F493014
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1324 | 384 | 2648 | 284 |
Family's Representative Sequence
| Representative Sequence | 3300039438|Ga0436360_1016639|Ga0436360_1016639_1254_2117 |
| Length | 282 |
| Sequence | MTATPAPLPTRFARLVKIEHTVFALPFAYVGAFLAVGGTPTAHDLLWITLAMVGARSLAMALNRLIDRGIDARNPRTAGREIPSGQLSIAQVVLFCAASLALFLAAVWQLDPLVHRLWPIPVAGFVVYPYLKRVTWLCHLWLGAVDGLAPVGAWVAITGKLVLGAAVALWVAGFDFFYALFDLDVDRREGLHSIATEFGVRGAFTGARLAHLATVACLVAAGLGLSVGALYWIGVAAVAGLLAYEHSLVRPDDLRRLDTAFFTMNGVISVVFAVFVILDQAT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 114 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 174 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 175 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 176 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 177 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 183 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 185 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 187 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 190 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 197 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 198 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 199 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 200 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 205 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 206 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 207 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 208 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 209 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 213 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 215 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 221 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 224 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 228 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 229 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 230 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 231 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 232 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 233 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 234 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 235 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 236 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 237 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 238 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 239 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 240 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 241 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 242 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 243 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 244 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 245 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 246 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 247 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 248 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 249 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 250 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 251 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 252 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 253 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 254 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 255 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 256 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 257 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 322 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 323 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 324 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 325 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 326 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 327 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 330 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 331 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 332 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 333 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 334 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 335 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 336 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 360 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 367 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 380 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 382 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 384 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.55 |
| Metatranscriptomes | 0.45 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.23 |
| Nodule | 0 |
| Rhizoplane | 17.3 |
| Rhizosphere | 82.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436360_1016639 | 3300039438 | Bacteria | 9656 |
| 2 | JGI25407J50210_10009508 | 3300003373 | Bacteria | 2464 |
| 3 | Ga0070658_10012791 | 3300005327 | Bacteria | 6733 |
| 4 | Ga0070658_10063646 | 3300005327 | Bacteria | 3007 |
| 5 | Ga0070658_10114397 | 3300005327 | Bacteria | 2237 |
| 6 | Ga0070658_10149871 | 3300005327 | Bacteria | 1952 |
| 7 | Ga0070658_10169244 | 3300005327 | Bacteria | 1835 |
| 8 | Ga0070683_100005050 | 3300005329 | Bacteria | 10955 |
| 9 | Ga0070683_100026240 | 3300005329 | Bacteria | 5242 |
| 10 | Ga0070683_100053877 | 3300005329 | Bacteria | 3728 |
| 11 | Ga0070683_100073457 | 3300005329 | Bacteria | 3193 |
| 12 | Ga0070683_100102836 | 3300005329 | Bacteria | 2691 |
| 13 | Ga0070683_100165566 | 3300005329 | Bacteria | 2097 |
| 14 | Ga0070690_100358059 | 3300005330 | Bacteria | 1061 |
| 15 | Ga0070670_100232271 | 3300005331 | Bacteria | 1605 |
| 16 | Ga0068869_100284701 | 3300005334 | Bacteria | 1330 |
| 17 | Ga0068869_100307646 | 3300005334 | Bacteria | 1282 |
| 18 | Ga0070666_10245088 | 3300005335 | Bacteria | 1268 |
| 19 | Ga0070680_100006253 | 3300005336 | Bacteria | 9033 |
| 20 | Ga0070680_100032586 | 3300005336 | Bacteria | 4195 |
| 21 | Ga0070680_100064314 | 3300005336 | Bacteria | 3006 |
| 22 | Ga0070680_100290897 | 3300005336 | Bacteria | 1385 |
| 23 | Ga0070680_100458681 | 3300005336 | Bacteria | 1089 |
| 24 | Ga0070682_100043893 | 3300005337 | Bacteria | 2765 |
| 25 | Ga0070682_100045211 | 3300005337 | Bacteria | 2728 |
| 26 | Ga0070682_100068968 | 3300005337 | Bacteria | 2257 |
| 27 | Ga0068868_100060097 | 3300005338 | Bacteria | 3008 |
| 28 | Ga0068868_100154711 | 3300005338 | Bacteria | 1890 |
| 29 | Ga0068868_100175254 | 3300005338 | Bacteria | 1777 |
| 30 | Ga0070660_100024614 | 3300005339 | Bacteria | 4466 |
| 31 | Ga0070660_100045847 | 3300005339 | Bacteria | 3349 |
| 32 | Ga0070660_100046194 | 3300005339 | Bacteria | 3337 |
| 33 | Ga0070660_100046949 | 3300005339 | Bacteria | 3311 |
| 34 | Ga0070660_100052003 | 3300005339 | Bacteria | 3156 |
| 35 | Ga0070660_100270999 | 3300005339 | Bacteria | 1387 |
| 36 | Ga0070689_100008221 | 3300005340 | Bacteria | 7337 |
| 37 | Ga0070691_10068259 | 3300005341 | Bacteria | 1721 |
| 38 | Ga0070661_100012445 | 3300005344 | Bacteria | 5951 |
| 39 | Ga0070661_100109628 | 3300005344 | Bacteria | 2060 |
| 40 | Ga0070661_100445191 | 3300005344 | Bacteria | 1030 |
| 41 | Ga0070692_10004619 | 3300005345 | Bacteria | 5767 |
| 42 | Ga0070692_10140230 | 3300005345 | Bacteria | 1367 |
| 43 | Ga0070675_100161683 | 3300005354 | Bacteria | 1926 |
| 44 | Ga0070671_100032295 | 3300005355 | Bacteria | 4328 |
| 45 | Ga0070671_100093187 | 3300005355 | Bacteria | 2524 |
| 46 | Ga0070674_100230187 | 3300005356 | Bacteria | 1446 |
| 47 | Ga0070674_100445881 | 3300005356 | Unclassified | 1067 |
| 48 | Ga0070673_100547224 | 3300005364 | Bacteria | 1051 |
| 49 | Ga0070659_100031564 | 3300005366 | Bacteria | 4104 |
| 50 | Ga0070667_100002001 | 3300005367 | Bacteria | 18056 |
| 51 | Ga0070703_10002554 | 3300005406 | Bacteria | 5245 |
| 52 | Ga0070703_10030854 | 3300005406 | Bacteria | 1618 |
| 53 | Ga0070709_10028844 | 3300005434 | Bacteria | 3313 |
| 54 | Ga0070709_10034021 | 3300005434 | Bacteria | 3087 |
| 55 | Ga0070714_100004198 | 3300005435 | Bacteria | 10846 |
| 56 | Ga0070714_100004838 | 3300005435 | Bacteria | 10221 |
| 57 | Ga0070714_100023312 | 3300005435 | Bacteria | 5083 |
| 58 | Ga0070714_100025095 | 3300005435 | Bacteria | 4917 |
| 59 | Ga0070714_100072969 | 3300005435 | Bacteria | 2973 |
| 60 | Ga0070714_100089467 | 3300005435 | Bacteria | 2695 |
| 61 | Ga0070714_100254802 | 3300005435 | Bacteria | 1624 |
| 62 | Ga0070714_100281644 | 3300005435 | Bacteria | 1545 |
| 63 | Ga0070714_100298449 | 3300005435 | Unclassified | 1501 |
| 64 | Ga0070714_100374294 | 3300005435 | Bacteria | 1341 |
| 65 | Ga0070714_100573408 | 3300005435 | Bacteria | 1082 |
| 66 | Ga0070713_100001060 | 3300005436 | Bacteria | 17565 |
| 67 | Ga0070713_100017251 | 3300005436 | Bacteria | 5455 |
| 68 | Ga0070713_100114537 | 3300005436 | Bacteria | 2356 |
| 69 | Ga0070713_100170226 | 3300005436 | Bacteria | 1951 |
| 70 | Ga0070710_10000443 | 3300005437 | Bacteria | 19486 |
| 71 | Ga0070710_10171620 | 3300005437 | Bacteria | 1351 |
| 72 | Ga0070701_10188709 | 3300005438 | Bacteria | 1212 |
| 73 | Ga0070711_100011889 | 3300005439 | Bacteria | 5417 |
| 74 | Ga0070711_100013538 | 3300005439 | Bacteria | 5122 |
| 75 | Ga0070711_100021588 | 3300005439 | Bacteria | 4165 |
| 76 | Ga0070711_100061153 | 3300005439 | Bacteria | 2621 |
| 77 | Ga0070711_100206347 | 3300005439 | Bacteria | 1519 |
| 78 | Ga0070711_100485727 | 3300005439 | Bacteria | 1016 |
| 79 | Ga0070705_100001980 | 3300005440 | Bacteria | 10456 |
| 80 | Ga0070705_100013747 | 3300005440 | Bacteria | 4146 |
| 81 | Ga0070705_100018179 | 3300005440 | Bacteria | 3680 |
| 82 | Ga0070700_100015619 | 3300005441 | Bacteria | 4310 |
| 83 | Ga0070694_100038984 | 3300005444 | Bacteria | 3160 |
| 84 | Ga0070708_100034217 | 3300005445 | Bacteria | 4420 |
| 85 | Ga0070708_100220947 | 3300005445 | Bacteria | 1777 |
| 86 | Ga0070663_100372014 | 3300005455 | Bacteria | 1162 |
| 87 | Ga0070678_100002713 | 3300005456 | Bacteria | 9771 |
| 88 | Ga0070678_100127047 | 3300005456 | Bacteria | 2020 |
| 89 | Ga0070678_100139922 | 3300005456 | Bacteria | 1935 |
| 90 | Ga0070681_10009404 | 3300005458 | Bacteria | 9617 |
| 91 | Ga0070681_10017738 | 3300005458 | Bacteria | 7114 |
| 92 | Ga0070681_10036127 | 3300005458 | Bacteria | 4963 |
| 93 | Ga0070681_10057635 | 3300005458 | Bacteria | 3865 |
| 94 | Ga0070681_10065039 | 3300005458 | Bacteria | 3616 |
| 95 | Ga0070681_10083232 | 3300005458 | Bacteria | 3153 |
| 96 | Ga0070681_10123323 | 3300005458 | Bacteria | 2524 |
| 97 | Ga0070681_10164387 | 3300005458 | Bacteria | 2142 |
| 98 | Ga0070681_10186406 | 3300005458 | Bacteria | 1995 |
| 99 | Ga0068867_100000913 | 3300005459 | Bacteria | 20051 |
| 100 | Ga0068867_100171456 | 3300005459 | Bacteria | 1719 |
| 101 | Ga0068867_100260382 | 3300005459 | Bacteria | 1414 |
| 102 | Ga0070685_10247899 | 3300005466 | Unclassified | 1178 |
| 103 | Ga0070706_100046484 | 3300005467 | Bacteria | 4007 |
| 104 | Ga0070706_100085657 | 3300005467 | Bacteria | 2920 |
| 105 | Ga0070706_100198366 | 3300005467 | Bacteria | 1875 |
| 106 | Ga0070706_100354329 | 3300005467 | Bacteria | 1368 |
| 107 | Ga0070707_100002712 | 3300005468 | Bacteria | 16848 |
| 108 | Ga0070707_100011501 | 3300005468 | Bacteria | 8253 |
| 109 | Ga0070707_100155777 | 3300005468 | Bacteria | 2225 |
| 110 | Ga0070707_100177888 | 3300005468 | Bacteria | 2074 |
| 111 | Ga0070707_100297321 | 3300005468 | Bacteria | 1569 |
| 112 | Ga0070707_100459801 | 3300005468 | Bacteria | 1233 |
| 113 | Ga0070707_100503600 | 3300005468 | Bacteria | 1173 |
| 114 | Ga0070698_100000853 | 3300005471 | Bacteria | 33433 |
| 115 | Ga0070698_100015615 | 3300005471 | Bacteria | 8020 |
| 116 | Ga0070698_100034960 | 3300005471 | Bacteria | 5197 |
| 117 | Ga0070698_100063612 | 3300005471 | Bacteria | 3720 |
| 118 | Ga0070698_100182169 | 3300005471 | Bacteria | 2039 |
| 119 | Ga0070679_100003423 | 3300005530 | Bacteria | 14526 |
| 120 | Ga0070679_100052984 | 3300005530 | Bacteria | 4039 |
| 121 | Ga0070679_100112160 | 3300005530 | Bacteria | 2713 |
| 122 | Ga0070679_100120333 | 3300005530 | Bacteria | 2610 |
| 123 | Ga0070679_100156760 | 3300005530 | Bacteria | 2251 |
| 124 | Ga0070679_100198244 | 3300005530 | Bacteria | 1974 |
| 125 | Ga0070684_100000762 | 3300005535 | Bacteria | 22333 |
| 126 | Ga0070684_100001409 | 3300005535 | Bacteria | 17288 |
| 127 | Ga0070684_100029473 | 3300005535 | Bacteria | 4651 |
| 128 | Ga0070684_100034824 | 3300005535 | Bacteria | 4307 |
| 129 | Ga0070684_100044526 | 3300005535 | Bacteria | 3839 |
| 130 | Ga0070684_100050892 | 3300005535 | Bacteria | 3599 |
| 131 | Ga0070684_100081507 | 3300005535 | Bacteria | 2863 |
| 132 | Ga0070684_100117734 | 3300005535 | Bacteria | 2387 |
| 133 | Ga0070684_100119746 | 3300005535 | Bacteria | 2368 |
| 134 | Ga0070684_100126232 | 3300005535 | Bacteria | 2305 |
| 135 | Ga0070684_100172123 | 3300005535 | Bacteria | 1967 |
| 136 | Ga0070697_100064098 | 3300005536 | Bacteria | 3001 |
| 137 | Ga0070697_100170162 | 3300005536 | Bacteria | 1843 |
| 138 | Ga0068853_100005764 | 3300005539 | Bacteria | 9750 |
| 139 | Ga0068853_100179062 | 3300005539 | Bacteria | 1922 |
| 140 | Ga0068853_100297938 | 3300005539 | Bacteria | 1490 |
| 141 | Ga0070672_100036775 | 3300005543 | Bacteria | 3733 |
| 142 | Ga0070686_100033420 | 3300005544 | Bacteria | 3161 |
| 143 | Ga0070686_100105273 | 3300005544 | Bacteria | 1912 |
| 144 | Ga0070695_100017454 | 3300005545 | Bacteria | 4352 |
| 145 | Ga0070695_100084342 | 3300005545 | Bacteria | 2107 |
| 146 | Ga0070696_100004176 | 3300005546 | Bacteria | 9624 |
| 147 | Ga0070696_100034805 | 3300005546 | Bacteria | 3466 |
| 148 | Ga0070693_100015388 | 3300005547 | Bacteria | 3938 |
| 149 | Ga0070693_100069223 | 3300005547 | Bacteria | 2073 |
| 150 | Ga0070693_100261239 | 3300005547 | Bacteria | 1152 |
| 151 | Ga0070665_100013762 | 3300005548 | Bacteria | 8140 |
| 152 | Ga0070704_100217705 | 3300005549 | Bacteria | 1551 |
| 153 | Ga0068855_100023527 | 3300005563 | Bacteria | 7376 |
| 154 | Ga0068855_100034915 | 3300005563 | Bacteria | 5992 |
| 155 | Ga0068855_100101071 | 3300005563 | Bacteria | 3319 |
| 156 | Ga0068855_100246350 | 3300005563 | Bacteria | 1995 |
| 157 | Ga0068855_100472521 | 3300005563 | Bacteria | 1366 |
| 158 | Ga0068855_100490321 | 3300005563 | Bacteria | 1336 |
| 159 | Ga0070664_100104597 | 3300005564 | Bacteria | 2465 |
| 160 | Ga0068857_100001692 | 3300005577 | Bacteria | 17733 |
| 161 | Ga0068857_100043413 | 3300005577 | Bacteria | 3988 |
| 162 | Ga0068857_100051612 | 3300005577 | Bacteria | 3650 |
| 163 | Ga0068857_100278651 | 3300005577 | Bacteria | 1538 |
| 164 | Ga0068854_100149252 | 3300005578 | Bacteria | 1801 |
| 165 | Ga0068854_100162977 | 3300005578 | Bacteria | 1728 |
| 166 | Ga0068856_100002581 | 3300005614 | Bacteria | 18656 |
| 167 | Ga0068856_100043969 | 3300005614 | Bacteria | 4394 |
| 168 | Ga0068856_100335162 | 3300005614 | Bacteria | 1531 |
| 169 | Ga0068856_100384501 | 3300005614 | Bacteria | 1423 |
| 170 | Ga0070702_100044121 | 3300005615 | Bacteria | 2515 |
| 171 | Ga0070702_100151165 | 3300005615 | Bacteria | 1490 |
| 172 | Ga0068852_100320981 | 3300005616 | Bacteria | 1504 |
| 173 | Ga0068864_100025713 | 3300005618 | Bacteria | 4961 |
| 174 | Ga0068866_10002623 | 3300005718 | Bacteria | 7431 |
| 175 | Ga0068866_10091584 | 3300005718 | Bacteria | 1657 |
| 176 | Ga0068861_100157244 | 3300005719 | Bacteria | 1871 |
| 177 | Ga0068861_100237372 | 3300005719 | Bacteria | 1549 |
| 178 | Ga0081455_10018767 | 3300005937 | Bacteria | 6563 |
| 179 | Ga0081455_10055952 | 3300005937 | Bacteria | 3352 |
| 180 | Ga0081538_10000100 | 3300005981 | Bacteria | 83917 |
| 181 | Ga0081538_10016467 | 3300005981 | Bacteria | 5664 |
| 182 | Ga0081540_1004488 | 3300005983 | Bacteria | 10610 |
| 183 | Ga0081539_10000095 | 3300005985 | Bacteria | 204474 |
| 184 | Ga0081539_10001005 | 3300005985 | Bacteria | 52334 |
| 185 | Ga0070717_10005467 | 3300006028 | Bacteria | 9275 |
| 186 | Ga0070717_10005558 | 3300006028 | Bacteria | 9196 |
| 187 | Ga0070717_10030563 | 3300006028 | Bacteria | 4327 |
| 188 | Ga0075365_10064967 | 3300006038 | Bacteria | 2445 |
| 189 | Ga0075432_10044418 | 3300006058 | Bacteria | 1558 |
| 190 | Ga0070715_10001395 | 3300006163 | Bacteria | 6980 |
| 191 | Ga0070715_10005089 | 3300006163 | Bacteria | 4362 |
