F492754

General Info

Members Datasets Scaffolds Average Seq Length
1301 486 1093 250

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10000133|Ga0105244_1000013355
Length 259
Sequence MSVFIASADQPLLARHNLADFESLWNIRLDAVDEPNTGRGGWSSVFRLDLDGQGFYLKRQSNYLTHTLHHPFGEPSFSREFRNISRYRKLGIPALQAVFYGERKVDGERRAILMTRALDGWTDLDELLQQWNQMEAAQRLAILHACGQLARTLHGAGQVHGCFYPKHIFLQAAGTGYQAQLIDLEKTRPVIFGKRDLARDLEPLLRRAPMWNEADRRELLAAYLQATPNSLLVDAWSARLGKRGAHKRDIQHRDDKETR

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231006 Pseudomonas sp. GM17 Isolate Nodule
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231008 Pseudomonas sp. GM21 Isolate Nodule
6 2511231011 Pseudomonas sp. GM30 Isolate Nodule
7 2511231012 Pseudomonas sp. GM33 Isolate Nodule
8 2511231014 Pseudomonas sp. GM48 Isolate Nodule
9 2511231015 Pseudomonas sp. GM49 Isolate Nodule
10 2511231016 Pseudomonas sp. GM50 Isolate Nodule
11 2511231017 Pseudomonas sp. GM55 Isolate Nodule
12 2511231020 Pseudomonas sp. GM74 Isolate Nodule
13 2511231023 Pseudomonas sp. GM80 Isolate Nodule
14 2511231024 Pseudomonas sp. GM84 Isolate Nodule
15 2511231031 Pseudomonas sp. GM16 Isolate Nodule
16 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
17 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
18 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
19 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
20 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
21 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
22 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
23 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
24 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
25 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
26 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
27 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
28 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
29 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
30 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
31 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
32 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
33 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
34 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
35 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
36 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
37 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
38 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
39 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
40 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
41 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
42 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
43 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
44 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
45 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
46 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
47 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
48 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
49 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
50 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
51 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
52 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
53 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
54 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
55 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
56 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
57 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
58 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
59 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
60 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
61 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
62 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
63 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
64 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
65 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
66 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
67 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
68 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
69 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
70 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
71 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
72 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
73 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
74 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
75 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
76 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
77 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
78 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
79 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
80 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
81 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
82 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
83 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
84 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
85 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
86 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
87 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
88 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
89 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
90 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
91 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
92 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
93 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
94 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
95 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
96 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
97 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
98 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
99 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
100 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
101 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
102 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
103 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
104 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
105 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
106 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
107 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
108 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
109 2765235841 Pseudomonas putida AA7 Isolate Unclassified
110 2773857673 Pseudomonas sp. 443 Isolate Unclassified
111 2784132063 Pseudomonas sp. 424 Isolate Unclassified
112 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
113 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
114 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
115 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
116 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
117 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
118 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
119 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
120 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
121 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
122 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
123 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
124 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
125 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
126 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
127 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
128 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
129 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
130 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
131 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
132 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
133 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
134 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
135 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
136 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
137 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
138 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
139 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
140 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
141 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
142 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
143 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
144 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
145 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
146 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
147 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
148 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
149 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
150 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
151 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
152 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
153 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
154 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
155 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
156 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
157 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
158 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
159 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
160 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
161 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
162 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
