ga0207686_10350092
1754 Ga0207709_10001987
1755 Ga0207709_10041853
1756 Ga0207709_10056938
1757 Ga0207670_10005003
1758 Ga0207669_10325134
1759 Ga0207704_10068925
1760 Ga0207704_10086150
1761 Ga0207665_10002358
1762 Ga0207665_10022233
1763 Ga0207665_10099705
1764 Ga0207691_10008985
1765 Ga0207691_10381473
1766 Ga0207711_10284281
1767 Ga0207711_10387493
1768 Ga0207711_10547669
1769 Ga0207661_10003288
1770 Ga0207661_10009282
1771 Ga0207661_10035675
1772 Ga0207661_10082038
1773 Ga0207661_10088182
1774 Ga0207661_10135236
1775 Ga0207661_10174694
1776 Ga0207661_10203334
1777 Ga0207661_10385319
1778 Ga0207661_10516806
1779 Ga0207679_10217655
1780 Ga0207679_10299986
1781 Ga0207667_10262907
1782 Ga0207651_10269474
1783 Ga0207640_10119282
1784 Ga0207640_10213080
1785 Ga0207640_10372966
1786 Ga0207658_10002326
1787 Ga0207658_10343087
1788 Ga0207677_10120632
1789 Ga0207677_10168895
1790 Ga0207677_10250418
1791 Ga0207677_10502275
1792 Ga0207703_10276464
1793 Ga0207639_10486147
1794 Ga0207678_10191318
1795 Ga0207708_10000400
1796 Ga0207708_10005578
1797 Ga0207708_10051886
1798 Ga0207702_10107873
1799 Ga0207702_10127857
1800 Ga0207702_10436663
1801 Ga0207702_10448545
1802 Ga0207702_10507763
1803 Ga0207641_10238689
1804 Ga0207648_10005898
1805 Ga0207648_10033391
1806 Ga0207648_10061990
1807 Ga0207648_10094073
1808 Ga0207676_10021755
1809 Ga0207676_10079799
1810 Ga0207674_10003276
1811 Ga0207674_10008281
1812 Ga0207674_10011757
1813 Ga0207674_10064147
1814 Ga0207675_100004495
1815 Ga0207675_100029762
1816 Ga0207675_100063876
1817 Ga0207675_100168285
1818 Ga0207683_10000864
1819 Ga0207683_10024235
1820 Ga0207683_10098964
1821 Ga0207683_10285260
1822 Ga0207683_10724199
1823 Ga0207698_10103333
1824 Ga0207698_10122159
1825 Ga0207698_10176732
1826 Ga0207428_10005934
1827 Ga0207428_10012523
1828 Ga0207428_10025233
1829 Ga0207428_10111703
1830 Ga0207428_10214319
1831 Ga0268266_10342816
1832 Ga0268265_10155629
1833 Ga0265319_1000635
1834 Ga0265318_10000338
1835 Ga0265318_10003761
1836 Ga0265323_10021941
1837 Ga0265322_10054029
1838 Ga0265336_10001093
1839 Ga0265338_10000924
1840 Ga0265338_10001048
1841 Ga0265338_10007196
1842 Ga0265338_10007510
1843 Ga0265338_10049044
1844 Ga0265338_10383456
1845 Ga0265324_10035012
1846 Ga0265330_10000327
1847 Ga0265330_10029460
1848 Ga0265330_10091494
1849 Ga0265332_10006061
1850 Ga0265332_10041282
1851 Ga0265328_10000520
1852 Ga0265320_10006577
1853 Ga0265320_10101768
1854 Ga0265325_10000102
1855 Ga0265325_10034254
1856 Ga0265329_10000373
1857 Ga0265340_10002339
1858 Ga0265339_10001624
1859 Ga0265339_10008896
1860 Ga0265331_10005697
1861 Ga0265327_10008083
1862 Ga0265327_10017059
1863 Ga0265327_10044866
1864 Ga0265327_10055369
1865 Ga0265316_10021395
1866 Ga0265316_10048991
1867 Ga0307408_100421482
1868 Ga0265313_10002639
1869 Ga0265313_10005201