| 192 | Ga0070715_10020497 | 3300006163 | Bacteria | 2551 |
| 193 | Ga0070716_100005635 | 3300006173 | Bacteria | 6082 |
| 194 | Ga0070712_100033918 | 3300006175 | Bacteria | 3457 |
| 195 | Ga0070712_100040695 | 3300006175 | Bacteria | 3187 |
| 196 | Ga0070712_100054382 | 3300006175 | Bacteria | 2799 |
| 197 | Ga0070712_100131276 | 3300006175 | Bacteria | 1899 |
| 198 | Ga0070712_100263968 | 3300006175 | Bacteria | 1381 |
| 199 | Ga0070712_100345452 | 3300006175 | Unclassified | 1216 |
| 200 | Ga0097621_100002459 | 3300006237 | Bacteria | 12676 |
| 201 | Ga0097621_100105826 | 3300006237 | Bacteria | 2372 |
| 202 | Ga0097621_100376153 | 3300006237 | Bacteria | 1268 |
| 203 | Ga0068871_100145601 | 3300006358 | Bacteria | 2017 |
| 204 | Ga0068871_100208963 | 3300006358 | Bacteria | 1688 |
| 205 | Ga0075428_100005327 | 3300006844 | Bacteria | 14298 |
| 206 | Ga0075431_100476000 | 3300006847 | Bacteria | 1242 |
| 207 | Ga0075433_10002265 | 3300006852 | Bacteria | 14625 |
| 208 | Ga0075433_10033469 | 3300006852 | Bacteria | 4406 |
| 209 | Ga0075434_100001294 | 3300006871 | Bacteria | 20866 |
| 210 | Ga0075434_100009463 | 3300006871 | Bacteria | 9085 |
| 211 | Ga0075434_100162060 | 3300006871 | Bacteria | 2256 |
| 212 | Ga0075434_100182287 | 3300006871 | Bacteria | 2120 |
| 213 | Ga0075434_100489407 | 3300006871 | Bacteria | 1251 |
| 214 | Ga0075434_100515776 | 3300006871 | Bacteria | 1216 |
| 215 | Ga0068865_100012648 | 3300006881 | Bacteria | 5318 |
| 216 | Ga0075436_100000915 | 3300006914 | Bacteria | 19663 |
| 217 | Ga0075436_100009752 | 3300006914 | Bacteria | 6571 |
| 218 | Ga0075436_100011075 | 3300006914 | Bacteria | 6186 |
| 219 | Ga0075436_100083343 | 3300006914 | Bacteria | 2218 |
| 220 | Ga0075436_100173171 | 3300006914 | Bacteria | 1524 |
| 221 | Ga0075435_100001243 | 3300007076 | Bacteria | 16320 |
| 222 | Ga0075435_100030849 | 3300007076 | Bacteria | 4218 |
| 223 | Ga0075435_100082018 | 3300007076 | Bacteria | 2650 |
| 224 | Ga0105240_10017296 | 3300009093 | Bacteria | 9720 |
| 225 | Ga0105240_10106166 | 3300009093 | Bacteria | 3407 |
| 226 | Ga0105240_10180778 | 3300009093 | Bacteria | 2489 |
| 227 | Ga0105240_10250352 | 3300009093 | Bacteria | 2049 |
| 228 | Ga0105240_10351008 | 3300009093 | Bacteria | 1673 |
| 229 | Ga0105240_10625444 | 3300009093 | Bacteria | 1183 |
| 230 | Ga0111539_10001300 | 3300009094 | Bacteria | 33359 |
| 231 | Ga0111539_10003648 | 3300009094 | Bacteria | 20271 |
| 232 | Ga0111539_10031645 | 3300009094 | Bacteria | 6427 |
| 233 | Ga0111539_10038970 | 3300009094 | Bacteria | 5731 |
| 234 | Ga0111539_10144163 | 3300009094 | Bacteria | 2788 |
| 235 | Ga0111539_10178854 | 3300009094 | Bacteria | 2478 |
| 236 | Ga0111539_10189315 | 3300009094 | Bacteria | 2401 |
| 237 | Ga0111539_10199717 | 3300009094 | Bacteria | 2332 |
| 238 | Ga0111539_10204142 | 3300009094 | Unclassified | 2304 |
| 239 | Ga0111539_10288660 | 3300009094 | Bacteria | 1909 |
| 240 | Ga0105245_10007177 | 3300009098 | Bacteria | 9767 |
| 241 | Ga0105245_10016075 | 3300009098 | Bacteria | 6520 |
| 242 | Ga0105245_10020104 | 3300009098 | Bacteria | 5853 |
| 243 | Ga0105245_10028370 | 3300009098 | Bacteria | 4937 |
| 244 | Ga0105245_10076745 | 3300009098 | Bacteria | 3045 |
| 245 | Ga0105245_10077410 | 3300009098 | Bacteria | 3032 |
| 246 | Ga0105245_10088218 | 3300009098 | Bacteria | 2849 |
| 247 | Ga0105245_10146073 | 3300009098 | Bacteria | 2231 |
| 248 | Ga0105245_10415010 | 3300009098 | Bacteria | 1348 |
| 249 | Ga0105247_10206780 | 3300009101 | Bacteria | 1322 |
| 250 | Ga0114129_10000141 | 3300009147 | Bacteria | 75420 |
| 251 | Ga0114129_10016454 | 3300009147 | Bacteria | 10527 |
| 252 | Ga0114129_10032839 | 3300009147 | Bacteria | 7333 |
| 253 | Ga0114129_10125768 | 3300009147 | Bacteria | 3525 |
| 254 | Ga0114129_10229065 | 3300009147 | Unclassified | 2503 |
| 255 | Ga0114129_10518272 | 3300009147 | Bacteria | 1555 |
| 256 | Ga0114129_10601237 | 3300009147 | Bacteria | 1425 |
| 257 | Ga0114129_10623426 | 3300009147 | Bacteria | 1395 |
| 258 | Ga0114129_10752386 | 3300009147 | Bacteria | 1247 |
| 259 | Ga0105243_10031341 | 3300009148 | Bacteria | 4099 |
| 260 | Ga0105243_10246127 | 3300009148 | Bacteria | 1594 |
| 261 | Ga0105243_10633861 | 3300009148 | Bacteria | 1034 |
| 262 | Ga0105241_10716541 | 3300009174 | Bacteria | 915 |
| 263 | Ga0105242_10074064 | 3300009176 | Bacteria | 2832 |
| 264 | Ga0105242_10389512 | 3300009176 | Bacteria | 1297 |
| 265 | Ga0105248_10016541 | 3300009177 | Bacteria | 8123 |
| 266 | Ga0105248_10430215 | 3300009177 | Bacteria | 1487 |
| 267 | Ga0105248_10437885 | 3300009177 | Bacteria | 1472 |
| 268 | Ga0105248_10551715 | 3300009177 | Bacteria | 1300 |
| 269 | Ga0105237_10105826 | 3300009545 | Bacteria | 2805 |
| 270 | Ga0105238_10091694 | 3300009551 | Bacteria | 3026 |
| 271 | Ga0105238_10198028 | 3300009551 | Bacteria | 1984 |
| 272 | Ga0105249_10001857 | 3300009553 | Bacteria | 18327 |
| 273 | Ga0105239_10158940 | 3300010375 | Bacteria | 2524 |
| 274 | Ga0105239_10196554 | 3300010375 | Bacteria | 2259 |
| 275 | Ga0105239_10261355 | 3300010375 | Bacteria | 1945 |
| 276 | Ga0105239_10284997 | 3300010375 | Bacteria | 1860 |
| 277 | Ga0105246_10088817 | 3300011119 | Bacteria | 2222 |
| 278 | Ga0105246_10098245 | 3300011119 | Bacteria | 2126 |
| 279 | Ga0157371_10204373 | 3300013102 | Bacteria | 1417 |
| 280 | Ga0157370_10015040 | 3300013104 | Bacteria | 7888 |
| 281 | Ga0157370_10086075 | 3300013104 | Bacteria | 2953 |
| 282 | Ga0157370_10153386 | 3300013104 | Bacteria | 2143 |
| 283 | Ga0157369_10002742 | 3300013105 | Bacteria | 21036 |
| 284 | Ga0157369_10017773 | 3300013105 | Bacteria | 7985 |
| 285 | Ga0157369_10018104 | 3300013105 | Bacteria | 7901 |
| 286 | Ga0157369_10035760 | 3300013105 | Bacteria | 5445 |
| 287 | Ga0157369_10037107 | 3300013105 | Bacteria | 5338 |
| 288 | Ga0157369_10149428 | 3300013105 | Bacteria | 2469 |
| 289 | Ga0157369_10198355 | 3300013105 | Bacteria | 2107 |
| 290 | Ga0157374_10020353 | 3300013296 | Bacteria | 5885 |
| 291 | Ga0157374_10023645 | 3300013296 | Bacteria | 5499 |
| 292 | Ga0157374_10085634 | 3300013296 | Bacteria | 2997 |
| 293 | Ga0157378_10110998 | 3300013297 | Bacteria | 2514 |
| 294 | Ga0157378_10191417 | 3300013297 | Bacteria | 1929 |
| 295 | Ga0157378_10448914 | 3300013297 | Bacteria | 1279 |
| 296 | Ga0163162_10032238 | 3300013306 | Bacteria | 5202 |
| 297 | Ga0163162_10467857 | 3300013306 | Unclassified | 1392 |
| 298 | Ga0157372_10080466 | 3300013307 | Bacteria | 3686 |
| 299 | Ga0157372_10270207 | 3300013307 | Bacteria | 1975 |
| 300 | Ga0157372_10352083 | 3300013307 | Bacteria | 1716 |
| 301 | Ga0157375_10006585 | 3300013308 | Bacteria | 10110 |
| 302 | Ga0157375_10045939 | 3300013308 | Bacteria | 4254 |
| 303 | Ga0157375_10055423 | 3300013308 | Bacteria | 3909 |
| 304 | Ga0157375_10300275 | 3300013308 | Bacteria | 1769 |
| 305 | Ga0157375_10539078 | 3300013308 | Bacteria | 1329 |
| 306 | Ga0157380_10001429 | 3300014326 | Bacteria | 15632 |
| 307 | Ga0157377_10006457 | 3300014745 | Bacteria | 5598 |
| 308 | Ga0157379_10119773 | 3300014968 | Bacteria | 2367 |
| 309 | Ga0157376_10013193 | 3300014969 | Bacteria | 6157 |
| 310 | Ga0157376_10114055 | 3300014969 | Unclassified | 2384 |
| 311 | Ga0182007_10017644 | 3300015262 | Bacteria | 2602 |
| 312 | Ga0197907_10740994 | 3300020069 | Bacteria | 1510 |
| 313 | Ga0206356_10116221 | 3300020070 | Bacteria | 6173 |
| 314 | Ga0206354_10232504 | 3300020081 | Bacteria | 1655 |
| 315 | Ga0206353_11057617 | 3300020082 | Bacteria | 1090 |
| 316 | Ga0206353_11605935 | 3300020082 | Bacteria | 7901 |
| 317 | Ga0206353_11689011 | 3300020082 | Bacteria | 14322 |
| 318 | Ga0213873_10033604 | 3300021358 | Bacteria | 1288 |
| 319 | Ga0213871_10014400 | 3300021441 | Bacteria | 1875 |
| 320 | Ga0207692_10006335 | 3300025898 | Bacteria | 4797 |
| 321 | Ga0207692_10008917 | 3300025898 | Bacteria | 4169 |
| 322 | Ga0207692_10068773 | 3300025898 | Bacteria | 1858 |
| 323 | Ga0207692_10238382 | 3300025898 | Bacteria | 1085 |
| 324 | Ga0207642_10200029 | 3300025899 | Bacteria | 1103 |
| 325 | Ga0207688_10065403 | 3300025901 | Bacteria | 2055 |
| 326 | Ga0207688_10102295 | 3300025901 | Bacteria | 1656 |
| 327 | Ga0207680_10005081 | 3300025903 | Bacteria | 6267 |
| 328 | Ga0207685_10001417 | 3300025905 | Bacteria | 5007 |
| 329 | Ga0207685_10006373 | 3300025905 | Bacteria | 3209 |
| 330 | Ga0207685_10033087 | 3300025905 | Bacteria | 1866 |
| 331 | Ga0207699_10018015 | 3300025906 | Bacteria | 3733 |
| 332 | Ga0207699_10155265 | 3300025906 | Bacteria | 1518 |
| 333 | Ga0207699_10183722 | 3300025906 | Bacteria | 1407 |
| 334 | Ga0207699_10309108 | 3300025906 | Bacteria | 1106 |
| 335 | Ga0207643_10027055 | 3300025908 | Bacteria | 3179 |
| 336 | Ga0207705_10137243 | 3300025909 | Bacteria | 1824 |
| 337 | Ga0207705_10139465 | 3300025909 | Bacteria | 1810 |
| 338 | Ga0207705_10149333 | 3300025909 | Bacteria | 1750 |
| 339 | Ga0207684_10028521 | 3300025910 | Bacteria | 4756 |
| 340 | Ga0207684_10103641 | 3300025910 | Bacteria | 2432 |
| 341 | Ga0207684_10128772 | 3300025910 | Bacteria | 2173 |
| 342 | Ga0207684_10467349 | 3300025910 | Bacteria | 1083 |
| 343 | Ga0207707_10008396 | 3300025912 | Bacteria | 8961 |
| 344 | Ga0207707_10030466 | 3300025912 | Bacteria | 4719 |
| 345 | Ga0207707_10050817 | 3300025912 | Bacteria | 3610 |
| 346 | Ga0207707_10065380 | 3300025912 | Bacteria | 3168 |
| 347 | Ga0207707_10250954 | 3300025912 | Unclassified | 1537 |
| 348 | Ga0207695_10009300 | 3300025913 | Bacteria | 12161 |
| 349 | Ga0207695_10052410 | 3300025913 | Bacteria | 4275 |
| 350 | Ga0207695_10216587 | 3300025913 | Bacteria | 1824 |
| 351 | Ga0207695_10246270 | 3300025913 | Archaea | 1687 |
| 352 | Ga0207693_10000468 | 3300025915 | Bacteria | 36863 |
| 353 | Ga0207693_10003383 | 3300025915 | Bacteria | 13623 |
| 354 | Ga0207693_10008117 | 3300025915 | Bacteria | 8606 |
| 355 | Ga0207693_10015138 | 3300025915 | Bacteria | 6191 |
| 356 | Ga0207693_10023335 | 3300025915 | Bacteria | 4912 |
| 357 | Ga0207693_10069335 | 3300025915 | Bacteria | 2759 |
| 358 | Ga0207693_10189074 | 3300025915 | Bacteria | 1621 |
| 359 | Ga0207693_10273778 | 3300025915 | Bacteria | 1323 |
| 360 | Ga0207693_10359449 | 3300025915 | Bacteria | 1139 |
| 361 | Ga0207663_10057469 | 3300025916 | Bacteria | 2451 |
| 362 | Ga0207663_10243328 | 3300025916 | Bacteria | 1320 |
| 363 | Ga0207663_10414183 | 3300025916 | Unclassified | 1033 |
| 364 | Ga0207663_10421374 | 3300025916 | Bacteria | 1025 |
| 365 | Ga0207660_10130370 | 3300025917 | Bacteria | 1913 |
| 366 | Ga0207660_10136895 | 3300025917 | Bacteria | 1869 |
| 367 | Ga0207660_10460566 | 3300025917 | Archaea | 1029 |
| 368 | Ga0207657_10000988 | 3300025919 | Bacteria | 30190 |
| 369 | Ga0207657_10004731 | 3300025919 | Bacteria | 14370 |
| 370 | Ga0207657_10009308 | 3300025919 | Bacteria | 9893 |
| 371 | Ga0207657_10015573 | 3300025919 | Bacteria | 7360 |
| 372 | Ga0207657_10024561 | 3300025919 | Bacteria | 5574 |
| 373 | Ga0207657_10069096 | 3300025919 | Bacteria | 2999 |
| 374 | Ga0207657_10336348 | 3300025919 | Bacteria | 1192 |
| 375 | Ga0207649_10024155 | 3300025920 | Bacteria | 3530 |
| 376 | Ga0207652_10045065 | 3300025921 | Bacteria | 3759 |
| 377 | Ga0207652_10080258 | 3300025921 | Bacteria | 2852 |
| 378 | Ga0207652_10092179 | 3300025921 | Bacteria | 2665 |
| 379 | Ga0207652_10382396 | 3300025921 | Unclassified | 1270 |
| 380 | Ga0207646_10001768 | 3300025922 | Bacteria | 26172 |
| 381 | Ga0207646_10002982 | 3300025922 | Bacteria | 19556 |
| 382 | Ga0207646_10005974 | 3300025922 | Bacteria | 12694 |
| 383 | Ga0207646_10236098 | 3300025922 | Bacteria | 1652 |
| 384 | Ga0207646_10272986 | 3300025922 | Bacteria | 1528 |
| 385 | Ga0207646_10347720 | 3300025922 | Bacteria | 1340 |
| 386 | Ga0207646_10478170 | 3300025922 | Bacteria | 1123 |
| 387 | Ga0207681_10237340 | 3300025923 | Bacteria | 1418 |
| 388 | Ga0207694_10176027 | 3300025924 | Bacteria | 1734 |
| 389 | Ga0207694_10193388 | 3300025924 | Bacteria | 1653 |
| 390 | Ga0207650_10041410 | 3300025925 | Bacteria | 3375 |
| 391 | Ga0207659_10079179 | 3300025926 | Bacteria | 2424 |
| 392 | Ga0207687_10060558 | 3300025927 | Bacteria | 2671 |
| 393 | Ga0207687_10084981 | 3300025927 | Bacteria | 2295 |
| 394 | Ga0207687_10160259 | 3300025927 | Bacteria | 1726 |
| 395 | Ga0207687_10384413 | 3300025927 | Unclassified | 1151 |
| 396 | Ga0207687_10575582 | 3300025927 | Bacteria | 947 |
| 397 | Ga0207700_10000039 | 3300025928 | Bacteria | 102496 |
| 398 | Ga0207700_10033783 | 3300025928 | Bacteria | 3663 |
| 399 | Ga0207700_10158959 | 3300025928 | Bacteria | 1875 |
| 400 | Ga0207700_10187583 | 3300025928 | Bacteria | 1736 |
| 401 | Ga0207700_10310088 | 3300025928 | Bacteria | 1365 |
| 402 | Ga0207700_10418481 | 3300025928 | Bacteria | 1177 |
| 403 | Ga0207700_10439943 | 3300025928 | Bacteria | 1148 |
| 404 | Ga0207664_10011034 | 3300025929 | Bacteria | 6401 |
| 405 | Ga0207664_10018300 | 3300025929 | Bacteria | 5155 |
| 406 | Ga0207664_10022691 | 3300025929 | Bacteria | 4692 |
| 407 | Ga0207664_10040296 | 3300025929 | Bacteria | 3631 |
| 408 | Ga0207664_10044151 | 3300025929 | Bacteria | 3489 |
| 409 | Ga0207664_10049096 | 3300025929 | Bacteria | 3321 |
| 410 | Ga0207664_10064076 | 3300025929 | Bacteria | 2938 |
| 411 | Ga0207664_10072301 | 3300025929 | Bacteria | 2780 |
| 412 | Ga0207664_10075761 | 3300025929 | Bacteria | 2721 |
| 413 | Ga0207664_10107716 | 3300025929 | Bacteria | 2312 |
| 414 | Ga0207664_10109430 | 3300025929 | Bacteria | 2296 |
| 415 | Ga0207664_10132209 | 3300025929 | Bacteria | 2102 |
| 416 | Ga0207664_10146176 | 3300025929 | Bacteria | 2005 |
| 417 | Ga0207664_10258378 | 3300025929 | Bacteria | 1522 |
| 418 | Ga0207664_10311446 | 3300025929 | Bacteria | 1387 |
| 419 | Ga0207664_10352322 | 3300025929 | Bacteria | 1303 |
| 420 | Ga0207644_10037229 | 3300025931 | Bacteria | 3422 |
| 421 | Ga0207644_10385391 | 3300025931 | Bacteria | 1144 |
| 422 | Ga0207690_10167735 | 3300025932 | Bacteria | 1642 |
| 423 | Ga0207690_10191423 | 3300025932 | Bacteria | 1547 |
| 424 | Ga0207706_10044731 | 3300025933 | Bacteria | 3923 |
| 425 | Ga0207706_10048942 | 3300025933 | Bacteria | 3737 |
| 426 | Ga0207686_10004740 | 3300025934 | Bacteria | 7296 |
| 427 | Ga0207686_10148042 | 3300025934 | Bacteria | 1631 |
| 428 | Ga0207686_10296150 | 3300025934 | Unclassified | 1200 |
| 429 | Ga0207686_10350092 | 3300025934 | Bacteria | 1112 |
| 430 | Ga0207709_10001987 | 3300025935 | Bacteria | 13317 |
| 431 | Ga0207709_10041853 | 3300025935 | Bacteria | 2752 |
| 432 | Ga0207709_10056938 | 3300025935 | Bacteria | 2422 |
| 433 | Ga0207670_10005003 | 3300025936 | Bacteria | 7223 |
| 434 | Ga0207669_10325134 | 3300025937 | Bacteria | 1179 |
| 435 | Ga0207704_10068925 | 3300025938 | Bacteria | 2232 |
| 436 | Ga0207704_10086150 | 3300025938 | Archaea | 2048 |
| 437 | Ga0207665_10002358 | 3300025939 | Bacteria | 12754 |
| 438 | Ga0207665_10022233 | 3300025939 | Bacteria | 4171 |
| 439 | Ga0207665_10099705 | 3300025939 | Bacteria | 2026 |
| 440 | Ga0207691_10008985 | 3300025940 | Bacteria | 9584 |
| 441 | Ga0207691_10381473 | 3300025940 | Unclassified | 1203 |
| 442 | Ga0207711_10284281 | 3300025941 | Bacteria | 1524 |
| 443 | Ga0207711_10387493 | 3300025941 | Bacteria | 1297 |
| 444 | Ga0207711_10547669 | 3300025941 | Bacteria | 1079 |
| 445 | Ga0207661_10003288 | 3300025944 | Bacteria | 11218 |
| 446 | Ga0207661_10009282 | 3300025944 | Bacteria | 7050 |
| 447 | Ga0207661_10035675 | 3300025944 | Bacteria | 3877 |
| 448 | Ga0207661_10082038 | 3300025944 | Bacteria | 2665 |
| 449 | Ga0207661_10088182 | 3300025944 | Bacteria | 2578 |
| 450 | Ga0207661_10135236 | 3300025944 | Bacteria | 2116 |
| 451 | Ga0207661_10174694 | 3300025944 | Bacteria | 1872 |
| 452 | Ga0207661_10203334 | 3300025944 | Bacteria | 1742 |
| 453 | Ga0207661_10385319 | 3300025944 | Bacteria | 1269 |
| 454 | Ga0207661_10516806 | 3300025944 | Bacteria | 1092 |
| 455 | Ga0207679_10217655 | 3300025945 | Bacteria | 1605 |
| 456 | Ga0207679_10299986 | 3300025945 | Bacteria | 1384 |
| 457 | Ga0207667_10262907 | 3300025949 | Bacteria | 1764 |
| 458 | Ga0207651_10269474 | 3300025960 | Bacteria | 1402 |
| 459 | Ga0207640_10119282 | 3300025981 | Unclassified | 1886 |
| 460 | Ga0207640_10213080 | 3300025981 | Bacteria | 1473 |
| 461 | Ga0207640_10372966 | 3300025981 | Bacteria | 1154 |
| 462 | Ga0207658_10002326 | 3300025986 | Bacteria | 13958 |