163 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
164 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
165 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
166 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
167 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
168 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
169 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
170 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
171 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
172 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
173 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
174 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
175 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
176 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
177 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
178 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
179 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
180 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
181 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
182 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
183 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
184 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
185 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
186 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
187 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
188 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
189 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
190 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
191 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
192 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
193 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
194 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
195 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
196 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
197 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
198 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
199 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
200 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
201 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
202 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
203 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
204 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
205 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
206 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
207 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
208 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
209 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
210 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
211 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
212 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
213 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
214 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
215 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
216 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
217 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
218 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
219 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
220 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
221 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
222 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
223 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
224 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
225 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
226 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
227 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
228 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
229 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
230 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
231 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
232 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
233 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
234 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
235 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
236 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
237 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
238 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
239 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
240 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
241 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
242 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
243 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
244 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
245 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
250 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
251 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
252 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
253 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
255 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
275 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
276 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
280 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
281 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
282 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
283 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
284 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
285 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
286 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
287 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
288 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
289 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
291 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
292 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
293 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
294 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
295 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
296 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
297 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
298 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
299 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
300 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
301 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
302 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
303 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
304 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
305 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
306 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
307 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
308 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
309 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
310 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
311 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
312 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
313 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
314 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
315 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
316 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
317 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
318 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
319 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
320 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
321 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
322 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
323 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
324 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
325 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
326 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
327 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
328 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
329 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
330 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
331 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
332 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
333 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
334 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
335 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
336 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
337 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
338 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
339 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
340 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
341 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
342 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
343 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
344 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
345 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
346 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
347 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
348 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
349 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
350 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
351 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
352 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
353 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
354 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