1870 Ga0265313_10063101
1871 Ga0265314_10002591
1872 Ga0265342_10021609
1873 Ga0265342_10042300
1874 Ga0307405_10249309
1875 Ga0307413_10002634
1876 Ga0307410_10001992
1877 Ga0307406_10050990
1878 Ga0307406_10269187
1879 Ga0307407_10000349
1880 Ga0307407_10300766
1881 Ga0307412_10007782
1882 Ga0307409_100000397
1883 Ga0307409_100176900
1884 Ga0307409_100214615
1885 Ga0307416_100005603
1886 Ga0307416_100100631
1887 Ga0307416_100156542
1888 Ga0307416_100436695
1889 Ga0307411_10012656
1890 Ga0307415_100001163
1891 Ga0307415_100037965
1892 Ga0307415_100062191
1893 Ga0373950_0005175
1894 Ga0373959_0007706
1895 Ga0373938_0000216
1896 Ga0373928_0006191
1897 Ga0373944_0004394
1898 Ga0373944_0009886
1899 Ga0373949_0002012
1900 Ga0373951_0001205
1901 Ga0373952_0012718
1902 Ga0373932_0001256
1903 Ga0373939_0001181
1904 Ga0373939_0057899
1905 Ga0373941_0000276
1906 Ga0373941_0074329
1907 Ga0373945_0005513
1908 Ga0373945_0037285
1909 Ga0373960_0000634
1910 Ga0373943_0000198
1911 Ga0373943_0007385
1912 Ga0373943_0069273
1913 Ga0373955_0027342
1914 Ga0373962_0001041
1915 Ga0373931_0067189
1916 Ga0373935_0030017
1917 Ga0373935_0041242
1918 Ga0373935_0088079
1919 Ga0373927_0133617
1920 Ga0373947_0000463
1921 Ga0373947_0002635
1922 Ga0373947_0018309
1923 Ga0373937_0000725
1924 Ga0373937_0360398
1925 Ga0373925_0002318
1926 Ga0373925_0007695
1927 Ga0373925_0201531
1928 Ga0373925_0527320
1929 Ga0395899_0002568
1930 Ga0395899_0003162
1931 Ga0395899_0004845
1932 Ga0395899_0008133
1933 Ga0395899_0012840
1934 Ga0395899_0020158
1935 Ga0395899_0056216
1936 Ga0395899_0060985
1937 Ga0395899_0077652
1938 Ga0395899_0081177
1939 Ga0395899_0096108
1940 Ga0395899_0145793
1941 Ga0395899_0178560
1942 Ga0395900_0000936
1943 Ga0395900_0001219
1944 Ga0395900_0001485
1945 Ga0395900_0001640
1946 Ga0395900_0004351
1947 Ga0395900_0004452
1948 Ga0395900_0011047
1949 Ga0395900_0011339
1950 Ga0395900_0027999
1951 Ga0395900_0033901
1952 Ga0395900_0041177
1953 Ga0395900_0058494
1954 Ga0395900_0061075
1955 Ga0395900_0080051
1956 Ga0395900_0083765
1957 Ga0395900_0120566
1958 Ga0395900_0132440
1959 Ga0395900_0267924
1960 Ga0395900_0367305
1961 Ga0395900_0480990
1962 Ga0395900_0620719
1963 Ga0395898_0002883
1964 Ga0395898_0004426
1965 Ga0395898_0008367
1966 Ga0395898_0009260
1967 Ga0395898_0013090
1968 Ga0395898_0013266
1969 Ga0395898_0019282
1970 Ga0395898_0020108
1971 Ga0395898_0057411
1972 Ga0395898_0058471
1973 Ga0395898_0059459
1974 Ga0395898_0097904
1975 Ga0395898_0116892
1976 Ga0395898_0121216
1977 Ga0395898_0125066
1978 Ga0395898_0136845
1979 Ga0395898_0150134
1980 Ga0395898_0248180
1981 Ga0395898_0280186
1982 Ga0395898_0306945
1983 Ga0395898_0402794
1984 Ga0395905_0000640
1985 Ga0395905_0002737
1986 Ga0395905_0003392
1987 Ga0395905_0007797
1988 Ga0395905_0010027
1989 Ga0395905_0023445
1990 Ga0395905_0028476