| 463 | Ga0207658_10343087 | 3300025986 | Unclassified | 1299 |
| 464 | Ga0207677_10120632 | 3300026023 | Bacteria | 1972 |
| 465 | Ga0207677_10168895 | 3300026023 | Bacteria | 1708 |
| 466 | Ga0207677_10250418 | 3300026023 | Bacteria | 1438 |
| 467 | Ga0207677_10502275 | 3300026023 | Bacteria | 1049 |
| 468 | Ga0207703_10276464 | 3300026035 | Bacteria | 1523 |
| 469 | Ga0207639_10486147 | 3300026041 | Bacteria | 1126 |
| 470 | Ga0207678_10191318 | 3300026067 | Bacteria | 1749 |
| 471 | Ga0207708_10000400 | 3300026075 | Bacteria | 34258 |
| 472 | Ga0207708_10005578 | 3300026075 | Bacteria | 9287 |
| 473 | Ga0207708_10051886 | 3300026075 | Bacteria | 3124 |
| 474 | Ga0207702_10107873 | 3300026078 | Bacteria | 2470 |
| 475 | Ga0207702_10127857 | 3300026078 | Bacteria | 2283 |
| 476 | Ga0207702_10436663 | 3300026078 | Bacteria | 1268 |
| 477 | Ga0207702_10448545 | 3300026078 | Bacteria | 1251 |
| 478 | Ga0207702_10507763 | 3300026078 | Bacteria | 1176 |
| 479 | Ga0207641_10238689 | 3300026088 | Bacteria | 1693 |
| 480 | Ga0207648_10005898 | 3300026089 | Bacteria | 12253 |
| 481 | Ga0207648_10033391 | 3300026089 | Bacteria | 4539 |
| 482 | Ga0207648_10061990 | 3300026089 | Bacteria | 3260 |
| 483 | Ga0207648_10094073 | 3300026089 | Bacteria | 2620 |
| 484 | Ga0207676_10021755 | 3300026095 | Bacteria | 4708 |
| 485 | Ga0207676_10079799 | 3300026095 | Bacteria | 2655 |
| 486 | Ga0207674_10003276 | 3300026116 | Bacteria | 19914 |
| 487 | Ga0207674_10008281 | 3300026116 | Bacteria | 12042 |
| 488 | Ga0207674_10011757 | 3300026116 | Bacteria | 9821 |
| 489 | Ga0207674_10064147 | 3300026116 | Bacteria | 3706 |
| 490 | Ga0207675_100004495 | 3300026118 | Bacteria | 13471 |
| 491 | Ga0207675_100029762 | 3300026118 | Bacteria | 5085 |
| 492 | Ga0207675_100063876 | 3300026118 | Bacteria | 3440 |
| 493 | Ga0207675_100168285 | 3300026118 | Bacteria | 2094 |
| 494 | Ga0207683_10000864 | 3300026121 | Bacteria | 27760 |
| 495 | Ga0207683_10024235 | 3300026121 | Bacteria | 5223 |
| 496 | Ga0207683_10098964 | 3300026121 | Bacteria | 2602 |
| 497 | Ga0207683_10285260 | 3300026121 | Bacteria | 1509 |
| 498 | Ga0207683_10724199 | 3300026121 | Bacteria | 923 |
| 499 | Ga0207698_10103333 | 3300026142 | Bacteria | 2368 |
| 500 | Ga0207698_10122159 | 3300026142 | Bacteria | 2206 |
| 501 | Ga0207698_10176732 | 3300026142 | Bacteria | 1886 |
| 502 | Ga0207428_10005934 | 3300027907 | Bacteria | 11308 |
| 503 | Ga0207428_10012523 | 3300027907 | Bacteria | 7447 |
| 504 | Ga0207428_10025233 | 3300027907 | Bacteria | 4976 |
| 505 | Ga0207428_10111703 | 3300027907 | Bacteria | 2103 |
| 506 | Ga0207428_10214319 | 3300027907 | Bacteria | 1446 |
| 507 | Ga0268266_10342816 | 3300028379 | Bacteria | 1403 |
| 508 | Ga0268265_10155629 | 3300028380 | Bacteria | 1934 |
| 509 | Ga0265319_1000635 | 3300028563 | Bacteria | 23180 |
| 510 | Ga0265318_10000338 | 3300028577 | Bacteria | 37223 |
| 511 | Ga0265318_10003761 | 3300028577 | Bacteria | 7549 |
| 512 | Ga0265323_10021941 | 3300028653 | Bacteria | 2443 |
| 513 | Ga0265322_10054029 | 3300028654 | Bacteria | 1139 |
| 514 | Ga0265336_10001093 | 3300028666 | Bacteria | 13087 |
| 515 | Ga0265338_10000924 | 3300028800 | Bacteria | 49511 |
| 516 | Ga0265338_10001048 | 3300028800 | Bacteria | 46186 |
| 517 | Ga0265338_10007196 | 3300028800 | Bacteria | 13912 |
| 518 | Ga0265338_10007510 | 3300028800 | Bacteria | 13496 |
| 519 | Ga0265338_10049044 | 3300028800 | Bacteria | 3832 |
| 520 | Ga0265338_10383456 | 3300028800 | Bacteria | 1005 |
| 521 | Ga0265324_10035012 | 3300029957 | Bacteria | 1748 |
| 522 | Ga0265330_10000327 | 3300031235 | Bacteria | 34205 |
| 523 | Ga0265330_10029460 | 3300031235 | Bacteria | 2469 |
| 524 | Ga0265330_10091494 | 3300031235 | Bacteria | 1306 |
| 525 | Ga0265332_10006061 | 3300031238 | Bacteria | 5524 |
| 526 | Ga0265332_10041282 | 3300031238 | Bacteria | 1996 |
| 527 | Ga0265328_10000520 | 3300031239 | Bacteria | 17888 |
| 528 | Ga0265320_10006577 | 3300031240 | Bacteria | 7306 |
| 529 | Ga0265320_10101768 | 3300031240 | Bacteria | 1322 |
| 530 | Ga0265325_10000102 | 3300031241 | Bacteria | 59998 |
| 531 | Ga0265325_10034254 | 3300031241 | Bacteria | 2703 |
| 532 | Ga0265329_10000373 | 3300031242 | Bacteria | 23681 |
| 533 | Ga0265340_10002339 | 3300031247 | Bacteria | 10824 |
| 534 | Ga0265339_10001624 | 3300031249 | Bacteria | 16616 |
| 535 | Ga0265339_10008896 | 3300031249 | Bacteria | 6357 |
| 536 | Ga0265331_10005697 | 3300031250 | Bacteria | 7474 |
| 537 | Ga0265327_10008083 | 3300031251 | Bacteria | 7923 |
| 538 | Ga0265327_10017059 | 3300031251 | Bacteria | 4575 |
| 539 | Ga0265327_10044866 | 3300031251 | Bacteria | 2353 |
| 540 | Ga0265327_10055369 | 3300031251 | Bacteria | 2049 |
| 541 | Ga0265316_10021395 | 3300031344 | Bacteria | 5477 |
| 542 | Ga0265316_10048991 | 3300031344 | Bacteria | 3330 |
| 543 | Ga0307408_100421482 | 3300031548 | Bacteria | 1151 |
| 544 | Ga0265313_10002639 | 3300031595 | Bacteria | 15258 |
| 545 | Ga0265313_10005201 | 3300031595 | Bacteria | 9646 |
| 546 | Ga0265313_10063101 | 3300031595 | Bacteria | 1728 |
| 547 | Ga0265314_10002591 | 3300031711 | Bacteria | 18287 |
| 548 | Ga0265342_10021609 | 3300031712 | Bacteria | 4105 |
| 549 | Ga0265342_10042300 | 3300031712 | Bacteria | 2753 |
| 550 | Ga0307405_10249309 | 3300031731 | Unclassified | 1320 |
| 551 | Ga0307413_10002634 | 3300031824 | Bacteria | 7345 |
| 552 | Ga0307410_10001992 | 3300031852 | Bacteria | 9620 |
| 553 | Ga0307406_10050990 | 3300031901 | Bacteria | 2625 |
| 554 | Ga0307406_10269187 | 3300031901 | Unclassified | 1293 |
| 555 | Ga0307407_10000349 | 3300031903 | Bacteria | 13923 |
| 556 | Ga0307407_10300766 | 3300031903 | Unclassified | 1118 |
| 557 | Ga0307412_10007782 | 3300031911 | Bacteria | 6097 |
| 558 | Ga0307409_100000397 | 3300031995 | Bacteria | 18516 |
| 559 | Ga0307409_100176900 | 3300031995 | Bacteria | 1884 |
| 560 | Ga0307409_100214615 | 3300031995 | Bacteria | 1732 |
| 561 | Ga0307416_100005603 | 3300032002 | Bacteria | 7740 |
| 562 | Ga0307416_100100631 | 3300032002 | Bacteria | 2514 |
| 563 | Ga0307416_100156542 | 3300032002 | Bacteria | 2099 |
| 564 | Ga0307416_100436695 | 3300032002 | Bacteria | 1358 |
| 565 | Ga0307411_10012656 | 3300032005 | Bacteria | 4616 |
| 566 | Ga0307415_100001163 | 3300032126 | Bacteria | 12295 |
| 567 | Ga0307415_100037965 | 3300032126 | Bacteria | 3171 |
| 568 | Ga0307415_100062191 | 3300032126 | Bacteria | 2588 |
| 569 | Ga0373950_0005175 | 3300034818 | Bacteria | 1938 |
| 570 | Ga0373959_0007706 | 3300034820 | Bacteria | 1815 |
| 571 | Ga0373938_0000216 | 3300034957 | Bacteria | 8814 |
| 572 | Ga0373928_0006191 | 3300035084 | Bacteria | 2298 |
| 573 | Ga0373944_0004394 | 3300035089 | Bacteria | 3670 |
| 574 | Ga0373944_0009886 | 3300035089 | Bacteria | 2594 |
| 575 | Ga0373949_0002012 | 3300035090 | Bacteria | 5422 |
| 576 | Ga0373951_0001205 | 3300035091 | Bacteria | 6839 |
| 577 | Ga0373952_0012718 | 3300035092 | Bacteria | 1660 |
| 578 | Ga0373932_0001256 | 3300035112 | Bacteria | 7192 |
| 579 | Ga0373939_0001181 | 3300035114 | Bacteria | 6387 |
| 580 | Ga0373939_0057899 | 3300035114 | Unclassified | 1224 |
| 581 | Ga0373941_0000276 | 3300035115 | Bacteria | 9946 |
| 582 | Ga0373941_0074329 | 3300035115 | Bacteria | 1135 |
| 583 | Ga0373945_0005513 | 3300035116 | Bacteria | 4052 |
| 584 | Ga0373945_0037285 | 3300035116 | Unclassified | 1744 |
| 585 | Ga0373960_0000634 | 3300035121 | Bacteria | 7204 |
| 586 | Ga0373943_0000198 | 3300035170 | Bacteria | 24537 |
| 587 | Ga0373943_0007385 | 3300035170 | Bacteria | 4935 |
| 588 | Ga0373943_0069273 | 3300035170 | Bacteria | 1783 |
| 589 | Ga0373955_0027342 | 3300035172 | Bacteria | 2948 |
| 590 | Ga0373962_0001041 | 3300035242 | Bacteria | 6430 |
| 591 | Ga0373931_0067189 | 3300035691 | Bacteria | 1947 |
| 592 | Ga0373935_0030017 | 3300035692 | Bacteria | 3367 |
| 593 | Ga0373935_0041242 | 3300035692 | Bacteria | 2899 |
| 594 | Ga0373935_0088079 | 3300035692 | Bacteria | 2028 |
| 595 | Ga0373927_0133617 | 3300035695 | Bacteria | 1621 |
| 596 | Ga0373947_0000463 | 3300035725 | Bacteria | 23167 |
| 597 | Ga0373947_0002635 | 3300035725 | Bacteria | 10776 |
| 598 | Ga0373947_0018309 | 3300035725 | Bacteria | 4031 |
| 599 | Ga0373937_0000725 | 3300036401 | Bacteria | 28683 |
| 600 | Ga0373937_0360398 | 3300036401 | Bacteria | 1378 |
| 601 | Ga0373925_0002318 | 3300037068 | Bacteria | 15306 |
| 602 | Ga0373925_0007695 | 3300037068 | Bacteria | 7848 |
| 603 | Ga0373925_0201531 | 3300037068 | Bacteria | 1583 |
| 604 | Ga0373925_0527320 | 3300037068 | Bacteria | 971 |
| 605 | Ga0395899_0002568 | 3300037312 | Bacteria | 14676 |
| 606 | Ga0395899_0003162 | 3300037312 | Bacteria | 13077 |
| 607 | Ga0395899_0004845 | 3300037312 | Bacteria | 10480 |
| 608 | Ga0395899_0008133 | 3300037312 | Bacteria | 8079 |
| 609 | Ga0395899_0012840 | 3300037312 | Bacteria | 6415 |
| 610 | Ga0395899_0020158 | 3300037312 | Bacteria | 5059 |
| 611 | Ga0395899_0056216 | 3300037312 | Bacteria | 2909 |
| 612 | Ga0395899_0060985 | 3300037312 | Bacteria | 2778 |
| 613 | Ga0395899_0077652 | 3300037312 | Bacteria | 2421 |
| 614 | Ga0395899_0081177 | 3300037312 | Bacteria | 2360 |
| 615 | Ga0395899_0096108 | 3300037312 | Bacteria | 2143 |
| 616 | Ga0395899_0145793 | 3300037312 | Bacteria | 1681 |
| 617 | Ga0395899_0178560 | 3300037312 | Bacteria | 1492 |
| 618 | Ga0395900_0000936 | 3300037418 | Bacteria | 38235 |
| 619 | Ga0395900_0001219 | 3300037418 | Bacteria | 31689 |
| 620 | Ga0395900_0001485 | 3300037418 | Bacteria | 27947 |
| 621 | Ga0395900_0001640 | 3300037418 | Bacteria | 26256 |
| 622 | Ga0395900_0004351 | 3300037418 | Bacteria | 15029 |
| 623 | Ga0395900_0004452 | 3300037418 | Bacteria | 14842 |
| 624 | Ga0395900_0011047 | 3300037418 | Bacteria | 9228 |
| 625 | Ga0395900_0011339 | 3300037418 | Bacteria | 9119 |
| 626 | Ga0395900_0027999 | 3300037418 | Bacteria | 5770 |
| 627 | Ga0395900_0033901 | 3300037418 | Bacteria | 5254 |
| 628 | Ga0395900_0041177 | 3300037418 | Bacteria | 4763 |
| 629 | Ga0395900_0058494 | 3300037418 | Bacteria | 3968 |
| 630 | Ga0395900_0061075 | 3300037418 | Bacteria | 3876 |
| 631 | Ga0395900_0080051 | 3300037418 | Bacteria | 3357 |
| 632 | Ga0395900_0083765 | 3300037418 | Bacteria | 3276 |
| 633 | Ga0395900_0120566 | 3300037418 | Bacteria | 2691 |
| 634 | Ga0395900_0132440 | 3300037418 | Bacteria | 2554 |
| 635 | Ga0395900_0267924 | 3300037418 | Bacteria | 1704 |
| 636 | Ga0395900_0367305 | 3300037418 | Bacteria | 1409 |
| 637 | Ga0395900_0480990 | 3300037418 | Bacteria | 1194 |
| 638 | Ga0395900_0620719 | 3300037418 | Bacteria | 1020 |
| 639 | Ga0395898_0002883 | 3300037466 | Bacteria | 19614 |
| 640 | Ga0395898_0004426 | 3300037466 | Bacteria | 15372 |
| 641 | Ga0395898_0008367 | 3300037466 | Bacteria | 10937 |
| 642 | Ga0395898_0009260 | 3300037466 | Bacteria | 10357 |
| 643 | Ga0395898_0013090 | 3300037466 | Bacteria | 8553 |
| 644 | Ga0395898_0013266 | 3300037466 | Bacteria | 8487 |
| 645 | Ga0395898_0019282 | 3300037466 | Bacteria | 6944 |
| 646 | Ga0395898_0020108 | 3300037466 | Bacteria | 6783 |
| 647 | Ga0395898_0057411 | 3300037466 | Bacteria | 3793 |
| 648 | Ga0395898_0058471 | 3300037466 | Bacteria | 3753 |
| 649 | Ga0395898_0059459 | 3300037466 | Bacteria | 3718 |
| 650 | Ga0395898_0097904 | 3300037466 | Bacteria | 2816 |
| 651 | Ga0395898_0116892 | 3300037466 | Bacteria | 2555 |
| 652 | Ga0395898_0121216 | 3300037466 | Bacteria | 2506 |
| 653 | Ga0395898_0125066 | 3300037466 | Bacteria | 2463 |
| 654 | Ga0395898_0136845 | 3300037466 | Bacteria | 2345 |
| 655 | Ga0395898_0150134 | 3300037466 | Bacteria | 2230 |
| 656 | Ga0395898_0248180 | 3300037466 | Bacteria | 1698 |
| 657 | Ga0395898_0280186 | 3300037466 | Bacteria | 1590 |
| 658 | Ga0395898_0306945 | 3300037466 | Bacteria | 1513 |
| 659 | Ga0395898_0402794 | 3300037466 | Bacteria | 1304 |
| 660 | Ga0395905_0000640 | 3300037471 | Bacteria | 46768 |
| 661 | Ga0395905_0002737 | 3300037471 | Bacteria | 19288 |
| 662 | Ga0395905_0003392 | 3300037471 | Bacteria | 17054 |
| 663 | Ga0395905_0007797 | 3300037471 | Bacteria | 10619 |
| 664 | Ga0395905_0010027 | 3300037471 | Bacteria | 9235 |
| 665 | Ga0395905_0023445 | 3300037471 | Bacteria | 5831 |
| 666 | Ga0395905_0028476 | 3300037471 | Bacteria | 5267 |
| 667 | Ga0395905_0039598 | 3300037471 | Bacteria | 4422 |
| 668 | Ga0395905_0050522 | 3300037471 | Bacteria | 3895 |
| 669 | Ga0395905_0095756 | 3300037471 | Bacteria | 2786 |
| 670 | Ga0395905_0117390 | 3300037471 | Bacteria | 2500 |
| 671 | Ga0395905_0117981 | 3300037471 | Bacteria | 2494 |
| 672 | Ga0395905_0136848 | 3300037471 | Bacteria | 2305 |
| 673 | Ga0395905_0202542 | 3300037471 | Bacteria | 1860 |
| 674 | Ga0395905_0244481 | 3300037471 | Bacteria | 1676 |
| 675 | Ga0395905_0364732 | 3300037471 | Bacteria | 1337 |
| 676 | Ga0395901_0000978 | 3300038443 | Bacteria | 30977 |
| 677 | Ga0395901_0001841 | 3300038443 | Bacteria | 21913 |
| 678 | Ga0395901_0002650 | 3300038443 | Bacteria | 18087 |
| 679 | Ga0395901_0002692 | 3300038443 | Bacteria | 17910 |
| 680 | Ga0395901_0003282 | 3300038443 | Bacteria | 16280 |
| 681 | Ga0395901_0011802 | 3300038443 | Bacteria | 8859 |
| 682 | Ga0395901_0016787 | 3300038443 | Bacteria | 7460 |
| 683 | Ga0395901_0016998 | 3300038443 | Bacteria | 7414 |
| 684 | Ga0395901_0017797 | 3300038443 | Bacteria | 7251 |
| 685 | Ga0395901_0038275 | 3300038443 | Bacteria | 4961 |
| 686 | Ga0395901_0058107 | 3300038443 | Bacteria | 4023 |
| 687 | Ga0395901_0069330 | 3300038443 | Bacteria | 3672 |
| 688 | Ga0395901_0081251 | 3300038443 | Bacteria | 3385 |
| 689 | Ga0395901_0088306 | 3300038443 | Bacteria | 3242 |
| 690 | Ga0395901_0107083 | 3300038443 | Bacteria | 2934 |
| 691 | Ga0395901_0117408 | 3300038443 | Bacteria | 2795 |
| 692 | Ga0395901_0204796 | 3300038443 | Bacteria | 2067 |
| 693 | Ga0395901_0224804 | 3300038443 | Bacteria | 1961 |
| 694 | Ga0395901_0228865 | 3300038443 | Bacteria | 1941 |
| 695 | Ga0395901_0232023 | 3300038443 | Unclassified | 1926 |
| 696 | Ga0395901_0282032 | 3300038443 | Bacteria | 1726 |
| 697 | Ga0395901_0306187 | 3300038443 | Bacteria | 1647 |
| 698 | Ga0395901_0338756 | 3300038443 | Bacteria | 1554 |
| 699 | Ga0395901_0452715 | 3300038443 | Unclassified | 1312 |
| 700 | Ga0436360_0072764 | 3300039438 | Bacteria | 1325 |
| 701 | Ga0436360_0325104 | 3300039438 | Bacteria | 8312 |
| 702 | Ga0436362_0000471 | 3300039453 | Bacteria | 3860 |
| 703 | Ga0439453_0004034 | 3300041408 | Bacteria | 2159 |
| 704 | Ga0439431_0004459 | 3300041997 | Bacteria | 3079 |
| 705 | Ga0439433_0001788 | 3300041999 | Bacteria | 4469 |
| 706 | Ga0439448_0010127 | 3300042005 | Bacteria | 2788 |
| 707 | Ga0439448_0050964 | 3300042005 | Bacteria | 1355 |
| 708 | Ga0439454_013683 | 3300042011 | Bacteria | 1117 |
| 709 | Ga0439455_0052896 | 3300042012 | Bacteria | 1064 |
| 710 | Ga0439446_0009779 | 3300042156 | Bacteria | 2572 |
| 711 | Ga0439434_0026494 | 3300042435 | Bacteria | 1751 |
| 712 | Ga0466969_0003306 | 3300044656 | Bacteria | 8575 |
| 713 | Ga0466969_0027186 | 3300044656 | Bacteria | 2930 |
| 714 | Ga0466972_0036719 | 3300044658 | Bacteria | 2396 |
| 715 | Ga0466965_0023576 | 3300044683 | Bacteria | 2972 |
| 716 | Ga0466965_0091376 | 3300044683 | Bacteria | 1549 |
| 717 | Ga0466966_0008955 | 3300044684 | Bacteria | 6632 |
| 718 | Ga0466966_0039067 | 3300044684 | Bacteria | 3056 |
| 719 | Ga0466961_0016940 | 3300044693 | Bacteria | 4682 |
| 720 | Ga0466961_0043432 | 3300044693 | Bacteria | 2879 |
| 721 | Ga0466961_0061392 | 3300044693 | Bacteria | 2389 |
| 722 | Ga0466961_0136160 | 3300044693 | Bacteria | 1539 |
| 723 | Ga0466961_0185539 | 3300044693 | Bacteria | 1290 |
| 724 | Ga0466963_0000095 | 3300044694 | Bacteria | 31064 |
| 725 | Ga0466963_0000705 | 3300044694 | Bacteria | 16314 |
| 726 | Ga0466963_0000857 | 3300044694 | Bacteria | 15366 |
| 727 | Ga0466963_0008069 | 3300044694 | Bacteria | 6303 |
| 728 | Ga0466963_0009173 | 3300044694 | Bacteria | 5950 |
| 729 | Ga0466963_0011499 | 3300044694 | Bacteria | 5390 |
| 730 | Ga0466963_0014736 | 3300044694 | Bacteria | 4825 |
| 731 | Ga0466963_0018021 | 3300044694 | Bacteria | 4406 |
| 732 | Ga0466963_0023819 | 3300044694 | Bacteria | 3892 |
| 733 | Ga0466963_0028626 | 3300044694 | Bacteria | 3579 |
| 734 | Ga0466963_0030330 | 3300044694 | Bacteria | 3488 |
| 735 | Ga0466963_0037276 | 3300044694 | Bacteria | 3173 |