355 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
356 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
357 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
358 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
359 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
360 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
361 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
362 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
363 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
364 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
365 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
366 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
367 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
368 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
369 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
370 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
371 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
372 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
373 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
374 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
375 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
376 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
377 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
378 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
379 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
380 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
381 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
382 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
383 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
384 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
385 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
386 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
387 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
388 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
389 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
390 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
391 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
392 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
393 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
394 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
395 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
396 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
397 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
398 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
399 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
400 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
401 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
402 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
403 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
404 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
405 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
406 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
407 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
408 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
409 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
410 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
411 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
412 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
413 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
414 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
415 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
416 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
417 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
418 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
419 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
420 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
421 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
422 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
423 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
424 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
425 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
426 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
427 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
428 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
429 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
430 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
431 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
432 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
433 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
434 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
435 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
436 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
437 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
438 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
439 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
440 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
441 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
442 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
443 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
444 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
445 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
446 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
447 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
448 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
451 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
452 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
453 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
454 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
455 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
456 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
457 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
458 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
459 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
460 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
461 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
462 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
463 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
464 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
465 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
466 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
467 8052494512 Pseudomonas putida LD6 Isolate Unclassified
468 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
469 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
470 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
471 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
472 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
473 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
474 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
475 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
476 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
477 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
478 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
479 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
480 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
481 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
482 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
483 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
484 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
485 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
486 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.01
Metatranscriptomes 0
Isolates 15.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.23
Nodule 1.84
Rhizoplane 5.61
Rhizosphere 74.02
Stem 0
Stem Tuber 0
Unclassified 14.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_540 2124908027 Bacteria 2490
2 SwRhRL2b_contig_1465106 2162886007 Bacteria 1681
3 SwRhRL2b_contig_1764872 2162886007 Bacteria 2885
4 JGI25154J39366_1001521 3300002738 Bacteria 8060
5 JGI25163J39215_1000534 3300002771 Bacteria 11173
6 JGI25164J39214_1000148 3300002772 Bacteria 67382
7 JGI25165J46597_1000268 3300003214 Bacteria 67382
8 Ga0055538_1000037 3300003751 Bacteria 190238
9 Ga0055539_1000048 3300003752 Bacteria 190238
10 Ga0055533_1000059 3300003756 Bacteria 190238
11 Ga0055532_1000096 3300003758 Bacteria 98889
12 Ga0055525_1000189 3300003759 Bacteria 75207
13 Ga0055535_1006534 3300003761 Bacteria 2342
14 Ga0055536_1002298 3300003781 Bacteria 10840
15 Ga0055530_10000374 3300003791 Bacteria 40490
16 Ga0055530_10000913 3300003791 Bacteria 24257
17 Ga0055540_1000337 3300003792 Bacteria 40512
18 Ga0055540_1000657 3300003792 Bacteria 24257
19 Ga0055541_1000035 3300003841 Bacteria 190238
20 Ga0058692_1007720 3300003856 Bacteria 2831
21 Ga0065714_10004567 3300005288 Bacteria 6014
22 Ga0065714_10020298 3300005288 Bacteria 1584
23 Ga0065714_10066037 3300005288 Bacteria 7777
24 Ga0065714_10067559 3300005288 Bacteria 5377
25 Ga0065714_10094584 3300005288 Bacteria 1811
26 Ga0065704_10001014 3300005289 Bacteria 15257
27 Ga0065704_10095994 3300005289 Bacteria 2463
28 Ga0065712_10067752 3300005290 Bacteria 56880
29 Ga0065712_10069162 3300005290 Bacteria 7852
30 Ga0070670_100001434 3300005331 Bacteria 19186
31 Ga0070670_100014428 3300005331 Bacteria 6781
32 Ga0070661_100000078 3300005344 Bacteria 77449
33 Ga0070669_100001899 3300005353 Bacteria 15087
34 Ga0070669_100034370 3300005353 Bacteria 3670
35 Ga0070659_100084814 3300005366 Bacteria 2533
36 Ga0070662_100003973 3300005457 Bacteria 9269
37 Ga0070662_100040416 3300005457 Bacteria 3320
38 Ga0068853_100000210 3300005539 Bacteria 41425