1991 Ga0395905_0039598
1992 Ga0395905_0050522
1993 Ga0395905_0095756
1994 Ga0395905_0117390
1995 Ga0395905_0117981
1996 Ga0395905_0136848
1997 Ga0395905_0202542
1998 Ga0395905_0244481
1999 Ga0395905_0364732
2000 Ga0395901_0000978
2001 Ga0395901_0001841
2002 Ga0395901_0002650
2003 Ga0395901_0002692
2004 Ga0395901_0003282
2005 Ga0395901_0011802
2006 Ga0395901_0016787
2007 Ga0395901_0016998
2008 Ga0395901_0017797
2009 Ga0395901_0038275
2010 Ga0395901_0058107
2011 Ga0395901_0069330
2012 Ga0395901_0081251
2013 Ga0395901_0088306
2014 Ga0395901_0107083
2015 Ga0395901_0117408
2016 Ga0395901_0204796
2017 Ga0395901_0224804
2018 Ga0395901_0228865
2019 Ga0395901_0232023
2020 Ga0395901_0282032
2021 Ga0395901_0306187
2022 Ga0395901_0338756
2023 Ga0395901_0452715
2024 Ga0436360_0072764
2025 Ga0436360_0325104
2026 Ga0436362_0000471
2027 Ga0439453_0004034
2028 Ga0439431_0004459
2029 Ga0439433_0001788
2030 Ga0439448_0010127
2031 Ga0439448_0050964
2032 Ga0439454_013683
2033 Ga0439455_0052896
2034 Ga0439446_0009779
2035 Ga0439434_0026494
2036 Ga0466969_0003306
2037 Ga0466969_0027186
2038 Ga0466972_0036719
2039 Ga0466965_0023576
2040 Ga0466965_0091376
2041 Ga0466966_0008955
2042 Ga0466966_0039067
2043 Ga0466961_0016940
2044 Ga0466961_0043432
2045 Ga0466961_0061392
2046 Ga0466961_0136160
2047 Ga0466961_0185539
2048 Ga0466963_0000095
2049 Ga0466963_0000705
2050 Ga0466963_0000857
2051 Ga0466963_0008069
2052 Ga0466963_0009173
2053 Ga0466963_0011499
2054 Ga0466963_0014736
2055 Ga0466963_0018021
2056 Ga0466963_0023819
2057 Ga0466963_0028626
2058 Ga0466963_0030330
2059 Ga0466963_0037276
2060 Ga0466963_0042093
2061 Ga0466963_0078175
2062 Ga0466963_0083799
2063 Ga0466963_0163639
2064 Ga0466963_0207139
2065 Ga0466964_0001480
2066 Ga0466964_0001981
2067 Ga0466964_0007054
2068 Ga0466964_0024500
2069 Ga0466964_0025725
2070 Ga0466964_0128097
2071 Ga0466964_0130877
2072 Ga0466964_0131755
2073 Ga0466971_0003250
2074 Ga0466971_0015522
2075 Ga0466971_0020860
2076 Ga0466971_0042634
2077 Ga0466971_0042660
2078 Ga0466971_0219805
2079 Ga0466968_0002238
2080 Ga0466968_0006491
2081 Ga0466968_0018435
2082 Ga0466968_0020838
2083 Ga0466968_0033912
2084 Ga0466968_0034595
2085 Ga0466968_0044769
2086 Ga0466968_0050752
2087 Ga0466968_0066253
2088 Ga0466970_0040086
2089 Ga0466970_0108568
2090 Ga0466957_0001672
2091 Ga0466957_0002974
2092 Ga0466957_0008669
2093 Ga0466957_0015929
2094 Ga0466957_0018921
2095 Ga0466957_0033943
2096 Ga0466957_0060142
2097 Ga0466957_0096331
2098 Ga0466957_0262522
2099 Ga0466957_0423275
2100 Ga0466960_0004411
2101 Ga0466960_0044665
2102 Ga0466960_0045687
2103 Ga0466959_0002457
2104 Ga0466959_0005223
2105 Ga0466959_0014268
2106 Ga0466959_0026055
2107 Ga0466959_0036203
2108 Ga0466959_0045680
2109 Ga0466959_0081935
2110 Ga0451576_0052216
2111 Ga0466958_0002667
2112 Ga0466958_0004618
2113 Ga0466958_0007167