| 736 | Ga0466963_0042093 | 3300044694 | Bacteria | 2998 |
| 737 | Ga0466963_0078175 | 3300044694 | Bacteria | 2236 |
| 738 | Ga0466963_0083799 | 3300044694 | Bacteria | 2162 |
| 739 | Ga0466963_0163639 | 3300044694 | Bacteria | 1549 |
| 740 | Ga0466963_0207139 | 3300044694 | Bacteria | 1372 |
| 741 | Ga0466964_0001480 | 3300044706 | Bacteria | 8039 |
| 742 | Ga0466964_0001981 | 3300044706 | Bacteria | 7183 |
| 743 | Ga0466964_0007054 | 3300044706 | Bacteria | 4203 |
| 744 | Ga0466964_0024500 | 3300044706 | Bacteria | 2352 |
| 745 | Ga0466964_0025725 | 3300044706 | Bacteria | 2300 |
| 746 | Ga0466964_0128097 | 3300044706 | Bacteria | 1153 |
| 747 | Ga0466964_0130877 | 3300044706 | Bacteria | 1142 |
| 748 | Ga0466964_0131755 | 3300044706 | Bacteria | 1139 |
| 749 | Ga0466971_0003250 | 3300044719 | Bacteria | 6933 |
| 750 | Ga0466971_0015522 | 3300044719 | Bacteria | 3354 |
| 751 | Ga0466971_0020860 | 3300044719 | Bacteria | 2913 |
| 752 | Ga0466971_0042634 | 3300044719 | Bacteria | 2039 |
| 753 | Ga0466971_0042660 | 3300044719 | Bacteria | 2038 |
| 754 | Ga0466971_0219805 | 3300044719 | Bacteria | 900 |
| 755 | Ga0466968_0002238 | 3300044735 | Bacteria | 7071 |
| 756 | Ga0466968_0006491 | 3300044735 | Bacteria | 4411 |
| 757 | Ga0466968_0018435 | 3300044735 | Bacteria | 2799 |
| 758 | Ga0466968_0020838 | 3300044735 | Bacteria | 2650 |
| 759 | Ga0466968_0033912 | 3300044735 | Bacteria | 2128 |
| 760 | Ga0466968_0034595 | 3300044735 | Bacteria | 2109 |
| 761 | Ga0466968_0044769 | 3300044735 | Bacteria | 1876 |
| 762 | Ga0466968_0050752 | 3300044735 | Bacteria | 1771 |
| 763 | Ga0466968_0066253 | 3300044735 | Bacteria | 1564 |
| 764 | Ga0466970_0040086 | 3300044765 | Bacteria | 2486 |
| 765 | Ga0466970_0108568 | 3300044765 | Unclassified | 1515 |
| 766 | Ga0466957_0001672 | 3300044842 | Bacteria | 11652 |
| 767 | Ga0466957_0002974 | 3300044842 | Bacteria | 9202 |
| 768 | Ga0466957_0008669 | 3300044842 | Bacteria | 5790 |
| 769 | Ga0466957_0015929 | 3300044842 | Bacteria | 4393 |
| 770 | Ga0466957_0018921 | 3300044842 | Bacteria | 4048 |
| 771 | Ga0466957_0033943 | 3300044842 | Bacteria | 3061 |
| 772 | Ga0466957_0060142 | 3300044842 | Bacteria | 2329 |
| 773 | Ga0466957_0096331 | 3300044842 | Bacteria | 1859 |
| 774 | Ga0466957_0262522 | 3300044842 | Bacteria | 1151 |
| 775 | Ga0466957_0423275 | 3300044842 | Unclassified | 914 |
| 776 | Ga0466960_0004411 | 3300044901 | Bacteria | 5497 |
| 777 | Ga0466960_0044665 | 3300044901 | Bacteria | 2113 |
| 778 | Ga0466960_0045687 | 3300044901 | Bacteria | 2093 |
| 779 | Ga0466959_0002457 | 3300045049 | Bacteria | 11851 |
| 780 | Ga0466959_0005223 | 3300045049 | Bacteria | 8862 |
| 781 | Ga0466959_0014268 | 3300045049 | Bacteria | 5766 |
| 782 | Ga0466959_0026055 | 3300045049 | Bacteria | 4336 |
| 783 | Ga0466959_0036203 | 3300045049 | Bacteria | 3647 |
| 784 | Ga0466959_0045680 | 3300045049 | Bacteria | 3225 |
| 785 | Ga0466959_0081935 | 3300045049 | Bacteria | 2325 |
| 786 | Ga0451576_0052216 | 3300045051 | Bacteria | 4284 |
| 787 | Ga0466958_0002667 | 3300045836 | Bacteria | 9029 |
| 788 | Ga0466958_0004618 | 3300045836 | Bacteria | 7298 |
| 789 | Ga0466958_0007167 | 3300045836 | Bacteria | 6113 |
| 790 | Ga0466958_0009418 | 3300045836 | Bacteria | 5443 |
| 791 | Ga0466958_0013118 | 3300045836 | Bacteria | 4711 |
| 792 | Ga0466958_0041087 | 3300045836 | Bacteria | 2781 |
| 793 | Ga0466958_0042172 | 3300045836 | Bacteria | 2747 |
| 794 | Ga0466958_0077821 | 3300045836 | Bacteria | 2037 |
| 795 | Ga0466958_0086108 | 3300045836 | Bacteria | 1939 |
| 796 | Ga0466958_0102836 | 3300045836 | Bacteria | 1778 |
| 797 | Ga0466958_0185700 | 3300045836 | Bacteria | 1320 |
| 798 | Ga0466958_0245978 | 3300045836 | Bacteria | 1143 |
| 799 | Ga0466967_0002678 | 3300045976 | Bacteria | 11240 |
| 800 | Ga0466967_0008051 | 3300045976 | Bacteria | 7683 |
| 801 | Ga0466967_0015896 | 3300045976 | Bacteria | 5915 |
| 802 | Ga0466967_0020790 | 3300045976 | Bacteria | 5316 |
| 803 | Ga0466967_0025255 | 3300045976 | Bacteria | 4897 |
| 804 | Ga0466967_0028485 | 3300045976 | Bacteria | 4662 |
| 805 | Ga0466967_0029109 | 3300045976 | Bacteria | 4619 |
| 806 | Ga0466967_0037568 | 3300045976 | Bacteria | 4145 |
| 807 | Ga0466967_0043946 | 3300045976 | Bacteria | 3871 |
| 808 | Ga0466967_0056030 | 3300045976 | Bacteria | 3474 |
| 809 | Ga0466967_0056885 | 3300045976 | Bacteria | 3450 |
| 810 | Ga0466967_0063628 | 3300045976 | Bacteria | 3278 |
| 811 | Ga0466967_0080325 | 3300045976 | Bacteria | 2942 |
| 812 | Ga0466967_0098860 | 3300045976 | Bacteria | 2664 |
| 813 | Ga0466967_0102239 | 3300045976 | Bacteria | 2621 |
| 814 | Ga0466967_0116645 | 3300045976 | Bacteria | 2460 |
| 815 | Ga0466967_0123887 | 3300045976 | Bacteria | 2392 |
| 816 | Ga0466967_0140917 | 3300045976 | Bacteria | 2246 |
| 817 | Ga0466967_0157618 | 3300045976 | Bacteria | 2128 |
| 818 | Ga0466967_0188657 | 3300045976 | Bacteria | 1947 |
| 819 | Ga0466967_0212175 | 3300045976 | Bacteria | 1836 |
| 820 | Ga0466967_0218654 | 3300045976 | Bacteria | 1809 |
| 821 | Ga0466967_0218956 | 3300045976 | Bacteria | 1808 |
| 822 | Ga0466967_0414494 | 3300045976 | Bacteria | 1312 |
| 823 | Ga0466967_0594491 | 3300045976 | Bacteria | 1092 |
| 824 | Ga0466967_0755032 | 3300045976 | Unclassified | 965 |
| 825 | Ga0495617_066573 | 3300046452 | Bacteria | 1187 |
| 826 | Ga0495592_0000050 | 3300046454 | Bacteria | 111971 |
| 827 | Ga0495592_0012008 | 3300046454 | Bacteria | 6564 |
| 828 | Ga0495592_0027375 | 3300046454 | Bacteria | 4322 |
| 829 | Ga0495603_0000081 | 3300046455 | Bacteria | 42501 |
| 830 | Ga0495603_0005193 | 3300046455 | Bacteria | 7776 |
| 831 | Ga0495603_0016668 | 3300046455 | Bacteria | 4445 |
| 832 | Ga0495603_0022206 | 3300046455 | Bacteria | 3843 |
| 833 | Ga0495629_0005211 | 3300046459 | Bacteria | 9734 |
| 834 | Ga0495629_0154036 | 3300046459 | Bacteria | 1597 |
| 835 | Ga0495641_0002133 | 3300046461 | Bacteria | 15953 |
| 836 | Ga0495641_0005435 | 3300046461 | Bacteria | 8615 |
| 837 | Ga0495651_0000028 | 3300046462 | Bacteria | 105473 |
| 838 | Ga0495653_0005030 | 3300046463 | Bacteria | 10729 |
| 839 | Ga0495653_0144677 | 3300046463 | Bacteria | 1668 |
| 840 | Ga0495653_0168998 | 3300046463 | Bacteria | 1511 |
| 841 | Ga0495653_0220685 | 3300046463 | Bacteria | 1274 |
| 842 | Ga0495580_0013968 | 3300046472 | Bacteria | 6109 |
| 843 | Ga0495580_0035292 | 3300046472 | Bacteria | 3596 |
| 844 | Ga0495580_0286149 | 3300046472 | Bacteria | 1124 |
| 845 | Ga0495582_0023069 | 3300046473 | Bacteria | 3404 |
| 846 | Ga0495582_0027338 | 3300046473 | Bacteria | 3126 |
| 847 | Ga0495582_0041322 | 3300046473 | Bacteria | 2540 |
| 848 | Ga0495582_0067921 | 3300046473 | Bacteria | 1970 |
| 849 | Ga0495605_0099798 | 3300046474 | Bacteria | 1336 |
| 850 | Ga0495605_0101760 | 3300046474 | Bacteria | 1320 |
| 851 | Ga0495639_0026021 | 3300046475 | Bacteria | 2583 |
| 852 | Ga0495662_0030188 | 3300046476 | Bacteria | 2616 |
| 853 | Ga0495664_0038850 | 3300046477 | Bacteria | 2810 |
| 854 | Ga0495664_0206601 | 3300046477 | Bacteria | 1190 |
| 855 | Ga0495584_0010750 | 3300046491 | Bacteria | 4701 |
| 856 | Ga0495594_0000536 | 3300046499 | Bacteria | 19443 |
| 857 | Ga0495596_0024479 | 3300046500 | Bacteria | 2443 |
| 858 | Ga0495607_0032668 | 3300046501 | Bacteria | 3174 |
| 859 | Ga0495608_0000555 | 3300046511 | Bacteria | 25761 |
| 860 | Ga0495608_0006235 | 3300046511 | Bacteria | 8464 |
| 861 | Ga0495608_0292274 | 3300046511 | Bacteria | 1010 |
| 862 | Ga0495618_0011013 | 3300046514 | Bacteria | 5481 |
| 863 | Ga0495618_0015268 | 3300046514 | Bacteria | 4686 |
| 864 | Ga0495628_0000060 | 3300046516 | Bacteria | 87173 |
| 865 | Ga0495628_0030989 | 3300046516 | Bacteria | 4326 |
| 866 | Ga0495628_0217609 | 3300046516 | Bacteria | 1435 |
| 867 | Ga0495628_0271208 | 3300046516 | Bacteria | 1262 |
| 868 | Ga0495630_0004280 | 3300046517 | Bacteria | 10013 |
| 869 | Ga0495630_0011832 | 3300046517 | Bacteria | 6323 |
| 870 | Ga0495630_0043614 | 3300046517 | Bacteria | 3351 |
| 871 | Ga0495630_0124813 | 3300046517 | Bacteria | 1953 |
| 872 | Ga0495630_0127901 | 3300046517 | Bacteria | 1928 |
| 873 | Ga0495663_0008292 | 3300046525 | Bacteria | 2877 |
| 874 | Ga0495663_0063146 | 3300046525 | Bacteria | 1167 |
| 875 | Ga0495666_0026341 | 3300046526 | Bacteria | 2867 |
| 876 | Ga0495666_0164870 | 3300046526 | Bacteria | 1026 |
| 877 | Ga0495652_0000969 | 3300046529 | Bacteria | 32863 |
| 878 | Ga0495652_0020746 | 3300046529 | Bacteria | 5841 |
| 879 | Ga0495652_0032336 | 3300046529 | Bacteria | 4576 |
| 880 | Ga0495652_0034234 | 3300046529 | Bacteria | 4428 |
| 881 | Ga0495652_0052975 | 3300046529 | Bacteria | 3459 |
| 882 | Ga0495652_0276735 | 3300046529 | Bacteria | 1231 |
| 883 | Ga0495652_0314676 | 3300046529 | Bacteria | 1133 |
| 884 | Ga0495665_0004858 | 3300046531 | Bacteria | 7249 |
| 885 | Ga0495665_0167412 | 3300046531 | Bacteria | 1145 |
| 886 | Ga0495586_0000939 | 3300046535 | Bacteria | 16532 |
| 887 | Ga0495587_0000062 | 3300046536 | Bacteria | 91862 |
| 888 | Ga0495609_0117563 | 3300046538 | Bacteria | 1145 |
| 889 | Ga0495645_0000207 | 3300046543 | Bacteria | 42086 |
| 890 | Ga0495622_0051305 | 3300046557 | Bacteria | 1914 |
| 891 | Ga0495667_0029836 | 3300046559 | Bacteria | 3669 |
| 892 | Ga0495667_0112698 | 3300046559 | Bacteria | 1758 |
| 893 | Ga0495667_0265183 | 3300046559 | Bacteria | 1092 |
| 894 | Ga0495656_0003250 | 3300046615 | Bacteria | 5481 |
| 895 | Ga0495656_0072527 | 3300046615 | Unclassified | 1533 |
| 896 | Ga0495656_0116517 | 3300046615 | Bacteria | 1256 |
| 897 | Ga0495634_0028969 | 3300046642 | Bacteria | 3838 |
| 898 | Ga0495634_0057539 | 3300046642 | Bacteria | 2594 |
| 899 | Ga0495634_0168833 | 3300046642 | Bacteria | 1376 |
| 900 | Ga0495611_0023526 | 3300046648 | Bacteria | 2675 |
| 901 | Ga0495611_0083262 | 3300046648 | Bacteria | 1473 |
| 902 | Ga0495635_0011900 | 3300046663 | Bacteria | 6097 |
| 903 | Ga0495635_0029948 | 3300046663 | Bacteria | 3784 |
| 904 | Ga0495635_0042176 | 3300046663 | Bacteria | 3151 |
| 905 | Ga0495659_0014611 | 3300046664 | Bacteria | 2572 |
| 906 | Ga0495588_0001728 | 3300046674 | Bacteria | 9298 |
| 907 | Ga0495588_0150921 | 3300046674 | Bacteria | 1228 |
| 908 | Ga0495657_0080872 | 3300046675 | Bacteria | 2102 |
| 909 | Ga0495657_0114462 | 3300046675 | Bacteria | 1705 |
| 910 | Ga0495657_0190957 | 3300046675 | Bacteria | 1252 |
| 911 | Ga0495599_0000202 | 3300046678 | Bacteria | 39562 |
| 912 | Ga0495599_0008974 | 3300046678 | Bacteria | 6091 |
| 913 | Ga0495599_0058776 | 3300046678 | Bacteria | 2405 |
| 914 | Ga0495599_0103106 | 3300046678 | Bacteria | 1778 |
| 915 | Ga0495623_0000230 | 3300046679 | Bacteria | 35964 |
| 916 | Ga0495646_0002084 | 3300046680 | Bacteria | 12124 |
| 917 | Ga0495646_0045703 | 3300046680 | Bacteria | 2673 |
| 918 | Ga0495646_0104200 | 3300046680 | Bacteria | 1622 |
| 919 | Ga0495647_0004336 | 3300046681 | Bacteria | 4600 |
| 920 | Ga0495647_0077696 | 3300046681 | Bacteria | 1340 |
| 921 | Ga0495658_0035274 | 3300046683 | Bacteria | 2751 |
| 922 | Ga0495658_0154427 | 3300046683 | Bacteria | 1412 |
| 923 | Ga0495613_0010552 | 3300046689 | Bacteria | 6856 |
| 924 | Ga0495613_0051296 | 3300046689 | Bacteria | 3040 |
| 925 | Ga0495613_0087671 | 3300046689 | Bacteria | 2256 |
| 926 | Ga0495624_0057267 | 3300046690 | Bacteria | 2450 |
| 927 | Ga0495670_0028098 | 3300046691 | Bacteria | 2788 |
| 928 | Ga0495671_0184627 | 3300046692 | Unclassified | 1013 |
| 929 | Ga0495589_0038852 | 3300046794 | Bacteria | 2381 |
| 930 | Ga0495600_0084751 | 3300046809 | Bacteria | 2068 |
| 931 | Ga0495600_0116039 | 3300046809 | Bacteria | 1743 |
| 932 | Ga0495604_0000262 | 3300047317 | Bacteria | 46873 |
| 933 | Ga0495604_0064035 | 3300047317 | Bacteria | 2803 |
| 934 | Ga0495636_0038751 | 3300047318 | Bacteria | 1973 |
| 935 | Ga0495674_0021386 | 3300047319 | Bacteria | 5984 |
| 936 | Ga0495674_0250500 | 3300047319 | Bacteria | 1457 |
| 937 | Ga0495674_0252040 | 3300047319 | Bacteria | 1452 |
| 938 | Ga0495676_0043187 | 3300047321 | Bacteria | 3693 |
| 939 | Ga0495676_0070438 | 3300047321 | Bacteria | 2693 |
| 940 | Ga0495676_0140485 | 3300047321 | Bacteria | 1731 |
| 941 | Ga0495680_0005532 | 3300047322 | Bacteria | 11858 |
| 942 | Ga0495680_0018905 | 3300047322 | Bacteria | 5834 |
| 943 | Ga0495680_0040961 | 3300047322 | Bacteria | 3686 |
| 944 | Ga0495680_0042745 | 3300047322 | Bacteria | 3593 |
| 945 | Ga0495680_0077775 | 3300047322 | Bacteria | 2512 |
| 946 | Ga0495680_0390897 | 3300047322 | Bacteria | 962 |
| 947 | Ga0495675_0000020 | 3300047444 | Bacteria | 111526 |
| 948 | Ga0495675_0108079 | 3300047444 | Bacteria | 1738 |
| 949 | Ga0495677_0032216 | 3300047445 | Bacteria | 1909 |
| 950 | Ga0495684_0004528 | 3300047471 | Bacteria | 10857 |
| 951 | Ga0495684_0053036 | 3300047471 | Bacteria | 3094 |
| 952 | Ga0495593_0004729 | 3300047673 | Bacteria | 8093 |
| 953 | Ga0495602_0000222 | 3300048088 | Bacteria | 53050 |
| 954 | Ga0495602_0053966 | 3300048088 | Bacteria | 3553 |
| 955 | Ga0495614_0097223 | 3300048089 | Bacteria | 1284 |
| 956 | Ga0495615_0031329 | 3300048090 | Bacteria | 1275 |
| 957 | Ga0495626_0102451 | 3300048091 | Bacteria | 1247 |
| 958 | Ga0496100_0002502 | 3300048903 | Bacteria | 9352 |
| 959 | Ga0496100_0006709 | 3300048903 | Bacteria | 6301 |
| 960 | Ga0496100_0006766 | 3300048903 | Bacteria | 6277 |
| 961 | Ga0496100_0008560 | 3300048903 | Bacteria | 5709 |
| 962 | Ga0496100_0009080 | 3300048903 | Bacteria | 5573 |
| 963 | Ga0496100_0043658 | 3300048903 | Bacteria | 2868 |
| 964 | Ga0496100_0070830 | 3300048903 | Bacteria | 2326 |
| 965 | Ga0496100_0342833 | 3300048903 | Bacteria | 1127 |
| 966 | Ga0496101_0001024 | 3300048904 | Bacteria | 16471 |
| 967 | Ga0496101_0016140 | 3300048904 | Bacteria | 5043 |
| 968 | Ga0496101_0025351 | 3300048904 | Bacteria | 4114 |
| 969 | Ga0496101_0028829 | 3300048904 | Bacteria | 3879 |
| 970 | Ga0496101_0064970 | 3300048904 | Bacteria | 2659 |
| 971 | Ga0496101_0072660 | 3300048904 | Bacteria | 2525 |
| 972 | Ga0496101_0102414 | 3300048904 | Bacteria | 2144 |
| 973 | Ga0496101_0116271 | 3300048904 | Bacteria | 2018 |
| 974 | Ga0496101_0125688 | 3300048904 | Bacteria | 1943 |
| 975 | Ga0496101_0167865 | 3300048904 | Bacteria | 1685 |
| 976 | Ga0496102_0004970 | 3300048905 | Bacteria | 11260 |
| 977 | Ga0496102_0013068 | 3300048905 | Bacteria | 7189 |
| 978 | Ga0496102_0022488 | 3300048905 | Bacteria | 5587 |
| 979 | Ga0496102_0025477 | 3300048905 | Bacteria | 5266 |
| 980 | Ga0496102_0036175 | 3300048905 | Bacteria | 4447 |
| 981 | Ga0496102_0043978 | 3300048905 | Bacteria | 4051 |
| 982 | Ga0496102_0046559 | 3300048905 | Bacteria | 3939 |
| 983 | Ga0496102_0061013 | 3300048905 | Bacteria | 3450 |
| 984 | Ga0496102_0063252 | 3300048905 | Bacteria | 3388 |
| 985 | Ga0496102_0094431 | 3300048905 | Bacteria | 2771 |
| 986 | Ga0496102_0121116 | 3300048905 | Bacteria | 2443 |
| 987 | Ga0496102_0196366 | 3300048905 | Unclassified | 1902 |
| 988 | Ga0496102_0225966 | 3300048905 | Bacteria | 1765 |
| 989 | Ga0496102_0231194 | 3300048905 | Bacteria | 1743 |
| 990 | Ga0496102_0262065 | 3300048905 | Bacteria | 1630 |
| 991 | Ga0496102_0450957 | 3300048905 | Bacteria | 1207 |
| 992 | Ga0496102_0501087 | 3300048905 | Bacteria | 1136 |
| 993 | Ga0496103_0004988 | 3300048906 | Bacteria | 8006 |
| 994 | Ga0496103_0009793 | 3300048906 | Bacteria | 5674 |
| 995 | Ga0496103_0019236 | 3300048906 | Bacteria | 4100 |
| 996 | Ga0496103_0021946 | 3300048906 | Bacteria | 3843 |
| 997 | Ga0496103_0083990 | 3300048906 | Bacteria | 2005 |
| 998 | Ga0496103_0105641 | 3300048906 | Bacteria | 1785 |
| 999 | Ga0496103_0174562 | 3300048906 | Bacteria | 1381 |
| 1000 | Ga0496103_0267710 | 3300048906 | Bacteria | 1099 |
| 1001 | Ga0496104_0000332 | 3300048907 | Bacteria | 42258 |
| 1002 | Ga0496104_0000865 | 3300048907 | Bacteria | 26083 |
| 1003 | Ga0496104_0002338 | 3300048907 | Bacteria | 16381 |
| 1004 | Ga0496104_0004406 | 3300048907 | Bacteria | 12261 |
| 1005 | Ga0496104_0008182 | 3300048907 | Bacteria | 9286 |
| 1006 | Ga0496104_0008226 | 3300048907 | Bacteria | 9261 |
| 1007 | Ga0496104_0010957 | 3300048907 | Bacteria | 8112 |
| 1008 | Ga0496104_0016855 | 3300048907 | Bacteria | 6642 |
| 1009 | Ga0496104_0022478 | 3300048907 | Bacteria | 5794 |
| 1010 | Ga0496104_0054582 | 3300048907 | Bacteria | 3777 |
| 1011 | Ga0496104_0075027 | 3300048907 | Bacteria | 3220 |