39 Ga0070665_100017564 3300005548 Bacteria 7185
40 Ga0070665_100081599 3300005548 Bacteria 3239
41 Ga0070664_100007381 3300005564 Bacteria 8868
42 Ga0070664_100017832 3300005564 Bacteria 5830
43 Ga0068854_100002209 3300005578 Bacteria 11976
44 Ga0068851_10000004 3300005834 Bacteria 269685
45 Ga0075364_10184833 3300006051 Bacteria 1411
46 Ga0075364_10224019 3300006051 Bacteria 1277
47 Ga0075364_10270254 3300006051 Bacteria 1156
48 Ga0075432_10001130 3300006058 Bacteria 8534
49 Ga0075432_10015575 3300006058 Bacteria 2594
50 Ga0075432_10026479 3300006058 Bacteria 1992
51 Ga0075432_10043798 3300006058 Bacteria 1568
52 Ga0075432_10088766 3300006058 Bacteria 1129
53 Ga0075432_10170768 3300006058 Bacteria 845
54 Ga0075362_10009085 3300006177 Bacteria 3828
55 Ga0075362_10050360 3300006177 Bacteria 1862
56 Ga0075369_10087520 3300006186 Bacteria 1388
57 Ga0075436_100064791 3300006914 Bacteria 2526
58 Ga0075436_100521583 3300006914 Bacteria 870
59 Ga0099823_1000048 3300006944 Bacteria 58407
60 Ga0099823_1013050 3300006944 Bacteria 8383
61 Ga0079104_1000638 3300006946 Bacteria 34050
62 Ga0079104_1000654 3300006946 Bacteria 33184
63 Ga0099826_10018533 3300006948 Bacteria 5251
64 Ga0105251_10001807 3300009011 Bacteria 17747
65 Ga0105251_10003211 3300009011 Bacteria 12053
66 Ga0105251_10004126 3300009011 Bacteria 10143
67 Ga0105251_10004337 3300009011 Bacteria 9705
68 Ga0105251_10015549 3300009011 Bacteria 4154
69 Ga0105251_10020559 3300009011 Bacteria 3465
70 Ga0105251_10061909 3300009011 Bacteria 1759
71 Ga0105251_10065340 3300009011 Bacteria 1703
72 Ga0105251_10066069 3300009011 Bacteria 1692
73 Ga0105251_10067635 3300009011 Bacteria 1668
74 Ga0105244_10000133 3300009036 Bacteria 76114
75 Ga0105244_10001762 3300009036 Bacteria 17014
76 Ga0105244_10002007 3300009036 Bacteria 15687
77 Ga0105244_10002116 3300009036 Bacteria 15263
78 Ga0105244_10004326 3300009036 Bacteria 9821
79 Ga0105244_10005610 3300009036 Bacteria 8291
80 Ga0105244_10022008 3300009036 Bacteria 3515
81 Ga0105244_10025182 3300009036 Bacteria 3238
82 Ga0105244_10027037 3300009036 Bacteria 3098
83 Ga0105244_10035328 3300009036 Bacteria 2626
84 Ga0105244_10056199 3300009036 Bacteria 1993
85 Ga0105244_10057443 3300009036 Bacteria 1966
86 Ga0105244_10062960 3300009036 Bacteria 1863
87 Ga0105244_10088423 3300009036 Bacteria 1526
88 Ga0105244_10137131 3300009036 Bacteria 1179
89 Ga0105250_10000423 3300009092 Bacteria 30845
90 Ga0105250_10002533 3300009092 Bacteria 9139
91 Ga0105250_10002789 3300009092 Bacteria 8571
92 Ga0105250_10006222 3300009092 Bacteria 5239
93 Ga0105250_10080460 3300009092 Bacteria 1321
94 Ga0105243_10001058 3300009148 Bacteria 25181
95 Ga0105243_10001664 3300009148 Bacteria 19255
96 Ga0105243_10002290 3300009148 Bacteria 16053
97 Ga0105243_10007323 3300009148 Bacteria 8485
98 Ga0105243_10176636 3300009148 Bacteria 1854
99 Ga0105242_10004878 3300009176 Bacteria 10384
100 Ga0105248_10090654 3300009177 Bacteria 3443
101 Ga0105237_10007904 3300009545 Bacteria 11590
102 Ga0105237_10149704 3300009545 Bacteria 2330
103 Ga0105249_10949488 3300009553 Bacteria 928
104 Ga0105246_10000489 3300011119 Bacteria 21461
105 Ga0105246_10008716 3300011119 Bacteria 6240
106 Ga0157345_1000037 3300012498 Bacteria 32065
107 Ga0157373_10006181 3300013100 Bacteria 8949
108 Ga0157373_10008180 3300013100 Bacteria 7780
109 Ga0157373_10012146 3300013100 Bacteria 6332
110 Ga0157373_10022539 3300013100 Bacteria 4568
111 Ga0157373_10029077 3300013100 Bacteria 3984
112 Ga0157373_10032871 3300013100 Bacteria 3733
113 Ga0157373_10046190 3300013100 Bacteria 3108
114 Ga0157373_10049050 3300013100 Bacteria 3009
115 Ga0157373_10061019 3300013100 Bacteria 2671
116 Ga0157373_10151185 3300013100 Bacteria 1633
117 Ga0157373_10177552 3300013100 Bacteria 1499
118 Ga0157371_10000839 3300013102 Bacteria 35135
119 Ga0157371_10027480 3300013102 Bacteria 4127
120 Ga0157371_10051956 3300013102 Bacteria 2912
121 Ga0157371_10261010 3300013102 Bacteria 1249
122 Ga0157370_10014921 3300013104 Bacteria 7924
123 Ga0157370_10081362 3300013104 Bacteria 3047
124 Ga0157370_10206842 3300013104 Bacteria 1820
125 Ga0157370_10307829 3300013104 Bacteria 1462
126 Ga0157370_10448233 3300013104 Bacteria 1186
127 Ga0157369_10001610 3300013105 Bacteria 27627
128 Ga0157369_10008368 3300013105 Bacteria 11864
129 Ga0157369_10018752 3300013105 Bacteria 7756
130 Ga0157369_10032980 3300013105 Bacteria 5692
131 Ga0157369_10040248 3300013105 Bacteria 5103
132 Ga0157369_10158309 3300013105 Bacteria 2391
133 Ga0157369_10375365 3300013105 Bacteria 1476
134 Ga0157369_10894191 3300013105 Bacteria 911
135 Ga0163162_10001133 3300013306 Bacteria 24802
136 Ga0163162_10266616 3300013306 Bacteria 1844
137 Ga0157372_10000947 3300013307 Bacteria 31672
138 Ga0157372_10006103 3300013307 Bacteria 12802
139 Ga0157375_10001804 3300013308 Bacteria 18354
140 Ga0157375_10008927 3300013308 Bacteria 8771
141 Ga0157375_10015868 3300013308 Bacteria 6750
142 Ga0157375_10149094 3300013308 Bacteria 2473
143 Ga0157375_11109097 3300013308 Bacteria 926
144 Ga0182008_10000659 3300014497 Bacteria 25061
145 Ga0182008_10002039 3300014497 Bacteria 12961
146 Ga0182008_10005131 3300014497 Bacteria 7514
147 Ga0182008_10012107 3300014497 Bacteria 4562
148 Ga0182008_10012497 3300014497 Bacteria 4481
149 Ga0182008_10030243 3300014497 Bacteria 2730
150 Ga0182008_10043649 3300014497 Bacteria 2232
151 Ga0182006_1003547 3300015261 Bacteria 7954
152 Ga0182006_1003616 3300015261 Bacteria 7855
153 Ga0182006_1008819 3300015261 Bacteria 4557
154 Ga0182006_1012301 3300015261 Bacteria 3741
155 Ga0182006_1020170 3300015261 Bacteria 2796
156 Ga0182006_1039979 3300015261 Bacteria 1848
157 Ga0182006_1053598 3300015261 Bacteria 1545
158 Ga0182007_10003898 3300015262 Bacteria 6919
159 Ga0182007_10007513 3300015262 Bacteria 4563
160 Ga0182005_1004402 3300015265 Bacteria 4563
161 Ga0182005_1030131 3300015265 Bacteria 1479
162 Ga0182005_1033189 3300015265 Bacteria 1404
163 Ga0163161_10000624 3300017792 Bacteria 28312
164 Ga0163161_10010533 3300017792 Bacteria 6404
165 Ga0163161_10047538 3300017792 Bacteria 3098
166 Ga0163161_10201690 3300017792 Bacteria 1533
167 Ga0163161_10376536 3300017792 Bacteria 1134
168 Ga0209760_100215 3300025207 Bacteria 25872
169 Ga0209784_100028 3300025224 Bacteria 357464
170 Ga0209566_100028 3300025225 Bacteria 357464
171 Ga0209674_100047 3300025226 Bacteria 357464
172 Ga0209147_100031 3300025229 Bacteria 357464
173 Ga0209563_100050 3300025230 Bacteria 357464
174 Ga0209563_100488 3300025230 Bacteria 13416
175 Ga0207427_100014 3300025231 Bacteria 561361
176 Ga0209437_100016 3300025233 Bacteria 710118
177 Ga0209437_105032 3300025233 Bacteria 2280
178 Ga0209258_100150 3300025242 Bacteria 161813
179 Ga0209646_1000165 3300025246 Bacteria 88117
180 Ga0209677_100029 3300025253 Bacteria 357464
181 Ga0209233_1000036 3300025261 Bacteria 561361
182 Ga0209676_1000032 3300025292 Bacteria 469558
183 Ga0209676_1000326 3300025292 Bacteria 91787
184 Ga0209676_1001232 3300025292 Bacteria 27033
185 Ga0209676_1001980 3300025292 Bacteria 16312
186 Ga0209676_1015080 3300025292 Bacteria 2866
187 Ga0209050_1000025 3300025298 Bacteria 528225
188 Ga0209050_1000028 3300025298 Bacteria 477133
189 Ga0209050_1001079 3300025298 Bacteria 33360
190 Ga0209051_1000080 3300025303 Bacteria 199694
191 Ga0209051_1000334 3300025303 Bacteria 70713
192 Ga0209051_1003650 3300025303 Bacteria 9967
193 Ga0209257_1006869 3300025304 Bacteria 7142
194 Ga0207656_10000007 3300025321 Bacteria 289154
195 Ga0207696_1000057 3300025711 Bacteria 249404
196 Ga0207696_1000064 3300025711 Bacteria 238379
197 Ga0207696_1000229 3300025711 Bacteria 79025
198 Ga0207696_1003169 3300025711 Bacteria 7631
199 Ga0207696_1013025 3300025711 Bacteria 2917
200 Ga0207696_1018357 3300025711 Bacteria 2298
201 Ga0207655_1000014 3300025728 Bacteria 607124
202 Ga0207655_1000406 3300025728 Bacteria 59327
203 Ga0207655_1000565 3300025728 Bacteria 45949
204 Ga0207655_1000815 3300025728 Bacteria 33730
205 Ga0207655_1000922 3300025728 Bacteria 30542
206 Ga0207655_1001160 3300025728 Bacteria 25632
207 Ga0207655_1001818 3300025728 Bacteria 18454
208 Ga0207655_1002787 3300025728 Bacteria 13583
209 Ga0207655_1003594 3300025728 Bacteria 11465
210 Ga0207655_1003980 3300025728 Bacteria 10681
211 Ga0207655_1004144 3300025728 Bacteria 10411
212 Ga0207655_1005546 3300025728 Bacteria 8554
213 Ga0207655_1006369 3300025728 Bacteria 7834
214 Ga0207655_1010151 3300025728 Bacteria 5750
215 Ga0207655_1022645 3300025728 Bacteria 3141
216 Ga0207655_1031921 3300025728 Bacteria 2417
217 Ga0207655_1040099 3300025728 Bacteria 2026
218 Ga0207655_1041210 3300025728 Bacteria 1981
219 Ga0207655_1049466 3300025728 Bacteria 1716
220 Ga0207655_1071585 3300025728 Bacteria 1286
221 Ga0207713_1000031 3300025735 Bacteria 283971
222 Ga0207713_1000759 3300025735 Bacteria 30004
223 Ga0207713_1001119 3300025735 Bacteria 22843
224 Ga0207713_1001942 3300025735 Bacteria 15635
225 Ga0207713_1002040 3300025735 Bacteria 15118
226 Ga0207713_1003833 3300025735 Bacteria 10057
227 Ga0207713_1004233 3300025735 Bacteria 9386
228 Ga0207713_1012137 3300025735 Bacteria 4630
229 Ga0207713_1016374 3300025735 Bacteria 3764
230 Ga0207713_1037730 3300025735 Bacteria 2057
231 Ga0207713_1044022 3300025735 Bacteria 1839
232 Ga0207713_1115546 3300025735 Bacteria 906
233 Ga0207671_10000015 3300025914 Bacteria 439607
234 Ga0207671_10123450 3300025914 Bacteria 1981
235 Ga0207649_10000001 3300025920 Bacteria 537851
236 Ga0207681_10000480 3300025923 Bacteria 27941
237 Ga0207681_10021836 3300025923 Bacteria 4074
238 Ga0207681_10106403 3300025923 Bacteria 2033