2114 Ga0466958_0009418
2115 Ga0466958_0013118
2116 Ga0466958_0041087
2117 Ga0466958_0042172
2118 Ga0466958_0077821
2119 Ga0466958_0086108
2120 Ga0466958_0102836
2121 Ga0466958_0185700
2122 Ga0466958_0245978
2123 Ga0466967_0002678
2124 Ga0466967_0008051
2125 Ga0466967_0015896
2126 Ga0466967_0020790
2127 Ga0466967_0025255
2128 Ga0466967_0028485
2129 Ga0466967_0029109
2130 Ga0466967_0037568
2131 Ga0466967_0043946
2132 Ga0466967_0056030
2133 Ga0466967_0056885
2134 Ga0466967_0063628
2135 Ga0466967_0080325
2136 Ga0466967_0098860
2137 Ga0466967_0102239
2138 Ga0466967_0116645
2139 Ga0466967_0123887
2140 Ga0466967_0140917
2141 Ga0466967_0157618
2142 Ga0466967_0188657
2143 Ga0466967_0212175
2144 Ga0466967_0218654
2145 Ga0466967_0218956
2146 Ga0466967_0414494
2147 Ga0466967_0594491
2148 Ga0466967_0755032
2149 Ga0495617_066573
2150 Ga0495592_0000050
2151 Ga0495592_0012008
2152 Ga0495592_0027375
2153 Ga0495603_0000081
2154 Ga0495603_0005193
2155 Ga0495603_0016668
2156 Ga0495603_0022206
2157 Ga0495629_0005211
2158 Ga0495629_0154036
2159 Ga0495641_0002133
2160 Ga0495641_0005435
2161 Ga0495651_0000028
2162 Ga0495653_0005030
2163 Ga0495653_0144677
2164 Ga0495653_0168998
2165 Ga0495653_0220685
2166 Ga0495580_0013968
2167 Ga0495580_0035292
2168 Ga0495580_0286149
2169 Ga0495582_0023069
2170 Ga0495582_0027338
2171 Ga0495582_0041322
2172 Ga0495582_0067921
2173 Ga0495605_0099798
2174 Ga0495605_0101760
2175 Ga0495639_0026021
2176 Ga0495662_0030188
2177 Ga0495664_0038850
2178 Ga0495664_0206601
2179 Ga0495584_0010750
2180 Ga0495594_0000536
2181 Ga0495596_0024479
2182 Ga0495607_0032668
2183 Ga0495608_0000555
2184 Ga0495608_0006235
2185 Ga0495608_0292274
2186 Ga0495618_0011013
2187 Ga0495618_0015268
2188 Ga0495628_0000060
2189 Ga0495628_0030989
2190 Ga0495628_0217609
2191 Ga0495628_0271208
2192 Ga0495630_0004280
2193 Ga0495630_0011832
2194 Ga0495630_0043614
2195 Ga0495630_0124813
2196 Ga0495630_0127901
2197 Ga0495663_0008292
2198 Ga0495663_0063146
2199 Ga0495666_0026341
2200 Ga0495666_0164870
2201 Ga0495652_0000969
2202 Ga0495652_0020746
2203 Ga0495652_0032336
2204 Ga0495652_0034234
2205 Ga0495652_0052975
2206 Ga0495652_0276735
2207 Ga0495652_0314676
2208 Ga0495665_0004858
2209 Ga0495665_0167412
2210 Ga0495586_0000939
2211 Ga0495587_0000062
2212 Ga0495609_0117563
2213 Ga0495645_0000207
2214 Ga0495622_0051305
2215 Ga0495667_0029836
2216 Ga0495667_0112698
2217 Ga0495667_0265183
2218 Ga0495656_0003250
2219 Ga0495656_0072527
2220 Ga0495656_0116517
2221 Ga0495634_0028969
2222 Ga0495634_0057539
2223 Ga0495634_0168833
2224 Ga0495611_0023526
2225 Ga0495611_0083262
2226 Ga0495635_0011900
2227 Ga0495635_0029948
2228 Ga0495635_0042176
2229 Ga0495659_0014611
2230 Ga0495588_0001728
2231 Ga0495588_0150921
2232 Ga0495657_0080872
2233 Ga0495657_0114462
2234 Ga0495657_0190957
2235 Ga0495599_0000202