| 1012 | Ga0496104_0088948 | 3300048907 | Bacteria | 2950 |
| 1013 | Ga0496104_0139359 | 3300048907 | Bacteria | 2331 |
| 1014 | Ga0496104_0150024 | 3300048907 | Bacteria | 2238 |
| 1015 | Ga0496104_0152100 | 3300048907 | Bacteria | 2221 |
| 1016 | Ga0496104_0173096 | 3300048907 | Bacteria | 2069 |
| 1017 | Ga0496104_0229696 | 3300048907 | Bacteria | 1767 |
| 1018 | Ga0496104_0446068 | 3300048907 | Bacteria | 1206 |
| 1019 | Ga0496104_0449124 | 3300048907 | Bacteria | 1201 |
| 1020 | Ga0496104_0532983 | 3300048907 | Bacteria | 1085 |
| 1021 | Ga0496105_0000775 | 3300048908 | Bacteria | 21608 |
| 1022 | Ga0496105_0001042 | 3300048908 | Bacteria | 19175 |
| 1023 | Ga0496105_0004368 | 3300048908 | Bacteria | 10647 |
| 1024 | Ga0496105_0005606 | 3300048908 | Bacteria | 9546 |
| 1025 | Ga0496105_0007386 | 3300048908 | Bacteria | 8508 |
| 1026 | Ga0496105_0008547 | 3300048908 | Bacteria | 7954 |
| 1027 | Ga0496105_0010597 | 3300048908 | Bacteria | 7253 |
| 1028 | Ga0496105_0027093 | 3300048908 | Bacteria | 4679 |
| 1029 | Ga0496105_0097710 | 3300048908 | Bacteria | 2425 |
| 1030 | Ga0496105_0187969 | 3300048908 | Bacteria | 1690 |
| 1031 | Ga0496105_0491751 | 3300048908 | Bacteria | 964 |
| 1032 | Ga0496106_0013216 | 3300048909 | Bacteria | 6092 |
| 1033 | Ga0496106_0016169 | 3300048909 | Bacteria | 5518 |
| 1034 | Ga0496106_0025657 | 3300048909 | Bacteria | 4387 |
| 1035 | Ga0496106_0057285 | 3300048909 | Bacteria | 2947 |
| 1036 | Ga0496106_0058700 | 3300048909 | Bacteria | 2913 |
| 1037 | Ga0496106_0076878 | 3300048909 | Bacteria | 2559 |
| 1038 | Ga0496106_0093840 | 3300048909 | Bacteria | 2319 |
| 1039 | Ga0496106_0176575 | 3300048909 | Bacteria | 1694 |
| 1040 | Ga0496106_0429062 | 3300048909 | Bacteria | 1062 |
| 1041 | Ga0496106_0583175 | 3300048909 | Bacteria | 896 |
| 1042 | Ga0496107_0000242 | 3300048910 | Bacteria | 28631 |
| 1043 | Ga0496107_0000832 | 3300048910 | Bacteria | 18003 |
| 1044 | Ga0496107_0001734 | 3300048910 | Bacteria | 13705 |
| 1045 | Ga0496107_0002291 | 3300048910 | Bacteria | 12358 |
| 1046 | Ga0496107_0004829 | 3300048910 | Bacteria | 9150 |
| 1047 | Ga0496107_0019833 | 3300048910 | Bacteria | 4747 |
| 1048 | Ga0496107_0051303 | 3300048910 | Bacteria | 2975 |
| 1049 | Ga0496107_0058503 | 3300048910 | Bacteria | 2787 |
| 1050 | Ga0496107_0080130 | 3300048910 | Bacteria | 2381 |
| 1051 | Ga0496107_0135016 | 3300048910 | Bacteria | 1823 |
| 1052 | Ga0496107_0141145 | 3300048910 | Bacteria | 1780 |
| 1053 | Ga0496107_0216437 | 3300048910 | Bacteria | 1425 |
| 1054 | Ga0496107_0241920 | 3300048910 | Bacteria | 1343 |
| 1055 | Ga0496107_0274605 | 3300048910 | Bacteria | 1254 |
| 1056 | Ga0496107_0396224 | 3300048910 | Bacteria | 1027 |
| 1057 | Ga0496108_0001121 | 3300048911 | Bacteria | 20955 |
| 1058 | Ga0496108_0001279 | 3300048911 | Bacteria | 19702 |
| 1059 | Ga0496108_0004022 | 3300048911 | Bacteria | 11798 |
| 1060 | Ga0496108_0005178 | 3300048911 | Bacteria | 10538 |
| 1061 | Ga0496108_0008931 | 3300048911 | Bacteria | 8122 |
| 1062 | Ga0496108_0018106 | 3300048911 | Bacteria | 5763 |
| 1063 | Ga0496108_0027191 | 3300048911 | Bacteria | 4721 |
| 1064 | Ga0496108_0028356 | 3300048911 | Bacteria | 4631 |
| 1065 | Ga0496108_0035181 | 3300048911 | Bacteria | 4163 |
| 1066 | Ga0496108_0068334 | 3300048911 | Bacteria | 2998 |
| 1067 | Ga0496108_0122086 | 3300048911 | Bacteria | 2235 |
| 1068 | Ga0496108_0229553 | 3300048911 | Bacteria | 1614 |
| 1069 | Ga0496108_0477317 | 3300048911 | Bacteria | 1089 |
| 1070 | Ga0496109_0000288 | 3300048912 | Bacteria | 47831 |
| 1071 | Ga0496109_0000534 | 3300048912 | Bacteria | 32226 |
| 1072 | Ga0496109_0001211 | 3300048912 | Bacteria | 21471 |
| 1073 | Ga0496109_0001239 | 3300048912 | Bacteria | 21163 |
| 1074 | Ga0496109_0001399 | 3300048912 | Bacteria | 19990 |
| 1075 | Ga0496109_0001931 | 3300048912 | Bacteria | 17224 |
| 1076 | Ga0496109_0009621 | 3300048912 | Bacteria | 8243 |
| 1077 | Ga0496109_0010449 | 3300048912 | Bacteria | 7931 |
| 1078 | Ga0496109_0018533 | 3300048912 | Bacteria | 6114 |
| 1079 | Ga0496109_0032272 | 3300048912 | Bacteria | 4707 |
| 1080 | Ga0496109_0043230 | 3300048912 | Bacteria | 4084 |
| 1081 | Ga0496109_0046067 | 3300048912 | Bacteria | 3959 |
| 1082 | Ga0496109_0053327 | 3300048912 | Bacteria | 3687 |
| 1083 | Ga0496109_0074982 | 3300048912 | Bacteria | 3110 |
| 1084 | Ga0496109_0118101 | 3300048912 | Bacteria | 2469 |
| 1085 | Ga0496109_0132805 | 3300048912 | Bacteria | 2324 |
| 1086 | Ga0496109_0191934 | 3300048912 | Bacteria | 1920 |
| 1087 | Ga0496109_0199773 | 3300048912 | Bacteria | 1879 |
| 1088 | Ga0496109_0208587 | 3300048912 | Bacteria | 1837 |
| 1089 | Ga0496109_0478094 | 3300048912 | Bacteria | 1176 |
| 1090 | Ga0496110_0000069 | 3300048913 | Bacteria | 51597 |
| 1091 | Ga0496110_0000769 | 3300048913 | Bacteria | 22239 |
| 1092 | Ga0496110_0000979 | 3300048913 | Bacteria | 20042 |
| 1093 | Ga0496110_0009023 | 3300048913 | Bacteria | 8047 |
| 1094 | Ga0496110_0010243 | 3300048913 | Bacteria | 7615 |
| 1095 | Ga0496110_0018239 | 3300048913 | Bacteria | 5881 |
| 1096 | Ga0496110_0020040 | 3300048913 | Bacteria | 5639 |
| 1097 | Ga0496110_0029541 | 3300048913 | Bacteria | 4719 |
| 1098 | Ga0496110_0035052 | 3300048913 | Bacteria | 4351 |
| 1099 | Ga0496110_0052227 | 3300048913 | Bacteria | 3592 |
| 1100 | Ga0496110_0069790 | 3300048913 | Bacteria | 3112 |
| 1101 | Ga0496110_0147469 | 3300048913 | Bacteria | 2129 |
| 1102 | Ga0496110_0150910 | 3300048913 | Bacteria | 2104 |
| 1103 | Ga0496110_0161352 | 3300048913 | Bacteria | 2032 |
| 1104 | Ga0496110_0183011 | 3300048913 | Bacteria | 1903 |
| 1105 | Ga0496110_0229563 | 3300048913 | Bacteria | 1688 |
| 1106 | Ga0496110_0257007 | 3300048913 | Bacteria | 1590 |
| 1107 | Ga0496110_0259524 | 3300048913 | Unclassified | 1581 |
| 1108 | Ga0496111_0000081 | 3300048914 | Bacteria | 39898 |
| 1109 | Ga0496111_0000204 | 3300048914 | Bacteria | 27767 |
| 1110 | Ga0496111_0001570 | 3300048914 | Bacteria | 13189 |
| 1111 | Ga0496111_0001689 | 3300048914 | Bacteria | 12867 |
| 1112 | Ga0496111_0003145 | 3300048914 | Bacteria | 10157 |
| 1113 | Ga0496111_0008085 | 3300048914 | Bacteria | 6945 |
| 1114 | Ga0496111_0017500 | 3300048914 | Bacteria | 4956 |
| 1115 | Ga0496111_0037818 | 3300048914 | Bacteria | 3455 |
| 1116 | Ga0496111_0061023 | 3300048914 | Bacteria | 2733 |
| 1117 | Ga0496111_0083224 | 3300048914 | Bacteria | 2338 |
| 1118 | Ga0496111_0085808 | 3300048914 | Bacteria | 2302 |
| 1119 | Ga0496111_0103382 | 3300048914 | Bacteria | 2095 |
| 1120 | Ga0496111_0142501 | 3300048914 | Bacteria | 1776 |
| 1121 | Ga0496111_0165467 | 3300048914 | Bacteria | 1642 |
| 1122 | Ga0496111_0167914 | 3300048914 | Bacteria | 1630 |
| 1123 | Ga0496111_0209459 | 3300048914 | Bacteria | 1448 |
| 1124 | Ga0496111_0238568 | 3300048914 | Bacteria | 1350 |
| 1125 | Ga0496111_0244438 | 3300048914 | Bacteria | 1333 |
| 1126 | Ga0496111_0246835 | 3300048914 | Bacteria | 1325 |
| 1127 | Ga0496111_0304007 | 3300048914 | Bacteria | 1182 |
| 1128 | Ga0496112_0000635 | 3300048915 | Bacteria | 24368 |
| 1129 | Ga0496112_0000670 | 3300048915 | Bacteria | 23864 |
| 1130 | Ga0496112_0001619 | 3300048915 | Bacteria | 17429 |
| 1131 | Ga0496112_0001889 | 3300048915 | Bacteria | 16523 |
| 1132 | Ga0496112_0003082 | 3300048915 | Bacteria | 13654 |
| 1133 | Ga0496112_0003473 | 3300048915 | Bacteria | 13038 |
| 1134 | Ga0496112_0003845 | 3300048915 | Bacteria | 12539 |
| 1135 | Ga0496112_0013900 | 3300048915 | Bacteria | 7448 |
| 1136 | Ga0496112_0036622 | 3300048915 | Bacteria | 4787 |
| 1137 | Ga0496112_0040719 | 3300048915 | Bacteria | 4543 |
| 1138 | Ga0496112_0040922 | 3300048915 | Bacteria | 4533 |
| 1139 | Ga0496112_0046708 | 3300048915 | Bacteria | 4248 |
| 1140 | Ga0496112_0069059 | 3300048915 | Bacteria | 3490 |
| 1141 | Ga0496112_0082681 | 3300048915 | Bacteria | 3175 |
| 1142 | Ga0496112_0113463 | 3300048915 | Bacteria | 2681 |
| 1143 | Ga0496112_0206666 | 3300048915 | Bacteria | 1921 |
| 1144 | Ga0496112_0490534 | 3300048915 | Bacteria | 1164 |
| 1145 | Ga0496112_0610800 | 3300048915 | Bacteria | 1022 |
| 1146 | Ga0496113_0036439 | 3300048916 | Bacteria | 3604 |
| 1147 | Ga0496113_0037069 | 3300048916 | Bacteria | 3576 |
| 1148 | Ga0496113_0040146 | 3300048916 | Bacteria | 3447 |
| 1149 | Ga0496113_0042126 | 3300048916 | Bacteria | 3372 |
| 1150 | Ga0496113_0055242 | 3300048916 | Bacteria | 2976 |
| 1151 | Ga0496113_0077332 | 3300048916 | Bacteria | 2544 |
| 1152 | Ga0496113_0081454 | 3300048916 | Bacteria | 2481 |
| 1153 | Ga0496113_0097482 | 3300048916 | Bacteria | 2275 |
| 1154 | Ga0496113_0153473 | 3300048916 | Bacteria | 1818 |
| 1155 | Ga0496113_0279582 | 3300048916 | Bacteria | 1334 |
| 1156 | Ga0496113_0370089 | 3300048916 | Bacteria | 1150 |
| 1157 | Ga0496113_0372603 | 3300048916 | Unclassified | 1146 |
| 1158 | Ga0496113_0424973 | 3300048916 | Bacteria | 1067 |
| 1159 | Ga0496114_0000892 | 3300048917 | Bacteria | 22279 |
| 1160 | Ga0496114_0002615 | 3300048917 | Bacteria | 13736 |
| 1161 | Ga0496114_0003773 | 3300048917 | Bacteria | 11681 |
| 1162 | Ga0496114_0008778 | 3300048917 | Bacteria | 8008 |
| 1163 | Ga0496114_0009938 | 3300048917 | Bacteria | 7562 |
| 1164 | Ga0496114_0017227 | 3300048917 | Bacteria | 5829 |
| 1165 | Ga0496114_0026677 | 3300048917 | Bacteria | 4731 |
| 1166 | Ga0496114_0032949 | 3300048917 | Bacteria | 4267 |
| 1167 | Ga0496114_0045010 | 3300048917 | Bacteria | 3664 |
| 1168 | Ga0496114_0047790 | 3300048917 | Bacteria | 3559 |
| 1169 | Ga0496114_0072617 | 3300048917 | Bacteria | 2894 |
| 1170 | Ga0496114_0080691 | 3300048917 | Bacteria | 2747 |
| 1171 | Ga0496114_0248391 | 3300048917 | Bacteria | 1565 |
| 1172 | Ga0496114_0267765 | 3300048917 | Bacteria | 1505 |
| 1173 | Ga0496114_0284462 | 3300048917 | Bacteria | 1458 |
| 1174 | Ga0496115_0000701 | 3300048918 | Bacteria | 24832 |
| 1175 | Ga0496115_0002745 | 3300048918 | Bacteria | 12643 |
| 1176 | Ga0496115_0005064 | 3300048918 | Bacteria | 9582 |
| 1177 | Ga0496115_0013798 | 3300048918 | Bacteria | 6118 |
| 1178 | Ga0496115_0033855 | 3300048918 | Bacteria | 4036 |
| 1179 | Ga0496115_0059075 | 3300048918 | Bacteria | 3087 |
| 1180 | Ga0496115_0095223 | 3300048918 | Bacteria | 2437 |
| 1181 | Ga0496115_0162000 | 3300048918 | Bacteria | 1849 |
| 1182 | Ga0496115_0182909 | 3300048918 | Bacteria | 1732 |
| 1183 | Ga0496115_0320269 | 3300048918 | Bacteria | 1268 |
| 1184 | Ga0496115_0338337 | 3300048918 | Bacteria | 1229 |
| 1185 | Ga0496115_0354123 | 3300048918 | Bacteria | 1197 |
| 1186 | Ga0496115_0501915 | 3300048918 | Bacteria | 975 |
| 1187 | Ga0496126_0014653 | 3300048929 | Bacteria | 7915 |
| 1188 | Ga0501031_0008694 | 3300049568 | Bacteria | 6602 |
| 1189 | Ga0501032_0008127 | 3300049569 | Bacteria | 7648 |
| 1190 | Ga0501033_0068861 | 3300049570 | Bacteria | 2601 |
| 1191 | Ga0501033_0111765 | 3300049570 | Bacteria | 1988 |
| 1192 | Ga0501034_0039223 | 3300049571 | Bacteria | 4798 |
| 1193 | Ga0501034_0058838 | 3300049571 | Bacteria | 3860 |
| 1194 | Ga0501036_0020205 | 3300049572 | Bacteria | 5592 |
| 1195 | Ga0501037_0061310 | 3300049573 | Bacteria | 2742 |
| 1196 | Ga0501037_0281014 | 3300049573 | Bacteria | 1160 |
| 1197 | Ga0501038_0045995 | 3300049574 | Bacteria | 3785 |
| 1198 | Ga0501039_0017278 | 3300049575 | Bacteria | 5534 |
| 1199 | Ga0501040_0001448 | 3300049576 | Bacteria | 15032 |
| 1200 | Ga0501040_0297682 | 3300049576 | Bacteria | 1153 |
| 1201 | Ga0501041_0002807 | 3300049577 | Bacteria | 9951 |
| 1202 | Ga0501041_0019626 | 3300049577 | Bacteria | 4038 |
| 1203 | Ga0501042_0011934 | 3300049578 | Bacteria | 5871 |
| 1204 | Ga0501042_0046216 | 3300049578 | Bacteria | 3103 |
| 1205 | Ga0501046_0000977 | 3300049580 | Bacteria | 28011 |
| 1206 | Ga0501047_0009198 | 3300049581 | Bacteria | 9328 |
| 1207 | Ga0501047_0009775 | 3300049581 | Bacteria | 9065 |
| 1208 | Ga0501047_0014688 | 3300049581 | Bacteria | 7451 |
| 1209 | Ga0501047_0152280 | 3300049581 | Bacteria | 2188 |
| 1210 | Ga0501047_0226916 | 3300049581 | Bacteria | 1722 |
| 1211 | Ga0501047_0242187 | 3300049581 | Bacteria | 1654 |
| 1212 | Ga0501048_0002843 | 3300049582 | Bacteria | 13219 |
| 1213 | Ga0501067_0068439 | 3300049583 | Bacteria | 1965 |
| 1214 | Ga0501068_0004782 | 3300049584 | Bacteria | 7369 |
| 1215 | Ga0501069_0020417 | 3300049585 | Bacteria | 3589 |
| 1216 | Ga0501069_0045548 | 3300049585 | Bacteria | 2430 |
| 1217 | Ga0501069_0055909 | 3300049585 | Bacteria | 2198 |
| 1218 | Ga0501069_0071570 | 3300049585 | Bacteria | 1943 |
| 1219 | Ga0501070_0000805 | 3300049586 | Bacteria | 28505 |
| 1220 | Ga0501070_0055530 | 3300049586 | Bacteria | 3282 |
| 1221 | Ga0501070_0219956 | 3300049586 | Bacteria | 1558 |
| 1222 | Ga0501070_0243302 | 3300049586 | Bacteria | 1472 |
| 1223 | Ga0501071_0035652 | 3300049587 | Bacteria | 3544 |
| 1224 | Ga0501071_0074619 | 3300049587 | Bacteria | 2475 |
| 1225 | Ga0501071_0169374 | 3300049587 | Bacteria | 1635 |
| 1226 | Ga0501072_0003411 | 3300049588 | Bacteria | 11969 |
| 1227 | Ga0501072_0254153 | 3300049588 | Bacteria | 1399 |
| 1228 | Ga0501072_0298827 | 3300049588 | Bacteria | 1280 |
| 1229 | Ga0501072_0299805 | 3300049588 | Bacteria | 1278 |
| 1230 | Ga0501074_0008458 | 3300049590 | Bacteria | 7460 |
| 1231 | Ga0501074_0020418 | 3300049590 | Bacteria | 4814 |
| 1232 | Ga0501074_0131376 | 3300049590 | Bacteria | 1791 |
| 1233 | Ga0501076_0002835 | 3300049592 | Bacteria | 11987 |
| 1234 | Ga0501077_0002484 | 3300049593 | Bacteria | 11045 |
| 1235 | Ga0501077_0007845 | 3300049593 | Bacteria | 6591 |
| 1236 | Ga0501077_0274233 | 3300049593 | Unclassified | 1073 |
| 1237 | Ga0501209_026745 | 3300049656 | Bacteria | 1427 |
| 1238 | Ga0501079_0001222 | 3300049741 | Bacteria | 17989 |
| 1239 | Ga0501079_0009336 | 3300049741 | Bacteria | 7433 |
| 1240 | Ga0501079_0053739 | 3300049741 | Bacteria | 3107 |
| 1241 | Ga0501079_0198124 | 3300049741 | Bacteria | 1568 |
| 1242 | Ga0501080_0015795 | 3300049742 | Bacteria | 6964 |
| 1243 | Ga0501080_0031460 | 3300049742 | Bacteria | 4944 |
| 1244 | Ga0501080_0067996 | 3300049742 | Bacteria | 3314 |
| 1245 | Ga0501080_0262950 | 3300049742 | Bacteria | 1572 |
| 1246 | Ga0501081_0004722 | 3300049743 | Bacteria | 8760 |
| 1247 | Ga0501081_0047579 | 3300049743 | Bacteria | 2950 |
| 1248 | Ga0501083_0002114 | 3300049744 | Bacteria | 13633 |
| 1249 | Ga0501083_0010944 | 3300049744 | Bacteria | 6379 |
| 1250 | Ga0501083_0067448 | 3300049744 | Bacteria | 2382 |
| 1251 | Ga0501044_0046555 | 3300049823 | Bacteria | 4489 |
| 1252 | Ga0501044_0343162 | 3300049823 | Bacteria | 1414 |
| 1253 | Ga0501044_0367068 | 3300049823 | Bacteria | 1357 |
| 1254 | Ga0501045_0002001 | 3300049824 | Bacteria | 13768 |
| 1255 | Ga0501045_0076746 | 3300049824 | Bacteria | 2462 |
| 1256 | nmdc:mga0yw44_43770_c2 | 3300050492 | Bacteria | 1821 |
| 1257 | nmdc:mga05p37_1712_c1 | 3300050507 | Bacteria | 25565 |
| 1258 | nmdc:mga05p37_211685_c1 | 3300050507 | Bacteria | 2343 |
| 1259 | nmdc:mga05p37_25384_c1 | 3300050507 | Bacteria | 7206 |
| 1260 | nmdc:mga05p37_354762_c1 | 3300050507 | Unclassified | 1726 |
| 1261 | nmdc:mga05p37_413569_c1 | 3300050507 | Bacteria | 1571 |
| 1262 | nmdc:mga06r32_163303_c1 | 3300050510 | Bacteria | 2210 |
| 1263 | nmdc:mga06r32_299926_c1 | 3300050510 | Bacteria | 1593 |
| 1264 | nmdc:mga06r32_450801_c1 | 3300050510 | Bacteria | 1266 |
| 1265 | nmdc:mga06r32_654237_c1 | 3300050510 | Bacteria | 1019 |
| 1266 | nmdc:mga08y16_150129_c1 | 3300050511 | Unclassified | 2422 |
| 1267 | nmdc:mga08y16_24505_c1 | 3300050511 | Bacteria | 6367 |
| 1268 | nmdc:mga08y16_553167_c1 | 3300050511 | Bacteria | 1164 |
| 1269 | nmdc:mga08y16_644016_c1 | 3300050511 | Bacteria | 1065 |
| 1270 | nmdc:mga08y16_715336_c1 | 3300050511 | Bacteria | 1000 |
| 1271 | nmdc:mga08y16_9150_c1 | 3300050511 | Bacteria | 10396 |
| 1272 | nmdc:mga0n895_12180_c1 | 3300050512 | Bacteria | 7702 |
| 1273 | nmdc:mga0n895_379557_c1 | 3300050512 | Bacteria | 1430 |
| 1274 | nmdc:mga0n895_481382_c1 | 3300050512 | Unclassified | 1252 |
| 1275 | nmdc:mga0n895_515970_c1 | 3300050512 | Bacteria | 1203 |
| 1276 | nmdc:mga0n895_669600_c1 | 3300050512 | Bacteria | 1035 |
| 1277 | nmdc:mga0n895_7295_c1 | 3300050512 | Bacteria | 9475 |
| 1278 | nmdc:mga0rr50_34687_c1 | 3300050513 | Bacteria | 3616 |
| 1279 | nmdc:mga0rr50_61838_c1 | 3300050513 | Archaea | 2822 |
| 1280 | nmdc:mga0rr50_76794_c1 | 3300050513 | Bacteria | 2565 |