239 Ga0207650_10000868 3300025925 Bacteria 22902
240 Ga0207650_10001058 3300025925 Bacteria 20465
241 Ga0207690_10070554 3300025932 Bacteria 2407
242 Ga0207706_10000624 3300025933 Bacteria 37622
243 Ga0207706_10006689 3300025933 Bacteria 10660
244 Ga0207686_10001543 3300025934 Bacteria 12987
245 Ga0207686_10237362 3300025934 Bacteria 1325
246 Ga0207709_10000022 3300025935 Bacteria 383573
247 Ga0207709_10000578 3300025935 Bacteria 30734
248 Ga0207709_10000971 3300025935 Bacteria 21405
249 Ga0207709_10009944 3300025935 Bacteria 5239
250 Ga0207709_10024304 3300025935 Bacteria 3459
251 Ga0207711_10066327 3300025941 Bacteria 3122
252 Ga0207679_10000011 3300025945 Bacteria 346112
253 Ga0207679_10511024 3300025945 Bacteria 1073
254 Ga0207639_10000706 3300026041 Bacteria 22900
255 Ga0209281_1000026 3300027111 Bacteria 465877
256 Ga0209281_1000033 3300027111 Bacteria 383539
257 Ga0209281_1004796 3300027111 Bacteria 3944
258 Ga0209389_1000095 3300027296 Bacteria 80518
259 Ga0209371_1000217 3300027312 Bacteria 77949
260 Ga0209371_1000380 3300027312 Bacteria 47577
261 Ga0209969_1008703 3300027360 Bacteria 1442
262 Ga0209981_1006694 3300027378 Bacteria 1546
263 Ga0209996_1001711 3300027395 Bacteria 2674
264 Ga0209995_1006297 3300027471 Bacteria 1907
265 Ga0209999_1020395 3300027543 Bacteria 1217
266 Ga0209982_1001176 3300027552 Bacteria 3520
267 Ga0209970_1022668 3300027614 Bacteria 1067
268 Ga0209983_1006729 3300027665 Bacteria 2359
269 Ga0209983_1043713 3300027665 Bacteria 972
270 Ga0209282_1048537 3300027666 Bacteria 2457
271 Ga0209971_1002229 3300027682 Bacteria 4694
272 Ga0209974_10006031 3300027876 Bacteria 4240
273 Ga0207428_10018345 3300027907 Bacteria 5979
274 Ga0207428_10032695 3300027907 Bacteria 4277
275 Ga0207428_10051303 3300027907 Bacteria 3298
276 Ga0207428_10099582 3300027907 Bacteria 2248
277 Ga0268266_10007054 3300028379 Bacteria 10203
278 Ga0307517_10046926 3300028786 Bacteria 4493
279 Ga0307515_10287028 3300028794 Bacteria 1346
280 Ga0268256_1000173 3300030500 Bacteria 77949
281 Ga0268256_1000428 3300030500 Bacteria 37773
282 Ga0307511_10055991 3300030521 Bacteria 3089
283 Ga0307511_10083045 3300030521 Bacteria 2235
284 Ga0316177_1136448 3300030731 Bacteria 3328
285 Ga0314311_1115640 3300030733 Bacteria 10318
286 Ga0316179_1116990 3300030734 Bacteria 5843
287 Ga0316178_1078135 3300030735 Bacteria 17093
288 Ga0316183_1053680 3300030742 Bacteria 4925
289 Ga0316183_1157733 3300030742 Bacteria 2868
290 Ga0307509_10497779 3300031507 Bacteria 904
291 Ga0307408_100000002 3300031548 Bacteria 827227
292 Ga0307408_100013668 3300031548 Bacteria 5391
293 Ga0307408_100025940 3300031548 Bacteria 4017
294 Ga0307408_100032095 3300031548 Bacteria 3661
295 Ga0307408_100040414 3300031548 Bacteria 3302
296 Ga0307408_100083810 3300031548 Bacteria 2389
297 Ga0307408_100169604 3300031548 Bacteria 1741
298 Ga0307408_100226140 3300031548 Bacteria 1529
299 Ga0307408_100518356 3300031548 Bacteria 1046
300 Ga0307516_10039930 3300031730 Bacteria 4674
301 Ga0307516_10297067 3300031730 Bacteria 1292
302 Ga0307405_10000474 3300031731 Bacteria 15078
303 Ga0307405_10009426 3300031731 Bacteria 5005
304 Ga0307405_10013191 3300031731 Bacteria 4402
305 Ga0307413_10052125 3300031824 Bacteria 2469
306 Ga0307413_10061646 3300031824 Bacteria 2315
307 Ga0307406_10053723 3300031901 Bacteria 2567
308 Ga0307407_10054914 3300031903 Bacteria 2299
309 Ga0307407_10166335 3300031903 Bacteria 1448
310 Ga0307412_10006654 3300031911 Bacteria 6549
311 Ga0307412_10012666 3300031911 Bacteria 4921
312 Ga0307412_10014146 3300031911 Bacteria 4698
313 Ga0307412_10016071 3300031911 Bacteria 4448
314 Ga0307412_10020189 3300031911 Bacteria 4051
315 Ga0307412_10060063 3300031911 Bacteria 2550
316 Ga0307409_100015570 3300031995 Bacteria 4996
317 Ga0307409_100017296 3300031995 Bacteria 4801
318 Ga0307416_100070455 3300032002 Bacteria 2899
319 Ga0307416_100199104 3300032002 Bacteria 1898
320 Ga0307416_100793822 3300032002 Bacteria 1042
321 Ga0307416_100951958 3300032002 Bacteria 960
322 Ga0307414_10002568 3300032004 Bacteria 9551
323 Ga0307414_10015030 3300032004 Bacteria 4662
324 Ga0307414_10027227 3300032004 Bacteria 3691
325 Ga0307414_10054038 3300032004 Bacteria 2804
326 Ga0307414_10126516 3300032004 Bacteria 1975
327 Ga0307414_10164504 3300032004 Bacteria 1766
328 Ga0307411_10010536 3300032005 Bacteria 4934
329 Ga0307411_10036524 3300032005 Bacteria 3079
330 Ga0307411_10102466 3300032005 Bacteria 2028
331 Ga0307411_10161157 3300032005 Bacteria 1680
332 Ga0307510_10003578 3300033180 Bacteria 18148
333 Ga0400490_60050 3300038726 Bacteria 3098
334 Ga0400485_15060 3300038735 Bacteria 9768
335 Ga0400488_51383 3300038741 Bacteria 6584
336 Ga0400486_08953 3300038742 Bacteria 19640
337 Ga0400486_30125 3300038742 Unclassified 1895
338 Ga0400483_016299 3300039062 Bacteria 5756
339 Ga0400483_063543 3300039062 Bacteria 2573
340 Ga0400483_178362 3300039062 Bacteria 3630
341 Ga0400489_85272 3300039093 Bacteria 6022
342 Ga0400487_25087 3300039110 Unclassified 1388
343 Ga0436363_1717883 3300039450 Bacteria 1072
344 Ga0439436_0000202 3300041404 Bacteria 14360
345 Ga0439438_000621 3300041405 Bacteria 15979
346 Ga0439438_003204 3300041405 Bacteria 6688
347 Ga0439438_004970 3300041405 Bacteria 4968
348 Ga0439438_005713 3300041405 Bacteria 4527
349 Ga0439438_006379 3300041405 Bacteria 4174
350 Ga0439438_006390 3300041405 Bacteria 4168
351 Ga0439438_008403 3300041405 Bacteria 3427
352 Ga0439447_000763 3300041407 Bacteria 11929
353 Ga0439447_004452 3300041407 Bacteria 4813
354 Ga0439447_005358 3300041407 Bacteria 4275
355 Ga0439447_006643 3300041407 Bacteria 3734
356 Ga0439447_016900 3300041407 Bacteria 1994
357 Ga0439447_037128 3300041407 Bacteria 1201
358 Ga0439466_0001219 3300041411 Bacteria 10013
359 Ga0439466_0001604 3300041411 Bacteria 8821
360 Ga0439466_0003680 3300041411 Bacteria 5918
361 Ga0439466_0007035 3300041411 Bacteria 4261
362 Ga0439466_0012287 3300041411 Bacteria 3157
363 Ga0439466_0013009 3300041411 Bacteria 3052
364 Ga0439466_0024657 3300041411 Bacteria 2106
365 Ga0439466_0024736 3300041411 Bacteria 2101
366 Ga0439466_0032823 3300041411 Bacteria 1767
367 Ga0439431_0002341 3300041997 Bacteria 4186
368 Ga0439445_0006292 3300042004 Bacteria 2727
369 Ga0439445_0008605 3300042004 Bacteria 2390
370 Ga0439432_000649 3300042006 Bacteria 13007
371 Ga0439432_001572 3300042006 Bacteria 8573
372 Ga0439432_002096 3300042006 Bacteria 7532
373 Ga0439432_006769 3300042006 Bacteria 4079
374 Ga0439432_006983 3300042006 Bacteria 4015
375 Ga0439432_019565 3300042006 Bacteria 2254
376 Ga0439432_026755 3300042006 Bacteria 1887
377 Ga0439432_027343 3300042006 Bacteria 1862
378 Ga0439451_004270 3300042009 Bacteria 2898
379 Ga0439451_005659 3300042009 Bacteria 2554
380 Ga0439451_006718 3300042009 Bacteria 2352
381 Ga0439451_009129 3300042009 Bacteria 2008
382 Ga0439452_000992 3300042010 Bacteria 12691
383 Ga0439452_002398 3300042010 Bacteria 6946
384 Ga0439452_008686 3300042010 Bacteria 3038
385 Ga0439452_008843 3300042010 Bacteria 3004
386 Ga0439452_011809 3300042010 Bacteria 2501
387 Ga0439456_000329 3300042013 Bacteria 10749
388 Ga0439456_004980 3300042013 Bacteria 2697
389 Ga0439456_009525 3300042013 Bacteria 2006
390 Ga0439456_014999 3300042013 Bacteria 1616
391 Ga0439456_034069 3300042013 Bacteria 1096
392 Ga0439463_000057 3300042016 Bacteria 23866
393 Ga0439463_001908 3300042016 Bacteria 5409
394 Ga0439463_014918 3300042016 Bacteria 1919
395 Ga0439463_021251 3300042016 Bacteria 1620
396 Ga0439463_036364 3300042016 Bacteria 1247
397 Ga0450911_000192 3300042115 Bacteria 24155
398 Ga0450911_003230 3300042115 Bacteria 2928
399 Ga0450919_006216 3300042121 Bacteria 1418
400 Ga0450920_006500 3300042122 Bacteria 2104
401 Ga0450921_000021 3300042123 Bacteria 3974
402 Ga0450922_000566 3300042124 Bacteria 3875
403 Ga0450922_001365 3300042124 Bacteria 2404
404 Ga0450923_001080 3300042125 Bacteria 3444
405 Ga0450923_007581 3300042125 Bacteria 1840
406 Ga0450900_000138 3300042136 Bacteria 4361
407 Ga0450902_002820 3300042137 Bacteria 2490
408 Ga0450903_004345 3300042138 Bacteria 2422
409 Ga0450904_002227 3300042139 Bacteria 2363
410 Ga0450905_000086 3300042142 Bacteria 8958
411 Ga0450905_001045 3300042142 Bacteria 3473
412 Ga0450905_011992 3300042142 Bacteria 1217
413 Ga0450906_002085 3300042145 Bacteria 4374
414 Ga0450906_019177 3300042145 Bacteria 1226
415 Ga0450907_002425 3300042146 Bacteria 3557
416 Ga0450907_011886 3300042146 Bacteria 1446
417 Ga0450907_013972 3300042146 Bacteria 1339
418 Ga0450910_002201 3300042147 Bacteria 2549
419 Ga0439446_0002511 3300042156 Bacteria 4413
420 Ga0439446_0022836 3300042156 Bacteria 1775
421 Ga0450909_001760 3300042185 Bacteria 3048
422 Ga0450909_003244 3300042185 Bacteria 2315
423 Ga0439434_0002067 3300042435 Bacteria 5797
424 Ga0439434_0015945 3300042435 Bacteria 2242
425 Ga0439464_0001991 3300042439 Bacteria 4949
426 Ga0439464_0004794 3300042439 Bacteria 3466
427 Ga0439460_0003385 3300042461 Bacteria 3857
428 Ga0439460_0044925 3300042461 Bacteria 1309
429 Ga0450918_013510 3300042531 Bacteria 1420
430 Ga0439440_0000861 3300042993 Bacteria 5303
431 Ga0495617_000900 3300046452 Bacteria 13927
432 Ga0495617_001444 3300046452 Bacteria 10436
433 Ga0495617_005638 3300046452 Bacteria 4427
434 Ga0495617_013843 3300046452 Bacteria 2743
435 Ga0495617_032809 3300046452 Bacteria 1743
436 Ga0495617_040468 3300046452 Bacteria 1558
437 Ga0495617_057721 3300046452 Bacteria 1286
438 Ga0495617_063492 3300046452 Bacteria 1219
439 Ga0495627_000529 3300046453 Bacteria 31618
440 Ga0495627_000662 3300046453 Bacteria 26550
441 Ga0495627_000811 3300046453 Bacteria 22857