2236 Ga0495599_0008974
2237 Ga0495599_0058776
2238 Ga0495599_0103106
2239 Ga0495623_0000230
2240 Ga0495646_0002084
2241 Ga0495646_0045703
2242 Ga0495646_0104200
2243 Ga0495647_0004336
2244 Ga0495647_0077696
2245 Ga0495658_0035274
2246 Ga0495658_0154427
2247 Ga0495613_0010552
2248 Ga0495613_0051296
2249 Ga0495613_0087671
2250 Ga0495624_0057267
2251 Ga0495670_0028098
2252 Ga0495671_0184627
2253 Ga0495589_0038852
2254 Ga0495600_0084751
2255 Ga0495600_0116039
2256 Ga0495604_0000262
2257 Ga0495604_0064035
2258 Ga0495636_0038751
2259 Ga0495674_0021386
2260 Ga0495674_0250500
2261 Ga0495674_0252040
2262 Ga0495676_0043187
2263 Ga0495676_0070438
2264 Ga0495676_0140485
2265 Ga0495680_0005532
2266 Ga0495680_0018905
2267 Ga0495680_0040961
2268 Ga0495680_0042745
2269 Ga0495680_0077775
2270 Ga0495680_0390897
2271 Ga0495675_0000020
2272 Ga0495675_0108079
2273 Ga0495677_0032216
2274 Ga0495684_0004528
2275 Ga0495684_0053036
2276 Ga0495593_0004729
2277 Ga0495602_0000222
2278 Ga0495602_0053966
2279 Ga0495614_0097223
2280 Ga0495615_0031329
2281 Ga0495626_0102451
2282 Ga0496100_0002502
2283 Ga0496100_0006709
2284 Ga0496100_0006766
2285 Ga0496100_0008560
2286 Ga0496100_0009080
2287 Ga0496100_0043658
2288 Ga0496100_0070830
2289 Ga0496100_0342833
2290 Ga0496101_0001024
2291 Ga0496101_0016140
2292 Ga0496101_0025351
2293 Ga0496101_0028829
2294 Ga0496101_0064970
2295 Ga0496101_0072660
2296 Ga0496101_0102414
2297 Ga0496101_0116271
2298 Ga0496101_0125688
2299 Ga0496101_0167865
2300 Ga0496102_0004970
2301 Ga0496102_0013068
2302 Ga0496102_0022488
2303 Ga0496102_0025477
2304 Ga0496102_0036175
2305 Ga0496102_0043978
2306 Ga0496102_0046559
2307 Ga0496102_0061013
2308 Ga0496102_0063252
2309 Ga0496102_0094431
2310 Ga0496102_0121116
2311 Ga0496102_0196366
2312 Ga0496102_0225966
2313 Ga0496102_0231194
2314 Ga0496102_0262065
2315 Ga0496102_0450957
2316 Ga0496102_0501087
2317 Ga0496103_0004988
2318 Ga0496103_0009793
2319 Ga0496103_0019236
2320 Ga0496103_0021946
2321 Ga0496103_0083990
2322 Ga0496103_0105641
2323 Ga0496103_0174562
2324 Ga0496103_0267710
2325 Ga0496104_0000332
2326 Ga0496104_0000865
2327 Ga0496104_0002338
2328 Ga0496104_0004406
2329 Ga0496104_0008182
2330 Ga0496104_0008226
2331 Ga0496104_0010957
2332 Ga0496104_0016855
2333 Ga0496104_0022478
2334 Ga0496104_0054582
2335 Ga0496104_0075027
2336 Ga0496104_0088948
2337 Ga0496104_0139359
2338 Ga0496104_0150024
2339 Ga0496104_0152100
2340 Ga0496104_0173096
2341 Ga0496104_0229696
2342 Ga0496104_0446068
2343 Ga0496104_0449124
2344 Ga0496104_0532983
2345 Ga0496105_0000775
2346 Ga0496105_0001042
2347 Ga0496105_0004368
2348 Ga0496105_0005606
2349 Ga0496105_0007386
2350 Ga0496105_0008547
2351 Ga0496105_0010597
2352 Ga0496105_0027093
2353 Ga0496105_0097710
2354 Ga0496105_0187969
2355 Ga0496105_0491751
2356 Ga0496106_0013216
2357 Ga0496106_0016169
2358 Ga0496106_0025657