| 1281 | nmdc:mga08x19_45480_c2 | 3300050514 | Bacteria | 2415 |
| 1282 | nmdc:mga08x19_8065_c1 | 3300050514 | Bacteria | 6256 |
| 1283 | nmdc:mga08x19_8700_c1 | 3300050514 | Bacteria | 6053 |
| 1284 | nmdc:mga08x19_9813_c1 | 3300050514 | Bacteria | 5736 |
| 1285 | nmdc:mga0a205_189643_c1 | 3300050515 | Bacteria | 1948 |
| 1286 | nmdc:mga0a205_209122_c1 | 3300050515 | Bacteria | 1840 |
| 1287 | nmdc:mga0a205_336084_c1 | 3300050515 | Bacteria | 1380 |
| 1288 | nmdc:mga0a205_36751_c1 | 3300050515 | Bacteria | 4708 |
| 1289 | Ga0495601_0000218 | 3300053077 | Bacteria | 30705 |
| 1290 | Ga0495601_0053536 | 3300053077 | Bacteria | 2551 |
| 1291 | Ga0495601_0116292 | 3300053077 | Bacteria | 1734 |
| 1292 | Ga0495612_0007074 | 3300053078 | Bacteria | 4589 |
| 1293 | Ga0495612_0056557 | 3300053078 | Bacteria | 1619 |
| 1294 | Ga0495655_0000400 | 3300053083 | Bacteria | 7351 |
| 1295 | Ga0495595_0004838 | 3300053084 | Bacteria | 5425 |
| 1296 | Ga0495595_0013345 | 3300053084 | Bacteria | 3471 |
| 1297 | Ga0495595_0030875 | 3300053084 | Bacteria | 2405 |
| 1298 | Ga0495619_0011100 | 3300053085 | Bacteria | 5664 |
| 1299 | Ga0495619_0026262 | 3300053085 | Bacteria | 3746 |
| 1300 | Ga0495619_0066626 | 3300053085 | Bacteria | 2403 |
| 1301 | Ga0495619_0083344 | 3300053085 | Bacteria | 2156 |
| 1302 | Ga0495619_0102697 | 3300053085 | Bacteria | 1947 |
| 1303 | Ga0495619_0187354 | 3300053085 | Bacteria | 1432 |
| 1304 | Ga0495619_0226748 | 3300053085 | Bacteria | 1294 |
| 1305 | Ga0500566_0054705 | 3300053094 | Bacteria | 2275 |
| 1306 | Ga0501084_0052612 | 3300054114 | Bacteria | 3406 |
| 1307 | Ga0501084_0153946 | 3300054114 | Bacteria | 1939 |
| 1308 | Ga0501084_0421059 | 3300054114 | Bacteria | 1129 |
| 1309 | Ga0590075_023342 | 3300059424 | Bacteria | 1550 |
| 1310 | Ga0501082_0000690 | 3300060353 | Bacteria | 29775 |
| 1311 | Ga0501082_0055589 | 3300060353 | Bacteria | 3409 |
| 1312 | Ga0501082_0189328 | 3300060353 | Bacteria | 1790 |
| 1313 | Ga0501082_0679284 | 3300060353 | Bacteria | 901 |
| 1314 | Ga0466962_0000096 | 3300061719 | Bacteria | 35253 |
| 1315 | Ga0466962_0001445 | 3300061719 | Bacteria | 11078 |
| 1316 | Ga0466962_0003609 | 3300061719 | Bacteria | 7374 |
| 1317 | Ga0466962_0007666 | 3300061719 | Bacteria | 5171 |
| 1318 | Ga0466962_0007812 | 3300061719 | Bacteria | 5127 |
| 1319 | Ga0466962_0050879 | 3300061719 | Bacteria | 1981 |
| 1320 | Ga0466962_0059336 | 3300061719 | Bacteria | 1826 |
| 1321 | Ga0466962_0062716 | 3300061719 | Bacteria | 1775 |
| 1322 | Ga0466962_0110360 | 3300061719 | Unclassified | 1324 |
| 1323 | Ga0530510_0000474 | 3300061734 | Bacteria | 25778 |
| 1324 | Ga0530510_0005435 | 3300061734 | Bacteria | 8816 |
| 1325 | Ga0436360_1016639 | |||
| 1326 | JGI25407J50210_10009508 | |||
| 1327 | Ga0070658_10012791 | |||
| 1328 | Ga0070658_10063646 | |||
| 1329 | Ga0070658_10114397 | |||
| 1330 | Ga0070658_10149871 | |||
| 1331 | Ga0070658_10169244 | |||
| 1332 | Ga0070683_100005050 | |||
| 1333 | Ga0070683_100026240 | |||
| 1334 | Ga0070683_100053877 | |||
| 1335 | Ga0070683_100073457 | |||
| 1336 | Ga0070683_100102836 | |||
| 1337 | Ga0070683_100165566 | |||
| 1338 | Ga0070690_100358059 | |||
| 1339 | Ga0070670_100232271 | |||
| 1340 | Ga0068869_100284701 | |||
| 1341 | Ga0068869_100307646 | |||
| 1342 | Ga0070666_10245088 | |||
| 1343 | Ga0070680_100006253 | |||
| 1344 | Ga0070680_100032586 | |||
| 1345 | Ga0070680_100064314 | |||
| 1346 | Ga0070680_100290897 | |||
| 1347 | Ga0070680_100458681 | |||
| 1348 | Ga0070682_100043893 | |||
| 1349 | Ga0070682_100045211 | |||
| 1350 | Ga0070682_100068968 | |||
| 1351 | Ga0068868_100060097 | |||
| 1352 | Ga0068868_100154711 | |||
| 1353 | Ga0068868_100175254 | |||
| 1354 | Ga0070660_100024614 | |||
| 1355 | Ga0070660_100045847 | |||
| 1356 | Ga0070660_100046194 | |||
| 1357 | Ga0070660_100046949 | |||
| 1358 | Ga0070660_100052003 | |||
| 1359 | Ga0070660_100270999 | |||
| 1360 | Ga0070689_100008221 | |||
| 1361 | Ga0070691_10068259 | |||
| 1362 | Ga0070661_100012445 | |||
| 1363 | Ga0070661_100109628 | |||
| 1364 | Ga0070661_100445191 | |||
| 1365 | Ga0070692_10004619 | |||
| 1366 | Ga0070692_10140230 | |||
| 1367 | Ga0070675_100161683 | |||
| 1368 | Ga0070671_100032295 | |||
| 1369 | Ga0070671_100093187 | |||
| 1370 | Ga0070674_100230187 | |||
| 1371 | Ga0070674_100445881 | |||
| 1372 | Ga0070673_100547224 | |||
| 1373 | Ga0070659_100031564 | |||
| 1374 | Ga0070667_100002001 | |||
| 1375 | Ga0070703_10002554 | |||
| 1376 | Ga0070703_10030854 | |||
| 1377 | Ga0070709_10028844 | |||
| 1378 | Ga0070709_10034021 | |||
| 1379 | Ga0070714_100004198 | |||
| 1380 | Ga0070714_100004838 | |||
| 1381 | Ga0070714_100023312 | |||
| 1382 | Ga0070714_100025095 | |||
| 1383 | Ga0070714_100072969 | |||
| 1384 | Ga0070714_100089467 | |||
| 1385 | Ga0070714_100254802 | |||
| 1386 | Ga0070714_100281644 | |||
| 1387 | Ga0070714_100298449 | |||
| 1388 | Ga0070714_100374294 | |||
| 1389 | Ga0070714_100573408 | |||
| 1390 | Ga0070713_100001060 | |||
| 1391 | Ga0070713_100017251 | |||
| 1392 | Ga0070713_100114537 | |||
| 1393 | Ga0070713_100170226 | |||
| 1394 | Ga0070710_10000443 | |||
| 1395 | Ga0070710_10171620 | |||
| 1396 | Ga0070701_10188709 | |||
| 1397 | Ga0070711_100011889 | |||
| 1398 | Ga0070711_100013538 | |||
| 1399 | Ga0070711_100021588 | |||
| 1400 | Ga0070711_100061153 | |||
| 1401 | Ga0070711_100206347 | |||
| 1402 | Ga0070711_100485727 | |||
| 1403 | Ga0070705_100001980 | |||
| 1404 | Ga0070705_100013747 | |||
| 1405 | Ga0070705_100018179 | |||
| 1406 | Ga0070700_100015619 | |||
| 1407 | Ga0070694_100038984 | |||
| 1408 | Ga0070708_100034217 | |||
| 1409 | Ga0070708_100220947 | |||
| 1410 | Ga0070663_100372014 | |||
| 1411 | Ga0070678_100002713 | |||
| 1412 | Ga0070678_100127047 | |||
| 1413 | Ga0070678_100139922 | |||
| 1414 | Ga0070681_10009404 | |||
| 1415 | Ga0070681_10017738 | |||
| 1416 | Ga0070681_10036127 | |||
| 1417 | Ga0070681_10057635 | |||
| 1418 | Ga0070681_10065039 | |||
| 1419 | Ga0070681_10083232 | |||
| 1420 | Ga0070681_10123323 | |||
| 1421 | Ga0070681_10164387 | |||
| 1422 | Ga0070681_10186406 | |||
| 1423 | Ga0068867_100000913 | |||
| 1424 | Ga0068867_100171456 | |||
| 1425 | Ga0068867_100260382 | |||
| 1426 | Ga0070685_10247899 | |||
| 1427 | Ga0070706_100046484 | |||
| 1428 | Ga0070706_100085657 | |||
| 1429 | Ga0070706_100198366 | |||
| 1430 | Ga0070706_100354329 | |||
| 1431 | Ga0070707_100002712 | |||
| 1432 | Ga0070707_100011501 | |||
| 1433 | Ga0070707_100155777 | |||
| 1434 | Ga0070707_100177888 | |||
| 1435 | Ga0070707_100297321 | |||
| 1436 | Ga0070707_100459801 | |||
| 1437 | Ga0070707_100503600 | |||
| 1438 | Ga0070698_100000853 | |||
| 1439 | Ga0070698_100015615 | |||
| 1440 | Ga0070698_100034960 | |||
| 1441 | Ga0070698_100063612 | |||
| 1442 | Ga0070698_100182169 | |||
| 1443 | Ga0070679_100003423 | |||
| 1444 | Ga0070679_100052984 | |||
| 1445 | Ga0070679_100112160 | |||
| 1446 | Ga0070679_100120333 | |||
| 1447 | Ga0070679_100156760 | |||
| 1448 | Ga0070679_100198244 | |||
| 1449 | Ga0070684_100000762 | |||
| 1450 | Ga0070684_100001409 | |||
| 1451 | Ga0070684_100029473 | |||
| 1452 | Ga0070684_100034824 | |||
| 1453 | Ga0070684_100044526 | |||
| 1454 | Ga0070684_100050892 | |||
| 1455 | Ga0070684_100081507 | |||
| 1456 | Ga0070684_100117734 | |||
| 1457 | Ga0070684_100119746 | |||
| 1458 | Ga0070684_100126232 | |||
| 1459 | Ga0070684_100172123 | |||
| 1460 | Ga0070697_100064098 | |||
| 1461 | Ga0070697_100170162 | |||
| 1462 | Ga0068853_100005764 | |||
| 1463 | Ga0068853_100179062 | |||
| 1464 | Ga0068853_100297938 | |||
| 1465 | Ga0070672_100036775 | |||
| 1466 | Ga0070686_100033420 | |||
| 1467 | Ga0070686_100105273 | |||
| 1468 | Ga0070695_100017454 | |||
| 1469 | Ga0070695_100084342 | |||
| 1470 | Ga0070696_100004176 | |||
| 1471 | Ga0070696_100034805 | |||
| 1472 | Ga0070693_100015388 | |||
| 1473 | Ga0070693_100069223 | |||
| 1474 | Ga0070693_100261239 | |||
| 1475 | Ga0070665_100013762 | |||
| 1476 | Ga0070704_100217705 | |||
| 1477 | Ga0068855_100023527 | |||
| 1478 | Ga0068855_100034915 | |||
| 1479 | Ga0068855_100101071 | |||
| 1480 | Ga0068855_100246350 | |||
| 1481 | Ga0068855_100472521 | |||
| 1482 | Ga0068855_100490321 | |||
| 1483 | Ga0070664_100104597 | |||
| 1484 | Ga0068857_100001692 | |||
| 1485 | Ga0068857_100043413 | |||
| 1486 | Ga0068857_100051612 | |||
| 1487 | Ga0068857_100278651 | |||
| 1488 | Ga0068854_100149252 | |||
| 1489 | Ga0068854_100162977 | |||
| 1490 | Ga0068856_100002581 | |||
| 1491 | Ga0068856_100043969 | |||
| 1492 | Ga0068856_100335162 | |||
| 1493 | Ga0068856_100384501 | |||
| 1494 | Ga0070702_100044121 | |||
| 1495 | Ga0070702_100151165 | |||
| 1496 | Ga0068852_100320981 | |||
| 1497 | Ga0068864_100025713 | |||
| 1498 | Ga0068866_10002623 | |||
| 1499 | Ga0068866_10091584 | |||
| 1500 | Ga0068861_100157244 | |||
| 1501 | Ga0068861_100237372 | |||
| 1502 | Ga0081455_10018767 | |||
| 1503 | Ga0081455_10055952 | |||
| 1504 | Ga0081538_10000100 | |||
| 1505 | Ga0081538_10016467 | |||
| 1506 | Ga0081540_1004488 | |||
| 1507 | Ga0081539_10000095 | |||
| 1508 | Ga0081539_10001005 | |||
| 1509 | Ga0070717_10005467 | |||
| 1510 | Ga0070717_10005558 | |||
| 1511 | Ga0070717_10030563 | |||
| 1512 | Ga0075365_10064967 | |||
| 1513 | Ga0075432_10044418 | |||
| 1514 | Ga0070715_10001395 | |||
| 1515 | Ga0070715_10005089 | |||
| 1516 | Ga0070715_10020497 | |||
| 1517 | Ga0070716_100005635 | |||
| 1518 | Ga0070712_100033918 | |||
| 1519 | Ga0070712_100040695 | |||
| 1520 | Ga0070712_100054382 | |||
| 1521 | Ga0070712_100131276 | |||
| 1522 | Ga0070712_100263968 | |||
| 1523 | Ga0070712_100345452 | |||
| 1524 | Ga0097621_100002459 | |||
| 1525 | Ga0097621_100105826 | |||
| 1526 | Ga0097621_100376153 | |||
| 1527 | Ga0068871_100145601 | |||
| 1528 | Ga0068871_100208963 | |||
| 1529 | Ga0075428_100005327 | |||
| 1530 | Ga0075431_100476000 | |||
| 1531 | Ga0075433_10002265 | |||
| 1532 | Ga0075433_10033469 | |||
| 1533 | Ga0075434_100001294 | |||
| 1534 | Ga0075434_100009463 | |||
| 1535 | Ga0075434_100162060 | |||
| 1536 | Ga0075434_100182287 | |||
| 1537 | Ga0075434_100489407 | |||
| 1538 | Ga0075434_100515776 | |||
| 1539 | Ga0068865_100012648 | |||
| 1540 | Ga0075436_100000915 | |||
| 1541 | Ga0075436_100009752 | |||
| 1542 | Ga0075436_100011075 | |||
| 1543 | Ga0075436_100083343 | |||
| 1544 | Ga0075436_100173171 | |||
| 1545 | Ga0075435_100001243 | |||
| 1546 | Ga0075435_100030849 | |||
| 1547 | Ga0075435_100082018 | |||
| 1548 | Ga0105240_10017296 | |||
| 1549 | Ga0105240_10106166 | |||
| 1550 | Ga0105240_10180778 | |||
| 1551 | Ga0105240_10250352 | |||
| 1552 | Ga0105240_10351008 | |||
| 1553 | Ga0105240_10625444 | |||
| 1554 | Ga0111539_10001300 | |||
| 1555 | Ga0111539_10003648 | |||
| 1556 | Ga0111539_10031645 | |||
| 1557 | Ga0111539_10038970 | |||
| 1558 | Ga0111539_10144163 | |||
| 1559 | Ga0111539_10178854 | |||
| 1560 | Ga0111539_10189315 | |||
| 1561 | Ga0111539_10199717 | |||
| 1562 | Ga0111539_10204142 | |||
| 1563 | Ga0111539_10288660 | |||
| 1564 | Ga0105245_10007177 | |||
| 1565 | Ga0105245_10016075 | |||
| 1566 | Ga0105245_10020104 | |||
| 1567 | Ga0105245_10028370 | |||
| 1568 | Ga0105245_10076745 | |||
| 1569 | Ga0105245_10077410 | |||
| 1570 | Ga0105245_10088218 | |||
| 1571 | Ga0105245_10146073 | |||
| 1572 | Ga0105245_10415010 | |||
| 1573 | Ga0105247_10206780 | |||
| 1574 | Ga0114129_10000141 | |||
| 1575 | Ga0114129_10016454 | |||
| 1576 | Ga0114129_10032839 | |||
| 1577 | Ga0114129_10125768 | |||
| 1578 | Ga0114129_10229065 | |||
| 1579 | Ga0114129_10518272 | |||
| 1580 | Ga0114129_10601237 | |||
| 1581 | Ga0114129_10623426 | |||
| 1582 | Ga0114129_10752386 | |||
| 1583 | Ga0105243_10031341 | |||
| 1584 | Ga0105243_10246127 | |||
| 1585 | Ga0105243_10633861 | |||
| 1586 | Ga0105241_10716541 | |||
| 1587 | Ga0105242_10074064 | |||
| 1588 | Ga0105242_10389512 | |||
| 1589 | Ga0105248_10016541 | |||
| 1590 | Ga0105248_10430215 | |||
| 1591 | Ga0105248_10437885 | |||
| 1592 | Ga0105248_10551715 | |||
| 1593 | Ga0105237_10105826 | |||
| 1594 | Ga0105238_10091694 | |||
| 1595 | Ga0105238_10198028 | |||
| 1596 | Ga0105249_10001857 | |||
| 1597 | Ga0105239_10158940 | |||
| 1598 | Ga0105239_10196554 | |||
| 1599 | Ga0105239_10261355 | |||
| 1600 | Ga0105239_10284997 | |||
| 1601 | Ga0105246_10088817 | |||
| 1602 | Ga0105246_10098245 | |||
| 1603 | Ga0157371_10204373 | |||
| 1604 | Ga0157370_10015040 | |||
| 1605 | Ga0157370_10086075 | |||
| 1606 | Ga0157370_10153386 | |||
| 1607 | Ga0157369_10002742 | |||
| 1608 | Ga0157369_10017773 | |||
| 1609 | Ga0157369_10018104 | |||
| 1610 | Ga0157369_10035760 | |||
| 1611 | Ga0157369_10037107 | |||
| 1612 | Ga0157369_10149428 | |||
| 1613 | Ga0157369_10198355 | |||
| 1614 | Ga0157374_10020353 | |||
| 1615 | Ga0157374_10023645 | |||
| 1616 | Ga0157374_10085634 | |||
| 1617 | Ga0157378_10110998 | |||
| 1618 | Ga0157378_10191417 | |||
| 1619 | Ga0157378_10448914 | |||
| 1620 | Ga0163162_10032238 | |||
| 1621 | Ga0163162_10467857 | |||
| 1622 | Ga0157372_10080466 | |||
| 1623 | Ga0157372_10270207 | |||
| 1624 | Ga0157372_10352083 | |||
| 1625 | Ga0157375_10006585 | |||
| 1626 | Ga0157375_10045939 | |||
| 1627 | Ga0157375_10055423 | |||
| 1628 | Ga0157375_10300275 | |||
| 1629 | Ga0157375_10539078 | |||
| 1630 | Ga0157380_10001429 | |||
| 1631 | Ga0157377_10006457 | |||
| 1632 | Ga0157379_10119773 | |||
| 1633 | Ga0157376_10013193 | |||
| 1634 | Ga0157376_10114055 | |||
| 1635 | Ga0182007_10017644 | |||
| 1636 | Ga0197907_10740994 | |||
| 1637 | Ga0206356_10116221 | |||
| 1638 | Ga0206354_10232504 | |||
| 1639 | Ga0206353_11057617 | |||
| 1640 | Ga0206353_11605935 | |||
| 1641 | Ga0206353_11689011 | |||
| 1642 | Ga0213873_10033604 | |||
| 1643 | Ga0213871_10014400 | |||
| 1644 | Ga0207692_10006335 | |||
| 1645 | Ga0207692_10008917 | |||
| 1646 | Ga0207692_10068773 | |||
| 1647 | Ga0207692_10238382 | |||
| 1648 | Ga0207642_10200029 | |||
| 1649 | Ga0207688_10065403 | |||
| 1650 | Ga0207688_10102295 | |||
| 1651 | Ga0207680_10005081 | |||
| 1652 | Ga0207685_10001417 | |||
| 1653 | Ga0207685_10006373 | |||
| 1654 | Ga0207685_10033087 | |||
| 1655 | Ga0207699_10018015 | |||
| 1656 | Ga0207699_10155265 | |||
| 1657 | Ga0207699_10183722 | |||
| 1658 | Ga0207699_10309108 | |||
| 1659 | Ga0207643_10027055 | |||
| 1660 | Ga0207705_10137243 | |||
| 1661 | Ga0207705_10139465 | |||
| 1662 | Ga0207705_10149333 | |||
| 1663 | Ga0207684_10028521 | |||
| 1664 | Ga0207684_10103641 | |||
| 1665 | Ga0207684_10128772 | |||
| 1666 | Ga0207684_10467349 | |||
| 1667 | Ga0207707_10008396 | |||
| 1668 | Ga0207707_10030466 | |||
| 1669 | Ga0207707_10050817 | |||
| 1670 | Ga0207707_10065380 | |||
| 1671 | Ga0207707_10250954 | |||
| 1672 | Ga0207695_10009300 | |||
| 1673 | Ga0207695_10052410 | |||
| 1674 | Ga0207695_10216587 | |||
| 1675 | Ga0207695_10246270 | |||
| 1676 | Ga0207693_10000468 | |||
| 1677 | Ga0207693_10003383 | |||
| 1678 | Ga0207693_10008117 | |||
| 1679 | Ga0207693_10015138 | |||
| 1680 | Ga0207693_10023335 | |||
| 1681 | Ga0207693_10069335 | |||
| 1682 | Ga0207693_10189074 | |||
| 1683 | Ga0207693_10273778 | |||
| 1684 | Ga0207693_10359449 | |||
| 1685 | Ga0207663_10057469 | |||
| 1686 | Ga0207663_10243328 | |||
| 1687 | Ga0207663_10414183 | |||
| 1688 | Ga0207663_10421374 | |||
| 1689 | Ga0207660_10130370 | |||
| 1690 | Ga0207660_10136895 | |||
| 1691 | Ga0207660_10460566 | |||
| 1692 | Ga0207657_10000988 | |||
| 1693 | Ga0207657_10004731 | |||
| 1694 | Ga0207657_10009308 | |||
| 1695 | Ga0207657_10015573 | |||
| 1696 | Ga0207657_10024561 | |||
| 1697 | Ga0207657_10069096 | |||
| 1698 | Ga0207657_10336348 | |||
| 1699 | Ga0207649_10024155 | |||
| 1700 | Ga0207652_10045065 | |||
| 1701 | Ga0207652_10080258 | |||
| 1702 | Ga0207652_10092179 | |||
| 1703 | Ga0207652_10382396 | |||
| 1704 | Ga0207646_10001768 | |||
| 1705 | Ga0207646_10002982 | |||
| 1706 | Ga0207646_10005974 | |||
| 1707 | Ga0207646_10236098 | |||
| 1708 | Ga0207646_10272986 | |||
| 1709 | Ga0207646_10347720 | |||
| 1710 | Ga0207646_10478170 | |||
| 1711 | Ga0207681_10237340 | |||
| 1712 | Ga0207694_10176027 | |||
| 1713 | Ga0207694_10193388 | |||
| 1714 | Ga0207650_10041410 | |||
| 1715 | Ga0207659_10079179 | |||
| 1716 | Ga0207687_10060558 | |||
| 1717 | Ga0207687_10084981 | |||
| 1718 | Ga0207687_10160259 | |||
| 1719 | Ga0207687_10384413 | |||
| 1720 | Ga0207687_10575582 | |||
| 1721 | Ga0207700_10000039 | |||