442 Ga0495627_001567 3300046453 Bacteria 12984
443 Ga0495627_003516 3300046453 Bacteria 6866
444 Ga0495627_006948 3300046453 Bacteria 4392
445 Ga0495627_007132 3300046453 Bacteria 4319
446 Ga0495627_031799 3300046453 Bacteria 1664
447 Ga0495603_0023960 3300046455 Bacteria 3692
448 Ga0495603_0095554 3300046455 Bacteria 1736
449 Ga0495590_0002060 3300046457 Bacteria 8435
450 Ga0495590_0006040 3300046457 Bacteria 4749
451 Ga0495590_0007173 3300046457 Bacteria 4312
452 Ga0495590_0013729 3300046457 Bacteria 2972
453 Ga0495590_0015849 3300046457 Bacteria 2727
454 Ga0495591_000417 3300046458 Bacteria 35343
455 Ga0495591_000692 3300046458 Bacteria 24631
456 Ga0495591_004076 3300046458 Bacteria 7277
457 Ga0495591_004675 3300046458 Bacteria 6580
458 Ga0495591_005356 3300046458 Bacteria 5961
459 Ga0495591_006221 3300046458 Bacteria 5323
460 Ga0495591_007785 3300046458 Bacteria 4486
461 Ga0495591_008359 3300046458 Bacteria 4248
462 Ga0495591_010252 3300046458 Bacteria 3647
463 Ga0495591_014123 3300046458 Bacteria 2885
464 Ga0495591_014281 3300046458 Bacteria 2863
465 Ga0495591_017460 3300046458 Bacteria 2463
466 Ga0495591_022627 3300046458 Bacteria 2027
467 Ga0495591_025032 3300046458 Bacteria 1879
468 Ga0495638_0006393 3300046460 Bacteria 8578
469 Ga0495638_0023255 3300046460 Bacteria 4055
470 Ga0495638_0029363 3300046460 Bacteria 3545
471 Ga0495638_0031538 3300046460 Bacteria 3405
472 Ga0495638_0040012 3300046460 Bacteria 2972
473 Ga0495638_0044269 3300046460 Bacteria 2804
474 Ga0495638_0079396 3300046460 Bacteria 1995
475 Ga0495638_0094551 3300046460 Bacteria 1796
476 Ga0495638_0112069 3300046460 Bacteria 1619
477 Ga0495653_0023867 3300046463 Bacteria 4936
478 Ga0495653_0028038 3300046463 Bacteria 4506
479 Ga0495650_0006531 3300046471 Bacteria 7247
480 Ga0495650_0008276 3300046471 Bacteria 6093
481 Ga0495650_0008803 3300046471 Bacteria 5833
482 Ga0495650_0012860 3300046471 Bacteria 4470
483 Ga0495650_0013274 3300046471 Bacteria 4367
484 Ga0495650_0017190 3300046471 Bacteria 3632
485 Ga0495650_0044807 3300046471 Bacteria 1867
486 Ga0495650_0050278 3300046471 Bacteria 1724
487 Ga0495605_0000062 3300046474 Bacteria 143176
488 Ga0495605_0000646 3300046474 Bacteria 26667
489 Ga0495605_0001077 3300046474 Bacteria 18170
490 Ga0495605_0001339 3300046474 Bacteria 16304
491 Ga0495605_0001776 3300046474 Bacteria 13827
492 Ga0495605_0006187 3300046474 Bacteria 6903
493 Ga0495605_0009458 3300046474 Bacteria 5476
494 Ga0495605_0012296 3300046474 Bacteria 4751
495 Ga0495605_0015068 3300046474 Bacteria 4215
496 Ga0495605_0016679 3300046474 Bacteria 3971
497 Ga0495605_0019443 3300046474 Bacteria 3627
498 Ga0495605_0030925 3300046474 Bacteria 2739
499 Ga0495605_0071978 3300046474 Bacteria 1631
500 Ga0495605_0099032 3300046474 Bacteria 1342
501 Ga0495639_0001422 3300046475 Bacteria 10699
502 Ga0495639_0050385 3300046475 Bacteria 1891
503 Ga0495584_0002039 3300046491 Bacteria 11608
504 Ga0495584_0002652 3300046491 Bacteria 10067
505 Ga0495584_0002719 3300046491 Bacteria 9917
506 Ga0495584_0012017 3300046491 Bacteria 4426
507 Ga0495584_0022672 3300046491 Bacteria 3185
508 Ga0495584_0023484 3300046491 Bacteria 3126
509 Ga0495584_0024169 3300046491 Bacteria 3081
510 Ga0495584_0025701 3300046491 Bacteria 2985
511 Ga0495584_0032469 3300046491 Bacteria 2642
512 Ga0495585_0013923 3300046492 Bacteria 4697
513 Ga0495585_0017389 3300046492 Bacteria 4153
514 Ga0495585_0019417 3300046492 Bacteria 3918
515 Ga0495585_0024659 3300046492 Bacteria 3447
516 Ga0495585_0044316 3300046492 Bacteria 2485
517 Ga0495585_0093283 3300046492 Bacteria 1619
518 Ga0495585_0101357 3300046492 Bacteria 1539
519 Ga0495585_0115135 3300046492 Bacteria 1426
520 Ga0495585_0134065 3300046492 Bacteria 1301
521 Ga0495585_0273654 3300046492 Bacteria 836
522 Ga0495594_0001089 3300046499 Bacteria 14172
523 Ga0495594_0014895 3300046499 Bacteria 4081
524 Ga0495594_0042261 3300046499 Bacteria 2496
525 Ga0495596_0009975 3300046500 Bacteria 4156
526 Ga0495596_0029630 3300046500 Bacteria 2193
527 Ga0495596_0040968 3300046500 Bacteria 1827
528 Ga0495607_0000535 3300046501 Bacteria 37269
529 Ga0495607_0001879 3300046501 Bacteria 17817
530 Ga0495607_0002217 3300046501 Bacteria 16098
531 Ga0495607_0003116 3300046501 Bacteria 12867
532 Ga0495607_0003678 3300046501 Bacteria 11635
533 Ga0495607_0004041 3300046501 Bacteria 10998
534 Ga0495607_0005642 3300046501 Bacteria 8923
535 Ga0495607_0008061 3300046501 Bacteria 7232
536 Ga0495607_0008397 3300046501 Bacteria 7061
537 Ga0495607_0008623 3300046501 Bacteria 6954
538 Ga0495607_0016067 3300046501 Bacteria 4836
539 Ga0495607_0016115 3300046501 Bacteria 4827
540 Ga0495607_0021197 3300046501 Bacteria 4091
541 Ga0495607_0022358 3300046501 Bacteria 3973
542 Ga0495607_0024864 3300046501 Bacteria 3729
543 Ga0495607_0027840 3300046501 Bacteria 3490
544 Ga0495607_0035316 3300046501 Bacteria 3025
545 Ga0495607_0035669 3300046501 Bacteria 3006
546 Ga0495607_0035839 3300046501 Bacteria 2997
547 Ga0495607_0036473 3300046501 Bacteria 2961
548 Ga0495607_0040027 3300046501 Bacteria 2793
549 Ga0495607_0101147 3300046501 Bacteria 1543
550 Ga0495607_0118487 3300046501 Bacteria 1393
551 Ga0495607_0148017 3300046501 Bacteria 1204
552 Ga0495607_0158011 3300046501 Bacteria 1154
553 Ga0495607_0188238 3300046501 Bacteria 1030
554 Ga0495583_0000015 3300046506 Bacteria 316392
555 Ga0495583_0000821 3300046506 Bacteria 38030
556 Ga0495583_0001917 3300046506 Bacteria 19233
557 Ga0495583_0002771 3300046506 Bacteria 14454
558 Ga0495583_0002903 3300046506 Bacteria 13863
559 Ga0495583_0003231 3300046506 Bacteria 12739
560 Ga0495583_0003968 3300046506 Bacteria 10927
561 Ga0495583_0013052 3300046506 Bacteria 4661
562 Ga0495583_0021871 3300046506 Bacteria 3279
563 Ga0495583_0070392 3300046506 Bacteria 1538
564 Ga0495606_0000214 3300046507 Bacteria 103149
565 Ga0495606_0000352 3300046507 Bacteria 78743
566 Ga0495606_0008604 3300046507 Bacteria 8826
567 Ga0495606_0010283 3300046507 Bacteria 7788
568 Ga0495606_0016147 3300046507 Bacteria 5711
569 Ga0495606_0017442 3300046507 Bacteria 5429
570 Ga0495606_0018459 3300046507 Bacteria 5228
571 Ga0495606_0018966 3300046507 Bacteria 5139
572 Ga0495606_0029803 3300046507 Bacteria 3823
573 Ga0495606_0045423 3300046507 Bacteria 2911
574 Ga0495606_0054683 3300046507 Bacteria 2584
575 Ga0495606_0083043 3300046507 Bacteria 1987
576 Ga0495606_0087152 3300046507 Bacteria 1928
577 Ga0495610_0001409 3300046512 Bacteria 21314
578 Ga0495610_0007419 3300046512 Bacteria 7302
579 Ga0495610_0009058 3300046512 Bacteria 6344
580 Ga0495610_0013793 3300046512 Bacteria 4780
581 Ga0495610_0016903 3300046512 Bacteria 4179
582 Ga0495610_0017393 3300046512 Bacteria 4101
583 Ga0495610_0018833 3300046512 Bacteria 3881
584 Ga0495610_0029194 3300046512 Bacteria 2908
585 Ga0495610_0040845 3300046512 Bacteria 2333
586 Ga0495610_0043460 3300046512 Bacteria 2238
587 Ga0495610_0107702 3300046512 Bacteria 1238
588 Ga0495616_0002776 3300046513 Bacteria 11437
589 Ga0495616_0006934 3300046513 Bacteria 6821
590 Ga0495616_0007447 3300046513 Bacteria 6552
591 Ga0495616_0013570 3300046513 Bacteria 4589
592 Ga0495616_0014709 3300046513 Bacteria 4372
593 Ga0495616_0014717 3300046513 Bacteria 4369
594 Ga0495616_0026903 3300046513 Bacteria 3056
595 Ga0495616_0034667 3300046513 Bacteria 2618
596 Ga0495616_0069666 3300046513 Bacteria 1704
597 Ga0495620_0000033 3300046515 Bacteria 118157
598 Ga0495620_0000050 3300046515 Bacteria 105651
599 Ga0495620_0001299 3300046515 Bacteria 15205
600 Ga0495620_0001883 3300046515 Bacteria 12333
601 Ga0495620_0001955 3300046515 Bacteria 12067
602 Ga0495620_0014580 3300046515 Bacteria 3991
603 Ga0495620_0014816 3300046515 Bacteria 3951
604 Ga0495620_0018478 3300046515 Bacteria 3451
605 Ga0495620_0024034 3300046515 Bacteria 2904
606 Ga0495620_0025048 3300046515 Bacteria 2829
607 Ga0495620_0026656 3300046515 Bacteria 2715
608 Ga0495620_0106713 3300046515 Bacteria 1112
609 Ga0495620_0110020 3300046515 Bacteria 1092
610 Ga0495631_0001124 3300046518 Bacteria 16576
611 Ga0495631_0002205 3300046518 Bacteria 11203
612 Ga0495631_0002647 3300046518 Bacteria 9989
613 Ga0495631_0004919 3300046518 Bacteria 7041
614 Ga0495631_0015810 3300046518 Bacteria 3608
615 Ga0495631_0022043 3300046518 Bacteria 2962
616 Ga0495631_0030774 3300046518 Bacteria 2432
617 Ga0495631_0131461 3300046518 Bacteria 1075
618 Ga0495632_0000411 3300046519 Bacteria 40562
619 Ga0495632_0000919 3300046519 Bacteria 25838
620 Ga0495632_0001245 3300046519 Bacteria 21589
621 Ga0495632_0005948 3300046519 Bacteria 7949
622 Ga0495632_0015336 3300046519 Bacteria 4302
623 Ga0495632_0015397 3300046519 Bacteria 4290
624 Ga0495632_0020513 3300046519 Bacteria 3576
625 Ga0495632_0029326 3300046519 Bacteria 2866
626 Ga0495632_0034921 3300046519 Bacteria 2569
627 Ga0495632_0041423 3300046519 Bacteria 2314
628 Ga0495632_0055385 3300046519 Bacteria 1941
629 Ga0495632_0057487 3300046519 Bacteria 1898
630 Ga0495632_0114922 3300046519 Bacteria 1261
631 Ga0495632_0154919 3300046519 Bacteria 1058
632 Ga0495637_0000020 3300046520 Bacteria 181611
633 Ga0495637_0001280 3300046520 Bacteria 15160
634 Ga0495637_0001840 3300046520 Bacteria 12131
635 Ga0495637_0001968 3300046520 Bacteria 11609
636 Ga0495637_0006061 3300046520 Bacteria 6105
637 Ga0495637_0006923 3300046520 Bacteria 5656
638 Ga0495637_0014561 3300046520 Bacteria 3709
639 Ga0495637_0014633 3300046520 Bacteria 3697
640 Ga0495637_0015329 3300046520 Bacteria 3595
641 Ga0495637_0015667 3300046520 Bacteria 3556
642 Ga0495637_0018055 3300046520 Bacteria 3276
643 Ga0495637_0041090 3300046520 Bacteria 1986