2359 Ga0496106_0057285
2360 Ga0496106_0058700
2361 Ga0496106_0076878
2362 Ga0496106_0093840
2363 Ga0496106_0176575
2364 Ga0496106_0429062
2365 Ga0496106_0583175
2366 Ga0496107_0000242
2367 Ga0496107_0000832
2368 Ga0496107_0001734
2369 Ga0496107_0002291
2370 Ga0496107_0004829
2371 Ga0496107_0019833
2372 Ga0496107_0051303
2373 Ga0496107_0058503
2374 Ga0496107_0080130
2375 Ga0496107_0135016
2376 Ga0496107_0141145
2377 Ga0496107_0216437
2378 Ga0496107_0241920
2379 Ga0496107_0274605
2380 Ga0496107_0396224
2381 Ga0496108_0001121
2382 Ga0496108_0001279
2383 Ga0496108_0004022
2384 Ga0496108_0005178
2385 Ga0496108_0008931
2386 Ga0496108_0018106
2387 Ga0496108_0027191
2388 Ga0496108_0028356
2389 Ga0496108_0035181
2390 Ga0496108_0068334
2391 Ga0496108_0122086
2392 Ga0496108_0229553
2393 Ga0496108_0477317
2394 Ga0496109_0000288
2395 Ga0496109_0000534
2396 Ga0496109_0001211
2397 Ga0496109_0001239
2398 Ga0496109_0001399
2399 Ga0496109_0001931
2400 Ga0496109_0009621
2401 Ga0496109_0010449
2402 Ga0496109_0018533
2403 Ga0496109_0032272
2404 Ga0496109_0043230
2405 Ga0496109_0046067
2406 Ga0496109_0053327
2407 Ga0496109_0074982
2408 Ga0496109_0118101
2409 Ga0496109_0132805
2410 Ga0496109_0191934
2411 Ga0496109_0199773
2412 Ga0496109_0208587
2413 Ga0496109_0478094
2414 Ga0496110_0000069
2415 Ga0496110_0000769
2416 Ga0496110_0000979
2417 Ga0496110_0009023
2418 Ga0496110_0010243
2419 Ga0496110_0018239
2420 Ga0496110_0020040
2421 Ga0496110_0029541
2422 Ga0496110_0035052
2423 Ga0496110_0052227
2424 Ga0496110_0069790
2425 Ga0496110_0147469
2426 Ga0496110_0150910
2427 Ga0496110_0161352
2428 Ga0496110_0183011
2429 Ga0496110_0229563
2430 Ga0496110_0257007
2431 Ga0496110_0259524
2432 Ga0496111_0000081
2433 Ga0496111_0000204
2434 Ga0496111_0001570
2435 Ga0496111_0001689
2436 Ga0496111_0003145
2437 Ga0496111_0008085
2438 Ga0496111_0017500
2439 Ga0496111_0037818
2440 Ga0496111_0061023
2441 Ga0496111_0083224
2442 Ga0496111_0085808
2443 Ga0496111_0103382
2444 Ga0496111_0142501
2445 Ga0496111_0165467
2446 Ga0496111_0167914
2447 Ga0496111_0209459
2448 Ga0496111_0238568
2449 Ga0496111_0244438
2450 Ga0496111_0246835
2451 Ga0496111_0304007
2452 Ga0496112_0000635
2453 Ga0496112_0000670
2454 Ga0496112_0001619
2455 Ga0496112_0001889
2456 Ga0496112_0003082
2457 Ga0496112_0003473
2458 Ga0496112_0003845
2459 Ga0496112_0013900
2460 Ga0496112_0036622
2461 Ga0496112_0040719
2462 Ga0496112_0040922
2463 Ga0496112_0046708
2464 Ga0496112_0069059
2465 Ga0496112_0082681
2466 Ga0496112_0113463
2467 Ga0496112_0206666
2468 Ga0496112_0490534
2469 Ga0496112_0610800
2470 Ga0496113_0036439
2471 Ga0496113_0037069
2472 Ga0496113_0040146
2473 Ga0496113_0042126
2474 Ga0496113_0055242
2475 Ga0496113_0077332
2476 Ga0496113_0081454
2477 Ga0496113_0097482
2478 Ga0496113_0153473
2479 Ga0496113_0279582
2480 Ga0496113_0370089