| 1722 | Ga0207700_10033783 | |||
| 1723 | Ga0207700_10158959 | |||
| 1724 | Ga0207700_10187583 | |||
| 1725 | Ga0207700_10310088 | |||
| 1726 | Ga0207700_10418481 | |||
| 1727 | Ga0207700_10439943 | |||
| 1728 | Ga0207664_10011034 | |||
| 1729 | Ga0207664_10018300 | |||
| 1730 | Ga0207664_10022691 | |||
| 1731 | Ga0207664_10040296 | |||
| 1732 | Ga0207664_10044151 | |||
| 1733 | Ga0207664_10049096 | |||
| 1734 | Ga0207664_10064076 | |||
| 1735 | Ga0207664_10072301 | |||
| 1736 | Ga0207664_10075761 | |||
| 1737 | Ga0207664_10107716 | |||
| 1738 | Ga0207664_10109430 | |||
| 1739 | Ga0207664_10132209 | |||
| 1740 | Ga0207664_10146176 | |||
| 1741 | Ga0207664_10258378 | |||
| 1742 | Ga0207664_10311446 | |||
| 1743 | Ga0207664_10352322 | |||
| 1744 | Ga0207644_10037229 | |||
| 1745 | Ga0207644_10385391 | |||
| 1746 | Ga0207690_10167735 | |||
| 1747 | Ga0207690_10191423 | |||
| 1748 | Ga0207706_10044731 | |||
| 1749 | Ga0207706_10048942 | |||
| 1750 | Ga0207686_10004740 | |||
| 1751 | Ga0207686_10148042 | |||
| 1752 | Ga0207686_10296150 | |||
| 1753 | Ga0207686_10350092 | |||
| 1754 | Ga0207709_10001987 | |||
| 1755 | Ga0207709_10041853 | |||
| 1756 | Ga0207709_10056938 | |||
| 1757 | Ga0207670_10005003 | |||
| 1758 | Ga0207669_10325134 | |||
| 1759 | Ga0207704_10068925 | |||
| 1760 | Ga0207704_10086150 | |||
| 1761 | Ga0207665_10002358 | |||
| 1762 | Ga0207665_10022233 | |||
| 1763 | Ga0207665_10099705 | |||
| 1764 | Ga0207691_10008985 | |||
| 1765 | Ga0207691_10381473 | |||
| 1766 | Ga0207711_10284281 | |||
| 1767 | Ga0207711_10387493 | |||
| 1768 | Ga0207711_10547669 | |||
| 1769 | Ga0207661_10003288 | |||
| 1770 | Ga0207661_10009282 | |||
| 1771 | Ga0207661_10035675 | |||
| 1772 | Ga0207661_10082038 | |||
| 1773 | Ga0207661_10088182 | |||
| 1774 | Ga0207661_10135236 | |||
| 1775 | Ga0207661_10174694 | |||
| 1776 | Ga0207661_10203334 | |||
| 1777 | Ga0207661_10385319 | |||
| 1778 | Ga0207661_10516806 | |||
| 1779 | Ga0207679_10217655 | |||
| 1780 | Ga0207679_10299986 | |||
| 1781 | Ga0207667_10262907 | |||
| 1782 | Ga0207651_10269474 | |||
| 1783 | Ga0207640_10119282 | |||
| 1784 | Ga0207640_10213080 | |||
| 1785 | Ga0207640_10372966 | |||
| 1786 | Ga0207658_10002326 | |||
| 1787 | Ga0207658_10343087 | |||
| 1788 | Ga0207677_10120632 | |||
| 1789 | Ga0207677_10168895 | |||
| 1790 | Ga0207677_10250418 | |||
| 1791 | Ga0207677_10502275 | |||
| 1792 | Ga0207703_10276464 | |||
| 1793 | Ga0207639_10486147 | |||
| 1794 | Ga0207678_10191318 | |||
| 1795 | Ga0207708_10000400 | |||
| 1796 | Ga0207708_10005578 | |||
| 1797 | Ga0207708_10051886 | |||
| 1798 | Ga0207702_10107873 | |||
| 1799 | Ga0207702_10127857 | |||
| 1800 | Ga0207702_10436663 | |||
| 1801 | Ga0207702_10448545 | |||
| 1802 | Ga0207702_10507763 | |||
| 1803 | Ga0207641_10238689 | |||
| 1804 | Ga0207648_10005898 | |||
| 1805 | Ga0207648_10033391 | |||
| 1806 | Ga0207648_10061990 | |||
| 1807 | Ga0207648_10094073 | |||
| 1808 | Ga0207676_10021755 | |||
| 1809 | Ga0207676_10079799 | |||
| 1810 | Ga0207674_10003276 | |||
| 1811 | Ga0207674_10008281 | |||
| 1812 | Ga0207674_10011757 | |||
| 1813 | Ga0207674_10064147 | |||
| 1814 | Ga0207675_100004495 | |||
| 1815 | Ga0207675_100029762 | |||
| 1816 | Ga0207675_100063876 | |||
| 1817 | Ga0207675_100168285 | |||
| 1818 | Ga0207683_10000864 | |||
| 1819 | Ga0207683_10024235 | |||
| 1820 | Ga0207683_10098964 | |||
| 1821 | Ga0207683_10285260 | |||
| 1822 | Ga0207683_10724199 | |||
| 1823 | Ga0207698_10103333 | |||
| 1824 | Ga0207698_10122159 | |||
| 1825 | Ga0207698_10176732 | |||
| 1826 | Ga0207428_10005934 | |||
| 1827 | Ga0207428_10012523 | |||
| 1828 | Ga0207428_10025233 | |||
| 1829 | Ga0207428_10111703 | |||
| 1830 | Ga0207428_10214319 | |||
| 1831 | Ga0268266_10342816 | |||
| 1832 | Ga0268265_10155629 | |||
| 1833 | Ga0265319_1000635 | |||
| 1834 | Ga0265318_10000338 | |||
| 1835 | Ga0265318_10003761 | |||
| 1836 | Ga0265323_10021941 | |||
| 1837 | Ga0265322_10054029 | |||
| 1838 | Ga0265336_10001093 | |||
| 1839 | Ga0265338_10000924 | |||
| 1840 | Ga0265338_10001048 | |||
| 1841 | Ga0265338_10007196 | |||
| 1842 | Ga0265338_10007510 | |||
| 1843 | Ga0265338_10049044 | |||
| 1844 | Ga0265338_10383456 | |||
| 1845 | Ga0265324_10035012 | |||
| 1846 | Ga0265330_10000327 | |||
| 1847 | Ga0265330_10029460 | |||
| 1848 | Ga0265330_10091494 | |||
| 1849 | Ga0265332_10006061 | |||
| 1850 | Ga0265332_10041282 | |||
| 1851 | Ga0265328_10000520 | |||
| 1852 | Ga0265320_10006577 | |||
| 1853 | Ga0265320_10101768 | |||
| 1854 | Ga0265325_10000102 | |||
| 1855 | Ga0265325_10034254 | |||
| 1856 | Ga0265329_10000373 | |||
| 1857 | Ga0265340_10002339 | |||
| 1858 | Ga0265339_10001624 | |||
| 1859 | Ga0265339_10008896 | |||
| 1860 | Ga0265331_10005697 | |||
| 1861 | Ga0265327_10008083 | |||
| 1862 | Ga0265327_10017059 | |||
| 1863 | Ga0265327_10044866 | |||
| 1864 | Ga0265327_10055369 | |||
| 1865 | Ga0265316_10021395 | |||
| 1866 | Ga0265316_10048991 | |||
| 1867 | Ga0307408_100421482 | |||
| 1868 | Ga0265313_10002639 | |||
| 1869 | Ga0265313_10005201 | |||
| 1870 | Ga0265313_10063101 | |||
| 1871 | Ga0265314_10002591 | |||
| 1872 | Ga0265342_10021609 | |||
| 1873 | Ga0265342_10042300 | |||
| 1874 | Ga0307405_10249309 | |||
| 1875 | Ga0307413_10002634 | |||
| 1876 | Ga0307410_10001992 | |||
| 1877 | Ga0307406_10050990 | |||
| 1878 | Ga0307406_10269187 | |||
| 1879 | Ga0307407_10000349 | |||
| 1880 | Ga0307407_10300766 | |||
| 1881 | Ga0307412_10007782 | |||
| 1882 | Ga0307409_100000397 | |||
| 1883 | Ga0307409_100176900 | |||
| 1884 | Ga0307409_100214615 | |||
| 1885 | Ga0307416_100005603 | |||
| 1886 | Ga0307416_100100631 | |||
| 1887 | Ga0307416_100156542 | |||
| 1888 | Ga0307416_100436695 | |||
| 1889 | Ga0307411_10012656 | |||
| 1890 | Ga0307415_100001163 | |||
| 1891 | Ga0307415_100037965 | |||
| 1892 | Ga0307415_100062191 | |||
| 1893 | Ga0373950_0005175 | |||
| 1894 | Ga0373959_0007706 | |||
| 1895 | Ga0373938_0000216 | |||
| 1896 | Ga0373928_0006191 | |||
| 1897 | Ga0373944_0004394 | |||
| 1898 | Ga0373944_0009886 | |||
| 1899 | Ga0373949_0002012 | |||
| 1900 | Ga0373951_0001205 | |||
| 1901 | Ga0373952_0012718 | |||
| 1902 | Ga0373932_0001256 | |||
| 1903 | Ga0373939_0001181 | |||
| 1904 | Ga0373939_0057899 | |||
| 1905 | Ga0373941_0000276 | |||
| 1906 | Ga0373941_0074329 | |||
| 1907 | Ga0373945_0005513 | |||
| 1908 | Ga0373945_0037285 | |||
| 1909 | Ga0373960_0000634 | |||
| 1910 | Ga0373943_0000198 | |||
| 1911 | Ga0373943_0007385 | |||
| 1912 | Ga0373943_0069273 | |||
| 1913 | Ga0373955_0027342 | |||
| 1914 | Ga0373962_0001041 | |||
| 1915 | Ga0373931_0067189 | |||
| 1916 | Ga0373935_0030017 | |||
| 1917 | Ga0373935_0041242 | |||
| 1918 | Ga0373935_0088079 | |||
| 1919 | Ga0373927_0133617 | |||
| 1920 | Ga0373947_0000463 | |||
| 1921 | Ga0373947_0002635 | |||
| 1922 | Ga0373947_0018309 | |||
| 1923 | Ga0373937_0000725 | |||
| 1924 | Ga0373937_0360398 | |||
| 1925 | Ga0373925_0002318 | |||
| 1926 | Ga0373925_0007695 | |||
| 1927 | Ga0373925_0201531 | |||
| 1928 | Ga0373925_0527320 | |||
| 1929 | Ga0395899_0002568 | |||
| 1930 | Ga0395899_0003162 | |||
| 1931 | Ga0395899_0004845 | |||
| 1932 | Ga0395899_0008133 | |||
| 1933 | Ga0395899_0012840 | |||
| 1934 | Ga0395899_0020158 | |||
| 1935 | Ga0395899_0056216 | |||
| 1936 | Ga0395899_0060985 | |||
| 1937 | Ga0395899_0077652 | |||
| 1938 | Ga0395899_0081177 | |||
| 1939 | Ga0395899_0096108 | |||
| 1940 | Ga0395899_0145793 | |||
| 1941 | Ga0395899_0178560 | |||
| 1942 | Ga0395900_0000936 | |||
| 1943 | Ga0395900_0001219 | |||
| 1944 | Ga0395900_0001485 | |||
| 1945 | Ga0395900_0001640 | |||
| 1946 | Ga0395900_0004351 | |||
| 1947 | Ga0395900_0004452 | |||
| 1948 | Ga0395900_0011047 | |||
| 1949 | Ga0395900_0011339 | |||
| 1950 | Ga0395900_0027999 | |||
| 1951 | Ga0395900_0033901 | |||
| 1952 | Ga0395900_0041177 | |||
| 1953 | Ga0395900_0058494 | |||
| 1954 | Ga0395900_0061075 | |||
| 1955 | Ga0395900_0080051 | |||
| 1956 | Ga0395900_0083765 | |||
| 1957 | Ga0395900_0120566 | |||
| 1958 | Ga0395900_0132440 | |||
| 1959 | Ga0395900_0267924 | |||
| 1960 | Ga0395900_0367305 | |||
| 1961 | Ga0395900_0480990 | |||
| 1962 | Ga0395900_0620719 | |||
| 1963 | Ga0395898_0002883 | |||
| 1964 | Ga0395898_0004426 | |||
| 1965 | Ga0395898_0008367 | |||
| 1966 | Ga0395898_0009260 | |||
| 1967 | Ga0395898_0013090 | |||
| 1968 | Ga0395898_0013266 | |||
| 1969 | Ga0395898_0019282 | |||
| 1970 | Ga0395898_0020108 | |||
| 1971 | Ga0395898_0057411 | |||
| 1972 | Ga0395898_0058471 | |||
| 1973 | Ga0395898_0059459 | |||
| 1974 | Ga0395898_0097904 | |||
| 1975 | Ga0395898_0116892 | |||
| 1976 | Ga0395898_0121216 | |||
| 1977 | Ga0395898_0125066 | |||
| 1978 | Ga0395898_0136845 | |||
| 1979 | Ga0395898_0150134 | |||
| 1980 | Ga0395898_0248180 | |||
| 1981 | Ga0395898_0280186 | |||
| 1982 | Ga0395898_0306945 | |||
| 1983 | Ga0395898_0402794 | |||
| 1984 | Ga0395905_0000640 | |||
| 1985 | Ga0395905_0002737 | |||
| 1986 | Ga0395905_0003392 | |||
| 1987 | Ga0395905_0007797 | |||
| 1988 | Ga0395905_0010027 | |||
| 1989 | Ga0395905_0023445 | |||
| 1990 | Ga0395905_0028476 | |||
| 1991 | Ga0395905_0039598 | |||
| 1992 | Ga0395905_0050522 | |||
| 1993 | Ga0395905_0095756 | |||
| 1994 | Ga0395905_0117390 | |||
| 1995 | Ga0395905_0117981 | |||
| 1996 | Ga0395905_0136848 | |||
| 1997 | Ga0395905_0202542 | |||
| 1998 | Ga0395905_0244481 | |||
| 1999 | Ga0395905_0364732 | |||
| 2000 | Ga0395901_0000978 | |||
| 2001 | Ga0395901_0001841 | |||
| 2002 | Ga0395901_0002650 | |||
| 2003 | Ga0395901_0002692 | |||
| 2004 | Ga0395901_0003282 | |||
| 2005 | Ga0395901_0011802 | |||
| 2006 | Ga0395901_0016787 | |||
| 2007 | Ga0395901_0016998 | |||
| 2008 | Ga0395901_0017797 | |||
| 2009 | Ga0395901_0038275 | |||
| 2010 | Ga0395901_0058107 | |||
| 2011 | Ga0395901_0069330 | |||
| 2012 | Ga0395901_0081251 | |||
| 2013 | Ga0395901_0088306 | |||
| 2014 | Ga0395901_0107083 | |||
| 2015 | Ga0395901_0117408 | |||
| 2016 | Ga0395901_0204796 | |||
| 2017 | Ga0395901_0224804 | |||
| 2018 | Ga0395901_0228865 | |||
| 2019 | Ga0395901_0232023 | |||
| 2020 | Ga0395901_0282032 | |||
| 2021 | Ga0395901_0306187 | |||
| 2022 | Ga0395901_0338756 | |||
| 2023 | Ga0395901_0452715 | |||
| 2024 | Ga0436360_0072764 | |||
| 2025 | Ga0436360_0325104 | |||
| 2026 | Ga0436362_0000471 | |||
| 2027 | Ga0439453_0004034 | |||
| 2028 | Ga0439431_0004459 | |||
| 2029 | Ga0439433_0001788 | |||
| 2030 | Ga0439448_0010127 | |||
| 2031 | Ga0439448_0050964 | |||
| 2032 | Ga0439454_013683 | |||
| 2033 | Ga0439455_0052896 | |||
| 2034 | Ga0439446_0009779 | |||
| 2035 | Ga0439434_0026494 | |||
| 2036 | Ga0466969_0003306 | |||
| 2037 | Ga0466969_0027186 | |||
| 2038 | Ga0466972_0036719 | |||
| 2039 | Ga0466965_0023576 | |||
| 2040 | Ga0466965_0091376 | |||
| 2041 | Ga0466966_0008955 | |||
| 2042 | Ga0466966_0039067 | |||
| 2043 | Ga0466961_0016940 | |||
| 2044 | Ga0466961_0043432 | |||
| 2045 | Ga0466961_0061392 | |||
| 2046 | Ga0466961_0136160 | |||
| 2047 | Ga0466961_0185539 | |||
| 2048 | Ga0466963_0000095 | |||
| 2049 | Ga0466963_0000705 | |||
| 2050 | Ga0466963_0000857 | |||
| 2051 | Ga0466963_0008069 | |||
| 2052 | Ga0466963_0009173 | |||
| 2053 | Ga0466963_0011499 | |||
| 2054 | Ga0466963_0014736 | |||
| 2055 | Ga0466963_0018021 | |||
| 2056 | Ga0466963_0023819 | |||
| 2057 | Ga0466963_0028626 | |||
| 2058 | Ga0466963_0030330 | |||
| 2059 | Ga0466963_0037276 | |||
| 2060 | Ga0466963_0042093 | |||
| 2061 | Ga0466963_0078175 | |||
| 2062 | Ga0466963_0083799 | |||
| 2063 | Ga0466963_0163639 | |||
| 2064 | Ga0466963_0207139 | |||
| 2065 | Ga0466964_0001480 | |||
| 2066 | Ga0466964_0001981 | |||
| 2067 | Ga0466964_0007054 | |||
| 2068 | Ga0466964_0024500 | |||
| 2069 | Ga0466964_0025725 | |||
| 2070 | Ga0466964_0128097 | |||
| 2071 | Ga0466964_0130877 | |||
| 2072 | Ga0466964_0131755 | |||
| 2073 | Ga0466971_0003250 | |||
| 2074 | Ga0466971_0015522 | |||
| 2075 | Ga0466971_0020860 | |||
| 2076 | Ga0466971_0042634 | |||
| 2077 | Ga0466971_0042660 | |||
| 2078 | Ga0466971_0219805 | |||
| 2079 | Ga0466968_0002238 | |||
| 2080 | Ga0466968_0006491 | |||
| 2081 | Ga0466968_0018435 | |||
| 2082 | Ga0466968_0020838 | |||
| 2083 | Ga0466968_0033912 | |||
| 2084 | Ga0466968_0034595 | |||
| 2085 | Ga0466968_0044769 | |||
| 2086 | Ga0466968_0050752 | |||
| 2087 | Ga0466968_0066253 | |||
| 2088 | Ga0466970_0040086 | |||
| 2089 | Ga0466970_0108568 | |||
| 2090 | Ga0466957_0001672 | |||
| 2091 | Ga0466957_0002974 | |||
| 2092 | Ga0466957_0008669 | |||
| 2093 | Ga0466957_0015929 | |||
| 2094 | Ga0466957_0018921 | |||
| 2095 | Ga0466957_0033943 | |||
| 2096 | Ga0466957_0060142 | |||
| 2097 | Ga0466957_0096331 | |||
| 2098 | Ga0466957_0262522 | |||
| 2099 | Ga0466957_0423275 | |||
| 2100 | Ga0466960_0004411 | |||
| 2101 | Ga0466960_0044665 | |||
| 2102 | Ga0466960_0045687 | |||
| 2103 | Ga0466959_0002457 | |||
| 2104 | Ga0466959_0005223 | |||
| 2105 | Ga0466959_0014268 | |||
| 2106 | Ga0466959_0026055 | |||
| 2107 | Ga0466959_0036203 | |||
| 2108 | Ga0466959_0045680 | |||
| 2109 | Ga0466959_0081935 | |||
| 2110 | Ga0451576_0052216 | |||
| 2111 | Ga0466958_0002667 | |||
| 2112 | Ga0466958_0004618 | |||
| 2113 | Ga0466958_0007167 | |||
| 2114 | Ga0466958_0009418 | |||
| 2115 | Ga0466958_0013118 | |||
| 2116 | Ga0466958_0041087 | |||
| 2117 | Ga0466958_0042172 | |||
| 2118 | Ga0466958_0077821 | |||
| 2119 | Ga0466958_0086108 | |||
| 2120 | Ga0466958_0102836 | |||
| 2121 | Ga0466958_0185700 | |||
| 2122 | Ga0466958_0245978 | |||
| 2123 | Ga0466967_0002678 | |||
| 2124 | Ga0466967_0008051 | |||
| 2125 | Ga0466967_0015896 | |||
| 2126 | Ga0466967_0020790 | |||
| 2127 | Ga0466967_0025255 | |||
| 2128 | Ga0466967_0028485 | |||
| 2129 | Ga0466967_0029109 | |||
| 2130 | Ga0466967_0037568 | |||
| 2131 | Ga0466967_0043946 | |||
| 2132 | Ga0466967_0056030 | |||
| 2133 | Ga0466967_0056885 | |||
| 2134 | Ga0466967_0063628 | |||
| 2135 | Ga0466967_0080325 | |||
| 2136 | Ga0466967_0098860 | |||
| 2137 | Ga0466967_0102239 | |||
| 2138 | Ga0466967_0116645 | |||
| 2139 | Ga0466967_0123887 | |||
| 2140 | Ga0466967_0140917 | |||
| 2141 | Ga0466967_0157618 | |||
| 2142 | Ga0466967_0188657 | |||
| 2143 | Ga0466967_0212175 | |||
| 2144 | Ga0466967_0218654 | |||
| 2145 | Ga0466967_0218956 | |||
| 2146 | Ga0466967_0414494 | |||
| 2147 | Ga0466967_0594491 | |||
| 2148 | Ga0466967_0755032 | |||
| 2149 | Ga0495617_066573 | |||
| 2150 | Ga0495592_0000050 | |||
| 2151 | Ga0495592_0012008 | |||
| 2152 | Ga0495592_0027375 | |||
| 2153 | Ga0495603_0000081 | |||
| 2154 | Ga0495603_0005193 | |||
| 2155 | Ga0495603_0016668 | |||
| 2156 | Ga0495603_0022206 | |||
| 2157 | Ga0495629_0005211 | |||
| 2158 | Ga0495629_0154036 | |||
| 2159 | Ga0495641_0002133 | |||
| 2160 | Ga0495641_0005435 | |||
| 2161 | Ga0495651_0000028 | |||
| 2162 | Ga0495653_0005030 | |||
| 2163 | Ga0495653_0144677 | |||
| 2164 | Ga0495653_0168998 | |||
| 2165 | Ga0495653_0220685 | |||
| 2166 | Ga0495580_0013968 | |||
| 2167 | Ga0495580_0035292 | |||
| 2168 | Ga0495580_0286149 | |||
| 2169 | Ga0495582_0023069 | |||
| 2170 | Ga0495582_0027338 | |||
| 2171 | Ga0495582_0041322 | |||
| 2172 | Ga0495582_0067921 | |||
| 2173 | Ga0495605_0099798 | |||
| 2174 | Ga0495605_0101760 | |||
| 2175 | Ga0495639_0026021 | |||
| 2176 | Ga0495662_0030188 | |||
| 2177 | Ga0495664_0038850 | |||
| 2178 | Ga0495664_0206601 | |||
| 2179 | Ga0495584_0010750 | |||
| 2180 | Ga0495594_0000536 | |||
| 2181 | Ga0495596_0024479 | |||
| 2182 | Ga0495607_0032668 | |||
| 2183 | Ga0495608_0000555 | |||
| 2184 | Ga0495608_0006235 | |||
| 2185 | Ga0495608_0292274 | |||
| 2186 | Ga0495618_0011013 | |||
| 2187 | Ga0495618_0015268 | |||
| 2188 | Ga0495628_0000060 | |||
| 2189 | Ga0495628_0030989 | |||
| 2190 | Ga0495628_0217609 | |||
| 2191 | Ga0495628_0271208 | |||
| 2192 | Ga0495630_0004280 | |||
| 2193 | Ga0495630_0011832 | |||
| 2194 | Ga0495630_0043614 | |||
| 2195 | Ga0495630_0124813 | |||
| 2196 | Ga0495630_0127901 | |||
| 2197 | Ga0495663_0008292 | |||
| 2198 | Ga0495663_0063146 | |||
| 2199 | Ga0495666_0026341 | |||
| 2200 | Ga0495666_0164870 | |||
| 2201 | Ga0495652_0000969 | |||
| 2202 | Ga0495652_0020746 | |||
| 2203 | Ga0495652_0032336 | |||
| 2204 | Ga0495652_0034234 | |||
| 2205 | Ga0495652_0052975 | |||
| 2206 | Ga0495652_0276735 | |||
| 2207 | Ga0495652_0314676 | |||
| 2208 | Ga0495665_0004858 | |||
| 2209 | Ga0495665_0167412 | |||
| 2210 | Ga0495586_0000939 | |||
| 2211 | Ga0495587_0000062 | |||