644 Ga0495637_0043708 3300046520 Bacteria 1910
645 Ga0495637_0052733 3300046520 Bacteria 1696
646 Ga0495637_0065071 3300046520 Bacteria 1485
647 Ga0495637_0118924 3300046520 Bacteria 1018
648 Ga0495643_0000320 3300046522 Bacteria 66010
649 Ga0495643_0001218 3300046522 Bacteria 24887
650 Ga0495643_0004327 3300046522 Bacteria 9988
651 Ga0495643_0021725 3300046522 Bacteria 3674
652 Ga0495643_0022745 3300046522 Bacteria 3570
653 Ga0495643_0022942 3300046522 Bacteria 3552
654 Ga0495643_0088688 3300046522 Bacteria 1598
655 Ga0495643_0101346 3300046522 Bacteria 1475
656 Ga0495644_0004800 3300046523 Bacteria 5311
657 Ga0495644_0083901 3300046523 Bacteria 1201
658 Ga0495644_0106367 3300046523 Bacteria 1063
659 Ga0495648_0001594 3300046524 Bacteria 22104
660 Ga0495648_0003563 3300046524 Bacteria 13621
661 Ga0495648_0005817 3300046524 Bacteria 10157
662 Ga0495648_0011636 3300046524 Bacteria 6610
663 Ga0495648_0016613 3300046524 Bacteria 5299
664 Ga0495648_0016627 3300046524 Bacteria 5296
665 Ga0495648_0017390 3300046524 Bacteria 5141
666 Ga0495648_0020938 3300046524 Bacteria 4547
667 Ga0495648_0021864 3300046524 Bacteria 4417
668 Ga0495648_0024558 3300046524 Bacteria 4101
669 Ga0495648_0026749 3300046524 Bacteria 3877
670 Ga0495648_0029807 3300046524 Bacteria 3615
671 Ga0495648_0033225 3300046524 Bacteria 3372
672 Ga0495648_0104606 3300046524 Bacteria 1554
673 Ga0495648_0106166 3300046524 Bacteria 1538
674 Ga0495666_0017492 3300046526 Bacteria 3569
675 Ga0495666_0023671 3300046526 Bacteria 3037
676 Ga0495666_0038261 3300046526 Bacteria 2333
677 Ga0495642_0004922 3300046528 Bacteria 5149
678 Ga0495642_0005686 3300046528 Bacteria 4786
679 Ga0495652_0224785 3300046529 Bacteria 1408
680 Ga0495654_0001141 3300046530 Bacteria 19059
681 Ga0495654_0001487 3300046530 Bacteria 16035
682 Ga0495654_0002649 3300046530 Bacteria 11378
683 Ga0495654_0003927 3300046530 Bacteria 8978
684 Ga0495654_0004238 3300046530 Bacteria 8572
685 Ga0495654_0004593 3300046530 Bacteria 8153
686 Ga0495654_0009894 3300046530 Bacteria 5212
687 Ga0495654_0010887 3300046530 Bacteria 4941
688 Ga0495654_0011698 3300046530 Bacteria 4741
689 Ga0495654_0013026 3300046530 Bacteria 4455
690 Ga0495654_0014506 3300046530 Bacteria 4193
691 Ga0495654_0017585 3300046530 Bacteria 3755
692 Ga0495654_0024381 3300046530 Bacteria 3125
693 Ga0495654_0024611 3300046530 Bacteria 3109
694 Ga0495654_0024770 3300046530 Bacteria 3096
695 Ga0495654_0038507 3300046530 Bacteria 2390
696 Ga0495654_0053248 3300046530 Bacteria 1967
697 Ga0495654_0133051 3300046530 Bacteria 1114
698 Ga0495587_0024624 3300046536 Bacteria 3686
699 Ga0495609_0000143 3300046538 Bacteria 74412
700 Ga0495609_0000372 3300046538 Bacteria 38530
701 Ga0495609_0000461 3300046538 Bacteria 33185
702 Ga0495609_0002012 3300046538 Bacteria 12842
703 Ga0495609_0007912 3300046538 Bacteria 5253
704 Ga0495609_0009727 3300046538 Bacteria 4637
705 Ga0495609_0012135 3300046538 Bacteria 4089
706 Ga0495609_0036586 3300046538 Bacteria 2216
707 Ga0495609_0060380 3300046538 Bacteria 1676
708 Ga0495609_0080702 3300046538 Bacteria 1422
709 Ga0495609_0110548 3300046538 Bacteria 1186
710 Ga0495609_0142220 3300046538 Bacteria 1023
711 Ga0495609_0159029 3300046538 Bacteria 958
712 Ga0495597_0001205 3300046542 Bacteria 19346
713 Ga0495597_0001312 3300046542 Bacteria 18248
714 Ga0495597_0027032 3300046542 Bacteria 2633
715 Ga0495597_0051245 3300046542 Bacteria 1820
716 Ga0495597_0115660 3300046542 Bacteria 1121
717 Ga0495645_0046593 3300046543 Bacteria 3160
718 Ga0495645_0139413 3300046543 Bacteria 1693
719 Ga0495622_0003397 3300046557 Bacteria 7508
720 Ga0495622_0004267 3300046557 Bacteria 6652
721 Ga0495622_0016895 3300046557 Bacteria 3396
722 Ga0495622_0022545 3300046557 Bacteria 2935
723 Ga0495622_0077097 3300046557 Bacteria 1536
724 Ga0495633_0000084 3300046558 Bacteria 124972
725 Ga0495633_0002008 3300046558 Bacteria 14726
726 Ga0495633_0042381 3300046558 Bacteria 2162
727 Ga0495633_0050811 3300046558 Bacteria 1953
728 Ga0495633_0059785 3300046558 Bacteria 1786
729 Ga0495633_0081463 3300046558 Bacteria 1506
730 Ga0495633_0101063 3300046558 Bacteria 1338
731 Ga0495668_0016198 3300046616 Bacteria 4336
732 Ga0495668_0039081 3300046616 Bacteria 2649
733 Ga0495668_0048596 3300046616 Bacteria 2353
734 Ga0495668_0086471 3300046616 Bacteria 1719
735 Ga0495668_0111135 3300046616 Bacteria 1499
736 Ga0495634_0016154 3300046642 Bacteria 5342
737 Ga0495634_0034059 3300046642 Bacteria 3496
738 Ga0495611_0000246 3300046648 Bacteria 37614
739 Ga0495611_0000318 3300046648 Bacteria 32266
740 Ga0495611_0000910 3300046648 Bacteria 16008
741 Ga0495611_0012327 3300046648 Bacteria 3635
742 Ga0495611_0012423 3300046648 Bacteria 3621
743 Ga0495611_0039250 3300046648 Bacteria 2108
744 Ga0495611_0065125 3300046648 Bacteria 1660
745 Ga0495625_0000133 3300046660 Bacteria 115381
746 Ga0495625_0002266 3300046660 Bacteria 21142
747 Ga0495625_0016901 3300046660 Bacteria 5727
748 Ga0495625_0023380 3300046660 Bacteria 4721
749 Ga0495625_0024270 3300046660 Bacteria 4616
750 Ga0495625_0049514 3300046660 Bacteria 3020
751 Ga0495625_0068197 3300046660 Bacteria 2501
752 Ga0495625_0080567 3300046660 Bacteria 2267
753 Ga0495625_0082889 3300046660 Bacteria 2229
754 Ga0495625_0099666 3300046660 Bacteria 1997
755 Ga0495625_0134445 3300046660 Bacteria 1673
756 Ga0495625_0165042 3300046660 Bacteria 1481
757 Ga0495635_0020355 3300046663 Bacteria 4622
758 Ga0495659_0000898 3300046664 Bacteria 10597
759 Ga0495659_0015064 3300046664 Bacteria 2538
760 Ga0495659_0015433 3300046664 Bacteria 2511
761 Ga0495661_0000065 3300046665 Bacteria 129298
762 Ga0495661_0000370 3300046665 Bacteria 48701
763 Ga0495661_0000542 3300046665 Bacteria 39039
764 Ga0495661_0002713 3300046665 Bacteria 13493
765 Ga0495661_0004103 3300046665 Bacteria 10609
766 Ga0495661_0017257 3300046665 Bacteria 4768
767 Ga0495661_0020962 3300046665 Bacteria 4263
768 Ga0495661_0028388 3300046665 Bacteria 3582
769 Ga0495661_0037566 3300046665 Bacteria 3022
770 Ga0495661_0096538 3300046665 Bacteria 1671
771 Ga0495661_0139530 3300046665 Bacteria 1320
772 Ga0495588_0026370 3300046674 Bacteria 2900
773 Ga0495588_0038874 3300046674 Bacteria 2422
774 Ga0495588_0133844 3300046674 Bacteria 1308
775 Ga0495623_0014638 3300046679 Bacteria 5074
776 Ga0495646_0038893 3300046680 Bacteria 2934
777 Ga0495646_0042505 3300046680 Bacteria 2788
778 Ga0495669_0009543 3300046684 Bacteria 4095
779 Ga0495613_0036395 3300046689 Bacteria 3649
780 Ga0495613_0096462 3300046689 Bacteria 2138
781 Ga0495613_0246713 3300046689 Bacteria 1247
782 Ga0495624_0019569 3300046690 Bacteria 4515
783 Ga0495670_0000196 3300046691 Bacteria 27094
784 Ga0495670_0007919 3300046691 Bacteria 5224
785 Ga0495670_0008305 3300046691 Bacteria 5104
786 Ga0495670_0019556 3300046691 Bacteria 3335
787 Ga0495670_0043044 3300046691 Bacteria 2253
788 Ga0495670_0071733 3300046691 Bacteria 1754
789 Ga0495670_0155482 3300046691 Bacteria 1200
790 Ga0495670_0180922 3300046691 Bacteria 1113
791 Ga0495671_0001993 3300046692 Bacteria 13125
792 Ga0495671_0003014 3300046692 Bacteria 10471
793 Ga0495671_0005998 3300046692 Bacteria 7061
794 Ga0495671_0015164 3300046692 Bacteria 4136
795 Ga0495671_0016969 3300046692 Bacteria 3878
796 Ga0495671_0020083 3300046692 Bacteria 3524
797 Ga0495671_0026931 3300046692 Bacteria 2974
798 Ga0495671_0032740 3300046692 Bacteria 2652
799 Ga0495671_0037455 3300046692 Bacteria 2452
800 Ga0495671_0037575 3300046692 Bacteria 2448
801 Ga0495671_0077881 3300046692 Bacteria 1625
802 Ga0495671_0226931 3300046692 Bacteria 903
803 Ga0495649_0004325 3300046694 Bacteria 9315
804 Ga0495649_0005670 3300046694 Bacteria 7882
805 Ga0495649_0011853 3300046694 Bacteria 5097
806 Ga0495649_0015412 3300046694 Bacteria 4351
807 Ga0495649_0016436 3300046694 Bacteria 4192
808 Ga0495649_0016885 3300046694 Bacteria 4131
809 Ga0495649_0023537 3300046694 Bacteria 3440
810 Ga0495649_0026907 3300046694 Bacteria 3194
811 Ga0495649_0036840 3300046694 Bacteria 2686
812 Ga0495649_0050329 3300046694 Bacteria 2261
813 Ga0495649_0064061 3300046694 Bacteria 1974
814 Ga0495649_0095171 3300046694 Bacteria 1585
815 Ga0495649_0207827 3300046694 Bacteria 1015
816 Ga0495589_0000779 3300046794 Bacteria 20247
817 Ga0495589_0001384 3300046794 Bacteria 14107
818 Ga0495589_0001986 3300046794 Bacteria 11576
819 Ga0495589_0005362 3300046794 Bacteria 6767
820 Ga0495589_0012516 3300046794 Bacteria 4392
821 Ga0495589_0013358 3300046794 Bacteria 4237
822 Ga0495589_0016506 3300046794 Bacteria 3796
823 Ga0495589_0026167 3300046794 Bacteria 2957
824 Ga0495589_0067482 3300046794 Bacteria 1750
825 Ga0495589_0075021 3300046794 Bacteria 1649
826 Ga0495600_0029082 3300046809 Bacteria 3577
827 Ga0495660_0000797 3300046810 Bacteria 23640
828 Ga0495660_0002243 3300046810 Bacteria 12441
829 Ga0495660_0002803 3300046810 Bacteria 10979
830 Ga0495660_0008873 3300046810 Bacteria 5874
831 Ga0495660_0010257 3300046810 Bacteria 5447
832 Ga0495660_0020048 3300046810 Bacteria 3834
833 Ga0495660_0020182 3300046810 Bacteria 3819
834 Ga0495660_0022695 3300046810 Bacteria 3581
835 Ga0495660_0031653 3300046810 Bacteria 2974
836 Ga0495660_0040945 3300046810 Bacteria 2566
837 Ga0495660_0041129 3300046810 Bacteria 2560
838 Ga0495660_0056596 3300046810 Bacteria 2118
839 Ga0495660_0191448 3300046810 Bacteria 982
840 Ga0495581_0016653 3300047315 Bacteria 4273
841 Ga0495604_0074768 3300047317 Bacteria 2552
842 Ga0495636_0068344 3300047318 Bacteria 1512
843 Ga0495674_0026203 3300047319 Bacteria 5336
844 Ga0495672_0000763 3300047320 Bacteria 35066
845 Ga0495672_0006798 3300047320 Bacteria 8751
846 Ga0495672_0007247 3300047320 Bacteria 8366