2481 Ga0496113_0372603
2482 Ga0496113_0424973
2483 Ga0496114_0000892
2484 Ga0496114_0002615
2485 Ga0496114_0003773
2486 Ga0496114_0008778
2487 Ga0496114_0009938
2488 Ga0496114_0017227
2489 Ga0496114_0026677
2490 Ga0496114_0032949
2491 Ga0496114_0045010
2492 Ga0496114_0047790
2493 Ga0496114_0072617
2494 Ga0496114_0080691
2495 Ga0496114_0248391
2496 Ga0496114_0267765
2497 Ga0496114_0284462
2498 Ga0496115_0000701
2499 Ga0496115_0002745
2500 Ga0496115_0005064
2501 Ga0496115_0013798
2502 Ga0496115_0033855
2503 Ga0496115_0059075
2504 Ga0496115_0095223
2505 Ga0496115_0162000
2506 Ga0496115_0182909
2507 Ga0496115_0320269
2508 Ga0496115_0338337
2509 Ga0496115_0354123
2510 Ga0496115_0501915
2511 Ga0496126_0014653
2512 Ga0501031_0008694
2513 Ga0501032_0008127
2514 Ga0501033_0068861
2515 Ga0501033_0111765
2516 Ga0501034_0039223
2517 Ga0501034_0058838
2518 Ga0501036_0020205
2519 Ga0501037_0061310
2520 Ga0501037_0281014
2521 Ga0501038_0045995
2522 Ga0501039_0017278
2523 Ga0501040_0001448
2524 Ga0501040_0297682
2525 Ga0501041_0002807
2526 Ga0501041_0019626
2527 Ga0501042_0011934
2528 Ga0501042_0046216
2529 Ga0501046_0000977
2530 Ga0501047_0009198
2531 Ga0501047_0009775
2532 Ga0501047_0014688
2533 Ga0501047_0152280
2534 Ga0501047_0226916
2535 Ga0501047_0242187
2536 Ga0501048_0002843
2537 Ga0501067_0068439
2538 Ga0501068_0004782
2539 Ga0501069_0020417
2540 Ga0501069_0045548
2541 Ga0501069_0055909
2542 Ga0501069_0071570
2543 Ga0501070_0000805
2544 Ga0501070_0055530
2545 Ga0501070_0219956
2546 Ga0501070_0243302
2547 Ga0501071_0035652
2548 Ga0501071_0074619
2549 Ga0501071_0169374
2550 Ga0501072_0003411
2551 Ga0501072_0254153
2552 Ga0501072_0298827
2553 Ga0501072_0299805
2554 Ga0501074_0008458
2555 Ga0501074_0020418
2556 Ga0501074_0131376
2557 Ga0501076_0002835
2558 Ga0501077_0002484
2559 Ga0501077_0007845
2560 Ga0501077_0274233
2561 Ga0501209_026745
2562 Ga0501079_0001222
2563 Ga0501079_0009336
2564 Ga0501079_0053739
2565 Ga0501079_0198124
2566 Ga0501080_0015795
2567 Ga0501080_0031460
2568 Ga0501080_0067996
2569 Ga0501080_0262950
2570 Ga0501081_0004722
2571 Ga0501081_0047579
2572 Ga0501083_0002114
2573 Ga0501083_0010944
2574 Ga0501083_0067448
2575 Ga0501044_0046555
2576 Ga0501044_0343162
2577 Ga0501044_0367068
2578 Ga0501045_0002001
2579 Ga0501045_0076746
2580 nmdc:mga0yw44_43770_c2
2581 nmdc:mga05p37_1712_c1
2582 nmdc:mga05p37_211685_c1
2583 nmdc:mga05p37_25384_c1
2584 nmdc:mga05p37_354762_c1
2585 nmdc:mga05p37_413569_c1
2586 nmdc:mga06r32_163303_c1
2587 nmdc:mga06r32_299926_c1
2588 nmdc:mga06r32_450801_c1
2589 nmdc:mga06r32_654237_c1
2590 nmdc:mga08y16_150129_c1
2591 nmdc:mga08y16_24505_c1
2592 nmdc:mga08y16_553167_c1
2593 nmdc:mga08y16_644016_c1
2594 nmdc:mga08y16_715336_c1
2595 nmdc:mga08y16_9150_c1
2596 nmdc:mga0n895_12180_c1
2597 nmdc:mga0n895_379557_c1
2598 nmdc:mga0n895_481382_c1