| 2212 | Ga0495609_0117563 | |||
| 2213 | Ga0495645_0000207 | |||
| 2214 | Ga0495622_0051305 | |||
| 2215 | Ga0495667_0029836 | |||
| 2216 | Ga0495667_0112698 | |||
| 2217 | Ga0495667_0265183 | |||
| 2218 | Ga0495656_0003250 | |||
| 2219 | Ga0495656_0072527 | |||
| 2220 | Ga0495656_0116517 | |||
| 2221 | Ga0495634_0028969 | |||
| 2222 | Ga0495634_0057539 | |||
| 2223 | Ga0495634_0168833 | |||
| 2224 | Ga0495611_0023526 | |||
| 2225 | Ga0495611_0083262 | |||
| 2226 | Ga0495635_0011900 | |||
| 2227 | Ga0495635_0029948 | |||
| 2228 | Ga0495635_0042176 | |||
| 2229 | Ga0495659_0014611 | |||
| 2230 | Ga0495588_0001728 | |||
| 2231 | Ga0495588_0150921 | |||
| 2232 | Ga0495657_0080872 | |||
| 2233 | Ga0495657_0114462 | |||
| 2234 | Ga0495657_0190957 | |||
| 2235 | Ga0495599_0000202 | |||
| 2236 | Ga0495599_0008974 | |||
| 2237 | Ga0495599_0058776 | |||
| 2238 | Ga0495599_0103106 | |||
| 2239 | Ga0495623_0000230 | |||
| 2240 | Ga0495646_0002084 | |||
| 2241 | Ga0495646_0045703 | |||
| 2242 | Ga0495646_0104200 | |||
| 2243 | Ga0495647_0004336 | |||
| 2244 | Ga0495647_0077696 | |||
| 2245 | Ga0495658_0035274 | |||
| 2246 | Ga0495658_0154427 | |||
| 2247 | Ga0495613_0010552 | |||
| 2248 | Ga0495613_0051296 | |||
| 2249 | Ga0495613_0087671 | |||
| 2250 | Ga0495624_0057267 | |||
| 2251 | Ga0495670_0028098 | |||
| 2252 | Ga0495671_0184627 | |||
| 2253 | Ga0495589_0038852 | |||
| 2254 | Ga0495600_0084751 | |||
| 2255 | Ga0495600_0116039 | |||
| 2256 | Ga0495604_0000262 | |||
| 2257 | Ga0495604_0064035 | |||
| 2258 | Ga0495636_0038751 | |||
| 2259 | Ga0495674_0021386 | |||
| 2260 | Ga0495674_0250500 | |||
| 2261 | Ga0495674_0252040 | |||
| 2262 | Ga0495676_0043187 | |||
| 2263 | Ga0495676_0070438 | |||
| 2264 | Ga0495676_0140485 | |||
| 2265 | Ga0495680_0005532 | |||
| 2266 | Ga0495680_0018905 | |||
| 2267 | Ga0495680_0040961 | |||
| 2268 | Ga0495680_0042745 | |||
| 2269 | Ga0495680_0077775 | |||
| 2270 | Ga0495680_0390897 | |||
| 2271 | Ga0495675_0000020 | |||
| 2272 | Ga0495675_0108079 | |||
| 2273 | Ga0495677_0032216 | |||
| 2274 | Ga0495684_0004528 | |||
| 2275 | Ga0495684_0053036 | |||
| 2276 | Ga0495593_0004729 | |||
| 2277 | Ga0495602_0000222 | |||
| 2278 | Ga0495602_0053966 | |||
| 2279 | Ga0495614_0097223 | |||
| 2280 | Ga0495615_0031329 | |||
| 2281 | Ga0495626_0102451 | |||
| 2282 | Ga0496100_0002502 | |||
| 2283 | Ga0496100_0006709 | |||
| 2284 | Ga0496100_0006766 | |||
| 2285 | Ga0496100_0008560 | |||
| 2286 | Ga0496100_0009080 | |||
| 2287 | Ga0496100_0043658 | |||
| 2288 | Ga0496100_0070830 | |||
| 2289 | Ga0496100_0342833 | |||
| 2290 | Ga0496101_0001024 | |||
| 2291 | Ga0496101_0016140 | |||
| 2292 | Ga0496101_0025351 | |||
| 2293 | Ga0496101_0028829 | |||
| 2294 | Ga0496101_0064970 | |||
| 2295 | Ga0496101_0072660 | |||
| 2296 | Ga0496101_0102414 | |||
| 2297 | Ga0496101_0116271 | |||
| 2298 | Ga0496101_0125688 | |||
| 2299 | Ga0496101_0167865 | |||
| 2300 | Ga0496102_0004970 | |||
| 2301 | Ga0496102_0013068 | |||
| 2302 | Ga0496102_0022488 | |||
| 2303 | Ga0496102_0025477 | |||
| 2304 | Ga0496102_0036175 | |||
| 2305 | Ga0496102_0043978 | |||
| 2306 | Ga0496102_0046559 | |||
| 2307 | Ga0496102_0061013 | |||
| 2308 | Ga0496102_0063252 | |||
| 2309 | Ga0496102_0094431 | |||
| 2310 | Ga0496102_0121116 | |||
| 2311 | Ga0496102_0196366 | |||
| 2312 | Ga0496102_0225966 | |||
| 2313 | Ga0496102_0231194 | |||
| 2314 | Ga0496102_0262065 | |||
| 2315 | Ga0496102_0450957 | |||
| 2316 | Ga0496102_0501087 | |||
| 2317 | Ga0496103_0004988 | |||
| 2318 | Ga0496103_0009793 | |||
| 2319 | Ga0496103_0019236 | |||
| 2320 | Ga0496103_0021946 | |||
| 2321 | Ga0496103_0083990 | |||
| 2322 | Ga0496103_0105641 | |||
| 2323 | Ga0496103_0174562 | |||
| 2324 | Ga0496103_0267710 | |||
| 2325 | Ga0496104_0000332 | |||
| 2326 | Ga0496104_0000865 | |||
| 2327 | Ga0496104_0002338 | |||
| 2328 | Ga0496104_0004406 | |||
| 2329 | Ga0496104_0008182 | |||
| 2330 | Ga0496104_0008226 | |||
| 2331 | Ga0496104_0010957 | |||
| 2332 | Ga0496104_0016855 | |||
| 2333 | Ga0496104_0022478 | |||
| 2334 | Ga0496104_0054582 | |||
| 2335 | Ga0496104_0075027 | |||
| 2336 | Ga0496104_0088948 | |||
| 2337 | Ga0496104_0139359 | |||
| 2338 | Ga0496104_0150024 | |||
| 2339 | Ga0496104_0152100 | |||
| 2340 | Ga0496104_0173096 | |||
| 2341 | Ga0496104_0229696 | |||
| 2342 | Ga0496104_0446068 | |||
| 2343 | Ga0496104_0449124 | |||
| 2344 | Ga0496104_0532983 | |||
| 2345 | Ga0496105_0000775 | |||
| 2346 | Ga0496105_0001042 | |||
| 2347 | Ga0496105_0004368 | |||
| 2348 | Ga0496105_0005606 | |||
| 2349 | Ga0496105_0007386 | |||
| 2350 | Ga0496105_0008547 | |||
| 2351 | Ga0496105_0010597 | |||
| 2352 | Ga0496105_0027093 | |||
| 2353 | Ga0496105_0097710 | |||
| 2354 | Ga0496105_0187969 | |||
| 2355 | Ga0496105_0491751 | |||
| 2356 | Ga0496106_0013216 | |||
| 2357 | Ga0496106_0016169 | |||
| 2358 | Ga0496106_0025657 | |||
| 2359 | Ga0496106_0057285 | |||
| 2360 | Ga0496106_0058700 | |||
| 2361 | Ga0496106_0076878 | |||
| 2362 | Ga0496106_0093840 | |||
| 2363 | Ga0496106_0176575 | |||
| 2364 | Ga0496106_0429062 | |||
| 2365 | Ga0496106_0583175 | |||
| 2366 | Ga0496107_0000242 | |||
| 2367 | Ga0496107_0000832 | |||
| 2368 | Ga0496107_0001734 | |||
| 2369 | Ga0496107_0002291 | |||
| 2370 | Ga0496107_0004829 | |||
| 2371 | Ga0496107_0019833 | |||
| 2372 | Ga0496107_0051303 | |||
| 2373 | Ga0496107_0058503 | |||
| 2374 | Ga0496107_0080130 | |||
| 2375 | Ga0496107_0135016 | |||
| 2376 | Ga0496107_0141145 | |||
| 2377 | Ga0496107_0216437 | |||
| 2378 | Ga0496107_0241920 | |||
| 2379 | Ga0496107_0274605 | |||
| 2380 | Ga0496107_0396224 | |||
| 2381 | Ga0496108_0001121 | |||
| 2382 | Ga0496108_0001279 | |||
| 2383 | Ga0496108_0004022 | |||
| 2384 | Ga0496108_0005178 | |||
| 2385 | Ga0496108_0008931 | |||
| 2386 | Ga0496108_0018106 | |||
| 2387 | Ga0496108_0027191 | |||
| 2388 | Ga0496108_0028356 | |||
| 2389 | Ga0496108_0035181 | |||
| 2390 | Ga0496108_0068334 | |||
| 2391 | Ga0496108_0122086 | |||
| 2392 | Ga0496108_0229553 | |||
| 2393 | Ga0496108_0477317 | |||
| 2394 | Ga0496109_0000288 | |||
| 2395 | Ga0496109_0000534 | |||
| 2396 | Ga0496109_0001211 | |||
| 2397 | Ga0496109_0001239 | |||
| 2398 | Ga0496109_0001399 | |||
| 2399 | Ga0496109_0001931 | |||
| 2400 | Ga0496109_0009621 | |||
| 2401 | Ga0496109_0010449 | |||
| 2402 | Ga0496109_0018533 | |||
| 2403 | Ga0496109_0032272 | |||
| 2404 | Ga0496109_0043230 | |||
| 2405 | Ga0496109_0046067 | |||
| 2406 | Ga0496109_0053327 | |||
| 2407 | Ga0496109_0074982 | |||
| 2408 | Ga0496109_0118101 | |||
| 2409 | Ga0496109_0132805 | |||
| 2410 | Ga0496109_0191934 | |||
| 2411 | Ga0496109_0199773 | |||
| 2412 | Ga0496109_0208587 | |||
| 2413 | Ga0496109_0478094 | |||
| 2414 | Ga0496110_0000069 | |||
| 2415 | Ga0496110_0000769 | |||
| 2416 | Ga0496110_0000979 | |||
| 2417 | Ga0496110_0009023 | |||
| 2418 | Ga0496110_0010243 | |||
| 2419 | Ga0496110_0018239 | |||
| 2420 | Ga0496110_0020040 | |||
| 2421 | Ga0496110_0029541 | |||
| 2422 | Ga0496110_0035052 | |||
| 2423 | Ga0496110_0052227 | |||
| 2424 | Ga0496110_0069790 | |||
| 2425 | Ga0496110_0147469 | |||
| 2426 | Ga0496110_0150910 | |||
| 2427 | Ga0496110_0161352 | |||
| 2428 | Ga0496110_0183011 | |||
| 2429 | Ga0496110_0229563 | |||
| 2430 | Ga0496110_0257007 | |||
| 2431 | Ga0496110_0259524 | |||
| 2432 | Ga0496111_0000081 | |||
| 2433 | Ga0496111_0000204 | |||
| 2434 | Ga0496111_0001570 | |||
| 2435 | Ga0496111_0001689 | |||
| 2436 | Ga0496111_0003145 | |||
| 2437 | Ga0496111_0008085 | |||
| 2438 | Ga0496111_0017500 | |||
| 2439 | Ga0496111_0037818 | |||
| 2440 | Ga0496111_0061023 | |||
| 2441 | Ga0496111_0083224 | |||
| 2442 | Ga0496111_0085808 | |||
| 2443 | Ga0496111_0103382 | |||
| 2444 | Ga0496111_0142501 | |||
| 2445 | Ga0496111_0165467 | |||
| 2446 | Ga0496111_0167914 | |||
| 2447 | Ga0496111_0209459 | |||
| 2448 | Ga0496111_0238568 | |||
| 2449 | Ga0496111_0244438 | |||
| 2450 | Ga0496111_0246835 | |||
| 2451 | Ga0496111_0304007 | |||
| 2452 | Ga0496112_0000635 | |||
| 2453 | Ga0496112_0000670 | |||
| 2454 | Ga0496112_0001619 | |||
| 2455 | Ga0496112_0001889 | |||
| 2456 | Ga0496112_0003082 | |||
| 2457 | Ga0496112_0003473 | |||
| 2458 | Ga0496112_0003845 | |||
| 2459 | Ga0496112_0013900 | |||
| 2460 | Ga0496112_0036622 | |||
| 2461 | Ga0496112_0040719 | |||
| 2462 | Ga0496112_0040922 | |||
| 2463 | Ga0496112_0046708 | |||
| 2464 | Ga0496112_0069059 | |||
| 2465 | Ga0496112_0082681 | |||
| 2466 | Ga0496112_0113463 | |||
| 2467 | Ga0496112_0206666 | |||
| 2468 | Ga0496112_0490534 | |||
| 2469 | Ga0496112_0610800 | |||
| 2470 | Ga0496113_0036439 | |||
| 2471 | Ga0496113_0037069 | |||
| 2472 | Ga0496113_0040146 | |||
| 2473 | Ga0496113_0042126 | |||
| 2474 | Ga0496113_0055242 | |||
| 2475 | Ga0496113_0077332 | |||
| 2476 | Ga0496113_0081454 | |||
| 2477 | Ga0496113_0097482 | |||
| 2478 | Ga0496113_0153473 | |||
| 2479 | Ga0496113_0279582 | |||
| 2480 | Ga0496113_0370089 | |||
| 2481 | Ga0496113_0372603 | |||
| 2482 | Ga0496113_0424973 | |||
| 2483 | Ga0496114_0000892 | |||
| 2484 | Ga0496114_0002615 | |||
| 2485 | Ga0496114_0003773 | |||
| 2486 | Ga0496114_0008778 | |||
| 2487 | Ga0496114_0009938 | |||
| 2488 | Ga0496114_0017227 | |||
| 2489 | Ga0496114_0026677 | |||
| 2490 | Ga0496114_0032949 | |||
| 2491 | Ga0496114_0045010 | |||
| 2492 | Ga0496114_0047790 | |||
| 2493 | Ga0496114_0072617 | |||
| 2494 | Ga0496114_0080691 | |||
| 2495 | Ga0496114_0248391 | |||
| 2496 | Ga0496114_0267765 | |||
| 2497 | Ga0496114_0284462 | |||
| 2498 | Ga0496115_0000701 | |||
| 2499 | Ga0496115_0002745 | |||
| 2500 | Ga0496115_0005064 | |||
| 2501 | Ga0496115_0013798 | |||
| 2502 | Ga0496115_0033855 | |||
| 2503 | Ga0496115_0059075 | |||
| 2504 | Ga0496115_0095223 | |||
| 2505 | Ga0496115_0162000 | |||
| 2506 | Ga0496115_0182909 | |||
| 2507 | Ga0496115_0320269 | |||
| 2508 | Ga0496115_0338337 | |||
| 2509 | Ga0496115_0354123 | |||
| 2510 | Ga0496115_0501915 | |||
| 2511 | Ga0496126_0014653 | |||
| 2512 | Ga0501031_0008694 | |||
| 2513 | Ga0501032_0008127 | |||
| 2514 | Ga0501033_0068861 | |||
| 2515 | Ga0501033_0111765 | |||
| 2516 | Ga0501034_0039223 | |||
| 2517 | Ga0501034_0058838 | |||
| 2518 | Ga0501036_0020205 | |||
| 2519 | Ga0501037_0061310 | |||
| 2520 | Ga0501037_0281014 | |||
| 2521 | Ga0501038_0045995 | |||
| 2522 | Ga0501039_0017278 | |||
| 2523 | Ga0501040_0001448 | |||
| 2524 | Ga0501040_0297682 | |||
| 2525 | Ga0501041_0002807 | |||
| 2526 | Ga0501041_0019626 | |||
| 2527 | Ga0501042_0011934 | |||
| 2528 | Ga0501042_0046216 | |||
| 2529 | Ga0501046_0000977 | |||
| 2530 | Ga0501047_0009198 | |||
| 2531 | Ga0501047_0009775 | |||
| 2532 | Ga0501047_0014688 | |||
| 2533 | Ga0501047_0152280 | |||
| 2534 | Ga0501047_0226916 | |||
| 2535 | Ga0501047_0242187 | |||
| 2536 | Ga0501048_0002843 | |||
| 2537 | Ga0501067_0068439 | |||
| 2538 | Ga0501068_0004782 | |||
| 2539 | Ga0501069_0020417 | |||
| 2540 | Ga0501069_0045548 | |||
| 2541 | Ga0501069_0055909 | |||
| 2542 | Ga0501069_0071570 | |||
| 2543 | Ga0501070_0000805 | |||
| 2544 | Ga0501070_0055530 | |||
| 2545 | Ga0501070_0219956 | |||
| 2546 | Ga0501070_0243302 | |||
| 2547 | Ga0501071_0035652 | |||
| 2548 | Ga0501071_0074619 | |||
| 2549 | Ga0501071_0169374 | |||
| 2550 | Ga0501072_0003411 | |||
| 2551 | Ga0501072_0254153 | |||
| 2552 | Ga0501072_0298827 | |||
| 2553 | Ga0501072_0299805 | |||
| 2554 | Ga0501074_0008458 | |||
| 2555 | Ga0501074_0020418 | |||
| 2556 | Ga0501074_0131376 | |||
| 2557 | Ga0501076_0002835 | |||
| 2558 | Ga0501077_0002484 | |||
| 2559 | Ga0501077_0007845 | |||
| 2560 | Ga0501077_0274233 | |||
| 2561 | Ga0501209_026745 | |||
| 2562 | Ga0501079_0001222 | |||
| 2563 | Ga0501079_0009336 | |||
| 2564 | Ga0501079_0053739 | |||
| 2565 | Ga0501079_0198124 | |||
| 2566 | Ga0501080_0015795 | |||
| 2567 | Ga0501080_0031460 | |||
| 2568 | Ga0501080_0067996 | |||
| 2569 | Ga0501080_0262950 | |||
| 2570 | Ga0501081_0004722 | |||
| 2571 | Ga0501081_0047579 | |||
| 2572 | Ga0501083_0002114 | |||
| 2573 | Ga0501083_0010944 | |||
| 2574 | Ga0501083_0067448 | |||
| 2575 | Ga0501044_0046555 | |||
| 2576 | Ga0501044_0343162 | |||
| 2577 | Ga0501044_0367068 | |||
| 2578 | Ga0501045_0002001 | |||
| 2579 | Ga0501045_0076746 | |||
| 2580 | nmdc:mga0yw44_43770_c2 | |||
| 2581 | nmdc:mga05p37_1712_c1 | |||
| 2582 | nmdc:mga05p37_211685_c1 | |||
| 2583 | nmdc:mga05p37_25384_c1 | |||
| 2584 | nmdc:mga05p37_354762_c1 | |||
| 2585 | nmdc:mga05p37_413569_c1 | |||
| 2586 | nmdc:mga06r32_163303_c1 | |||
| 2587 | nmdc:mga06r32_299926_c1 | |||
| 2588 | nmdc:mga06r32_450801_c1 | |||
| 2589 | nmdc:mga06r32_654237_c1 | |||
| 2590 | nmdc:mga08y16_150129_c1 | |||
| 2591 | nmdc:mga08y16_24505_c1 | |||
| 2592 | nmdc:mga08y16_553167_c1 | |||
| 2593 | nmdc:mga08y16_644016_c1 | |||
| 2594 | nmdc:mga08y16_715336_c1 | |||
| 2595 | nmdc:mga08y16_9150_c1 | |||
| 2596 | nmdc:mga0n895_12180_c1 | |||
| 2597 | nmdc:mga0n895_379557_c1 | |||
| 2598 | nmdc:mga0n895_481382_c1 | |||
| 2599 | nmdc:mga0n895_515970_c1 | |||
| 2600 | nmdc:mga0n895_669600_c1 | |||
| 2601 | nmdc:mga0n895_7295_c1 | |||
| 2602 | nmdc:mga0rr50_34687_c1 | |||
| 2603 | nmdc:mga0rr50_61838_c1 | |||
| 2604 | nmdc:mga0rr50_76794_c1 | |||
| 2605 | nmdc:mga08x19_45480_c2 | |||
| 2606 | nmdc:mga08x19_8065_c1 | |||
| 2607 | nmdc:mga08x19_8700_c1 | |||
| 2608 | nmdc:mga08x19_9813_c1 | |||
| 2609 | nmdc:mga0a205_189643_c1 | |||
| 2610 | nmdc:mga0a205_209122_c1 | |||
| 2611 | nmdc:mga0a205_336084_c1 | |||
| 2612 | nmdc:mga0a205_36751_c1 | |||
| 2613 | Ga0495601_0000218 | |||
| 2614 | Ga0495601_0053536 | |||
| 2615 | Ga0495601_0116292 | |||
| 2616 | Ga0495612_0007074 | |||
| 2617 | Ga0495612_0056557 | |||
| 2618 | Ga0495655_0000400 | |||
| 2619 | Ga0495595_0004838 | |||
| 2620 | Ga0495595_0013345 | |||
| 2621 | Ga0495595_0030875 | |||
| 2622 | Ga0495619_0011100 | |||
| 2623 | Ga0495619_0026262 | |||
| 2624 | Ga0495619_0066626 | |||
| 2625 | Ga0495619_0083344 | |||
| 2626 | Ga0495619_0102697 | |||
| 2627 | Ga0495619_0187354 | |||
| 2628 | Ga0495619_0226748 | |||
| 2629 | Ga0500566_0054705 | |||
| 2630 | Ga0501084_0052612 | |||
| 2631 | Ga0501084_0153946 | |||
| 2632 | Ga0501084_0421059 | |||
| 2633 | Ga0590075_023342 | |||
| 2634 | Ga0501082_0000690 | |||
| 2635 | Ga0501082_0055589 | |||
| 2636 | Ga0501082_0189328 | |||
| 2637 | Ga0501082_0679284 | |||
| 2638 | Ga0466962_0000096 | |||
| 2639 | Ga0466962_0001445 | |||
| 2640 | Ga0466962_0003609 | |||
| 2641 | Ga0466962_0007666 | |||
| 2642 | Ga0466962_0007812 | |||
| 2643 | Ga0466962_0050879 | |||
| 2644 | Ga0466962_0059336 | |||
| 2645 | Ga0466962_0062716 | |||
| 2646 | Ga0466962_0110360 | |||
| 2647 | Ga0530510_0000474 | |||
| 2648 | Ga0530510_0005435 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4od4-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8987 | 18 | 283 |
| 4od4-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8674 | 18 | 283 |
| 4tq4-assembly3.cif.gz_C | structure of a ubia homolog from archaeoglobus fulgidus bound to dmapp and mg2+ | 0.8061 | 11 | 283 |
| 4tq6-assembly2.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.7718 | 11 | 288 |
| 4tq3-assembly1.cif.gz_A | structure of a ubia homolog from archaeoglobus fulgidus bound to gpp and mg2+ | 0.7697 | 11 | 288 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AGK1_23_169_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.9395 | 21 | 162 | 1.10.357.140 |
| 4od5A01 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.9369 | 18 | 160 | 1.10.357.140 |
| af_A4I0M3_131_276_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.9321 | 21 | 162 | 1.10.357.140 |
| af_F1LVF4_158_307_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.9272 | 16 | 162 | 1.10.357.140 |
| af_Q66JT7_234_356_1.20.120.1780 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase | 0.9163 | 167 | 288 | 1.20.120.1780 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V2SLM7-F1-model_v4 | deleted | 0.9944 | 5 | 220 |
|
| AF-A0A7V3WHU1-F1-model_v4 | 4-hydroxybenzoate octaprenyltransferase | 0.9894 | 5 | 196 |
GO:0005886
GO:0006744 GO:0016765 |
| AF-A0A2U1RZI6-F1-model_v4 | 4-hydroxybenzoate octaprenyltransferase | 0.9849 | 5 | 223 |
GO:0005886
GO:0006744 GO:0016765 |
| AF-A0A2E9DAM5-F1-model_v4 | 4-hydroxybenzoate octaprenyltransferase | 0.9838 | 5 | 287 |
GO:0005886
GO:0006744 GO:0016765 |
| AF-A0A1H2URZ6-F1-model_v4 | 4-hydroxybenzoate polyprenyltransferase | 0.9837 | 6 | 286 |
GO:0005886
GO:0006744 GO:0016765 |