2599 nmdc:mga0n895_515970_c1
2600 nmdc:mga0n895_669600_c1
2601 nmdc:mga0n895_7295_c1
2602 nmdc:mga0rr50_34687_c1
2603 nmdc:mga0rr50_61838_c1
2604 nmdc:mga0rr50_76794_c1
2605 nmdc:mga08x19_45480_c2
2606 nmdc:mga08x19_8065_c1
2607 nmdc:mga08x19_8700_c1
2608 nmdc:mga08x19_9813_c1
2609 nmdc:mga0a205_189643_c1
2610 nmdc:mga0a205_209122_c1
2611 nmdc:mga0a205_336084_c1
2612 nmdc:mga0a205_36751_c1
2613 Ga0495601_0000218
2614 Ga0495601_0053536
2615 Ga0495601_0116292
2616 Ga0495612_0007074
2617 Ga0495612_0056557
2618 Ga0495655_0000400
2619 Ga0495595_0004838
2620 Ga0495595_0013345
2621 Ga0495595_0030875
2622 Ga0495619_0011100
2623 Ga0495619_0026262
2624 Ga0495619_0066626
2625 Ga0495619_0083344
2626 Ga0495619_0102697
2627 Ga0495619_0187354
2628 Ga0495619_0226748
2629 Ga0500566_0054705
2630 Ga0501084_0052612
2631 Ga0501084_0153946
2632 Ga0501084_0421059
2633 Ga0590075_023342
2634 Ga0501082_0000690
2635 Ga0501082_0055589
2636 Ga0501082_0189328
2637 Ga0501082_0679284
2638 Ga0466962_0000096
2639 Ga0466962_0001445
2640 Ga0466962_0003609
2641 Ga0466962_0007666
2642 Ga0466962_0007812
2643 Ga0466962_0050879
2644 Ga0466962_0059336
2645 Ga0466962_0062716
2646 Ga0466962_0110360
2647 Ga0530510_0000474
2648 Ga0530510_0005435

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01040

UbiA

UbiA prenyltransferase family

24

267

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8987 18 283
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8674 18 283
4tq4-assembly3.cif.gz_C structure of a ubia homolog from archaeoglobus fulgidus bound to dmapp and mg2+ 0.8061 11 283
4tq6-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7718 11 288
4tq3-assembly1.cif.gz_A structure of a ubia homolog from archaeoglobus fulgidus bound to gpp and mg2+ 0.7697 11 288
ID Description Score Start End Superfamily
af_P0AGK1_23_169_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9395 21 162 1.10.357.140
4od5A01 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9369 18 160 1.10.357.140
af_A4I0M3_131_276_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9321 21 162 1.10.357.140
af_F1LVF4_158_307_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9272 16 162 1.10.357.140
af_Q66JT7_234_356_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.9163 167 288 1.20.120.1780
ID Description Score Start End GO Terms
AF-A0A2V2SLM7-F1-model_v4 deleted 0.9944 5 220
AF-A0A7V3WHU1-F1-model_v4 4-hydroxybenzoate octaprenyltransferase 0.9894 5 196 GO:0005886
GO:0006744
GO:0016765
AF-A0A2U1RZI6-F1-model_v4 4-hydroxybenzoate octaprenyltransferase 0.9849 5 223 GO:0005886
GO:0006744
GO:0016765
AF-A0A2E9DAM5-F1-model_v4 4-hydroxybenzoate octaprenyltransferase 0.9838 5 287 GO:0005886
GO:0006744
GO:0016765
AF-A0A1H2URZ6-F1-model_v4 4-hydroxybenzoate polyprenyltransferase 0.9837 6 286 GO:0005886
GO:0006744
GO:0016765

Map