847 Ga0495672_0017675 3300047320 Bacteria 4763
848 Ga0495672_0018132 3300047320 Bacteria 4684
849 Ga0495672_0022743 3300047320 Bacteria 4069
850 Ga0495672_0026683 3300047320 Bacteria 3681
851 Ga0495672_0028332 3300047320 Bacteria 3546
852 Ga0495672_0029664 3300047320 Bacteria 3441
853 Ga0495672_0033268 3300047320 Bacteria 3195
854 Ga0495672_0033865 3300047320 Bacteria 3162
855 Ga0495672_0038784 3300047320 Bacteria 2903
856 Ga0495672_0048938 3300047320 Bacteria 2505
857 Ga0495672_0055662 3300047320 Bacteria 2307
858 Ga0495672_0107078 3300047320 Bacteria 1506
859 Ga0495676_0000181 3300047321 Bacteria 49744
860 Ga0495676_0027747 3300047321 Bacteria 4850
861 Ga0495676_0034485 3300047321 Bacteria 4246
862 Ga0495680_0023975 3300047322 Bacteria 5068
863 Ga0495680_0031499 3300047322 Bacteria 4315
864 Ga0495680_0128016 3300047322 Bacteria 1868
865 Ga0495683_0000109 3300047323 Bacteria 84488
866 Ga0495683_0011206 3300047323 Bacteria 4723
867 Ga0495683_0012454 3300047323 Bacteria 4461
868 Ga0495683_0014543 3300047323 Bacteria 4100
869 Ga0495683_0017273 3300047323 Bacteria 3741
870 Ga0495683_0031175 3300047323 Bacteria 2717
871 Ga0495683_0057945 3300047323 Bacteria 1924
872 Ga0495683_0083113 3300047323 Bacteria 1559
873 Ga0495683_0089182 3300047323 Bacteria 1496
874 Ga0495683_0091486 3300047323 Bacteria 1473
875 Ga0495683_0097942 3300047323 Bacteria 1413
876 Ga0495683_0111518 3300047323 Bacteria 1305
877 Ga0495687_002205 3300047443 Bacteria 16130
878 Ga0495687_011390 3300047443 Bacteria 4789
879 Ga0495687_017368 3300047443 Bacteria 3592
880 Ga0495687_021739 3300047443 Bacteria 3095
881 Ga0495675_0023506 3300047444 Bacteria 3927
882 Ga0495679_000132 3300047446 Bacteria 66186
883 Ga0495679_001170 3300047446 Bacteria 15609
884 Ga0495679_001404 3300047446 Bacteria 13752
885 Ga0495679_004863 3300047446 Bacteria 6066
886 Ga0495679_009430 3300047446 Bacteria 3907
887 Ga0495679_009497 3300047446 Bacteria 3890
888 Ga0495679_011133 3300047446 Bacteria 3491
889 Ga0495679_013934 3300047446 Bacteria 2997
890 Ga0495679_048035 3300047446 Bacteria 1292
891 Ga0495685_006140 3300047447 Bacteria 3929
892 Ga0495673_0001604 3300047469 Bacteria 17602
893 Ga0495673_0002244 3300047469 Bacteria 13877
894 Ga0495673_0002585 3300047469 Bacteria 12600
895 Ga0495673_0002908 3300047469 Bacteria 11620
896 Ga0495673_0003031 3300047469 Bacteria 11314
897 Ga0495673_0007181 3300047469 Bacteria 6445
898 Ga0495673_0007528 3300047469 Bacteria 6239
899 Ga0495673_0010899 3300047469 Bacteria 4918
900 Ga0495673_0013618 3300047469 Bacteria 4261
901 Ga0495673_0016693 3300047469 Bacteria 3747
902 Ga0495673_0017586 3300047469 Bacteria 3624
903 Ga0495673_0030699 3300047469 Bacteria 2522
904 Ga0495673_0040906 3300047469 Bacteria 2090
905 Ga0495673_0077383 3300047469 Bacteria 1385
906 Ga0495673_0109790 3300047469 Bacteria 1104
907 Ga0495673_0119249 3300047469 Bacteria 1046
908 Ga0495681_0000608 3300047470 Bacteria 27382
909 Ga0495681_0001925 3300047470 Bacteria 15221
910 Ga0495681_0005164 3300047470 Bacteria 8786
911 Ga0495681_0009549 3300047470 Bacteria 5960
912 Ga0495681_0011171 3300047470 Bacteria 5374
913 Ga0495681_0011308 3300047470 Bacteria 5324
914 Ga0495681_0013682 3300047470 Bacteria 4694
915 Ga0495681_0013946 3300047470 Bacteria 4635
916 Ga0495681_0015218 3300047470 Bacteria 4361
917 Ga0495681_0023851 3300047470 Bacteria 3237
918 Ga0495681_0026196 3300047470 Bacteria 3040
919 Ga0495681_0031858 3300047470 Bacteria 2661
920 Ga0495681_0040042 3300047470 Bacteria 2284
921 Ga0495681_0062302 3300047470 Bacteria 1715
922 Ga0495681_0103775 3300047470 Bacteria 1239
923 Ga0495684_0036875 3300047471 Bacteria 3748
924 Ga0495686_0015884 3300047472 Bacteria 5120
925 Ga0495686_0026840 3300047472 Bacteria 3767
926 Ga0495686_0050489 3300047472 Bacteria 2613
927 Ga0495686_0080947 3300047472 Bacteria 1984
928 Ga0495686_0100527 3300047472 Bacteria 1744
929 Ga0495593_0020514 3300047673 Bacteria 3701
930 Ga0495593_0056814 3300047673 Bacteria 2056
931 Ga0495602_0041830 3300048088 Bacteria 4181
932 Ga0495602_0126370 3300048088 Bacteria 2048
933 Ga0495626_0000218 3300048091 Bacteria 68820
934 Ga0495626_0003946 3300048091 Bacteria 9273
935 Ga0495626_0004767 3300048091 Bacteria 8192
936 Ga0495626_0008938 3300048091 Bacteria 5438
937 Ga0495626_0010760 3300048091 Bacteria 4863
938 Ga0495626_0011220 3300048091 Bacteria 4745
939 Ga0495626_0016408 3300048091 Bacteria 3761
940 Ga0495626_0028826 3300048091 Bacteria 2688
941 Ga0495626_0068403 3300048091 Bacteria 1601
942 Ga0496100_0404148 3300048903 Bacteria 1041
943 Ga0496102_0022878 3300048905 Bacteria 5542
944 Ga0496102_0307138 3300048905 Bacteria 1495
945 Ga0496103_0014475 3300048906 Bacteria 4683
946 Ga0496106_0175324 3300048909 Bacteria 1701
947 Ga0496106_0338029 3300048909 Bacteria 1209
948 Ga0496107_0395273 3300048910 Bacteria 1028
949 Ga0496110_0139108 3300048913 Bacteria 2195
950 Ga0496111_0094806 3300048914 Bacteria 2189
951 Ga0496114_0037332 3300048917 Bacteria 4018
952 Ga0496115_0088224 3300048918 Bacteria 2532
953 Ga0496116_0000567 3300048919 Bacteria 49501
954 Ga0496116_0000699 3300048919 Bacteria 43452
955 Ga0496116_0005627 3300048919 Bacteria 11541
956 Ga0496116_0017648 3300048919 Bacteria 5530
957 Ga0496116_0018115 3300048919 Bacteria 5440
958 Ga0496116_0021247 3300048919 Bacteria 4900
959 Ga0496116_0032467 3300048919 Bacteria 3720
960 Ga0496116_0044587 3300048919 Bacteria 3010
961 Ga0496116_0167660 3300048919 Bacteria 1194
962 Ga0496117_0000970 3300048920 Bacteria 43943
963 Ga0496117_0003533 3300048920 Bacteria 18073
964 Ga0496117_0004132 3300048920 Bacteria 16242
965 Ga0496117_0005390 3300048920 Bacteria 13467
966 Ga0496117_0005662 3300048920 Bacteria 13025
967 Ga0496117_0019503 3300048920 Bacteria 5565
968 Ga0496117_0022678 3300048920 Bacteria 5028
969 Ga0496117_0046809 3300048920 Bacteria 3108
970 Ga0496117_0049246 3300048920 Bacteria 2999
971 Ga0496117_0067810 3300048920 Bacteria 2412
972 Ga0496117_0076958 3300048920 Bacteria 2209
973 Ga0496117_0082920 3300048920 Bacteria 2098
974 Ga0496117_0084966 3300048920 Bacteria 2062
975 Ga0496117_0129610 3300048920 Bacteria 1531
976 Ga0496117_0132791 3300048920 Bacteria 1505
977 Ga0496117_0231622 3300048920 Bacteria 1020
978 Ga0496118_0003741 3300048921 Bacteria 18811
979 Ga0496118_0006996 3300048921 Bacteria 12156
980 Ga0496118_0013161 3300048921 Bacteria 7850
981 Ga0496118_0027624 3300048921 Bacteria 4795
982 Ga0496118_0035067 3300048921 Bacteria 4081
983 Ga0496118_0038682 3300048921 Bacteria 3819
984 Ga0496118_0041588 3300048921 Bacteria 3636
985 Ga0496118_0047002 3300048921 Bacteria 3351
986 Ga0496118_0050421 3300048921 Bacteria 3194
987 Ga0496118_0054304 3300048921 Bacteria 3035
988 Ga0496118_0079652 3300048921 Bacteria 2310
989 Ga0496118_0104428 3300048921 Bacteria 1902
990 Ga0496118_0209951 3300048921 Bacteria 1143
991 Ga0496119_0000071 3300048922 Bacteria 153652
992 Ga0496119_0012870 3300048922 Bacteria 6740
993 Ga0496119_0018070 3300048922 Bacteria 5268
994 Ga0496119_0045801 3300048922 Bacteria 2738
995 Ga0496120_0001138 3300048923 Bacteria 34316
996 Ga0496120_0010521 3300048923 Bacteria 6446
997 Ga0496120_0015296 3300048923 Bacteria 5070
998 Ga0496120_0061911 3300048923 Bacteria 2086
999 Ga0496121_0001560 3300048924 Bacteria 38266
1000 Ga0496121_0001800 3300048924 Bacteria 34643
1001 Ga0496121_0002238 3300048924 Bacteria 30164
1002 Ga0496121_0017913 3300048924 Bacteria 7185
1003 Ga0496121_0022105 3300048924 Bacteria 6189
1004 Ga0496121_0034112 3300048924 Bacteria 4586
1005 Ga0496121_0051576 3300048924 Bacteria 3463
1006 Ga0496121_0064601 3300048924 Bacteria 2983
1007 Ga0496121_0100967 3300048924 Bacteria 2226
1008 Ga0496121_0103755 3300048924 Bacteria 2186
1009 Ga0496121_0290287 3300048924 Bacteria 1114
1010 Ga0496121_0425762 3300048924 Bacteria 862
1011 Ga0496122_0001196 3300048925 Bacteria 44299
1012 Ga0496122_0002157 3300048925 Bacteria 28836
1013 Ga0496122_0010986 3300048925 Bacteria 9253
1014 Ga0496122_0011862 3300048925 Bacteria 8759
1015 Ga0496122_0013092 3300048925 Bacteria 8165
1016 Ga0496122_0026651 3300048925 Bacteria 4973
1017 Ga0496122_0030146 3300048925 Bacteria 4554
1018 Ga0496122_0112687 3300048925 Bacteria 1780
1019 Ga0496122_0146723 3300048925 Bacteria 1464
1020 Ga0496122_0196875 3300048925 Bacteria 1182
1021 Ga0496123_0000594 3300048926 Bacteria 61368
1022 Ga0496123_0001464 3300048926 Bacteria 32764
1023 Ga0496123_0010203 3300048926 Bacteria 8335
1024 Ga0496123_0014657 3300048926 Bacteria 6479
1025 Ga0496123_0020924 3300048926 Bacteria 5099
1026 Ga0496123_0021000 3300048926 Bacteria 5089
1027 Ga0496123_0045647 3300048926 Bacteria 2982
1028 Ga0496123_0066389 3300048926 Bacteria 2285
1029 Ga0496123_0069627 3300048926 Bacteria 2207
1030 Ga0496124_0001266 3300048927 Bacteria 38461
1031 Ga0496124_0007109 3300048927 Bacteria 11986
1032 Ga0496124_0010051 3300048927 Bacteria 9651
1033 Ga0496124_0011281 3300048927 Bacteria 8945
1034 Ga0496124_0015327 3300048927 Bacteria 7355
1035 Ga0496124_0028965 3300048927 Bacteria 4943
1036 Ga0496124_0049689 3300048927 Bacteria 3576
1037 Ga0496124_0050723 3300048927 Bacteria 3534
1038 Ga0496124_0054961 3300048927 Bacteria 3367
1039 Ga0496124_0058314 3300048927 Bacteria 3248
1040 Ga0496124_0059149 3300048927 Bacteria 3220
1041 Ga0496124_0066815 3300048927 Bacteria 2993
1042 Ga0496124_0145107 3300048927 Bacteria 1868
1043 Ga0496124_0158153 3300048927 Bacteria 1769
1044 Ga0496124_0159552 3300048927 Bacteria 1759
1045 Ga0496124_0160345 3300048927 Bacteria 1753
1046 Ga0496124_0200465 3300048927 Bacteria 1518
1047 Ga0496125_0003386 3300048928 Bacteria 19397
1048 Ga0496125_0005700 3300048928 Bacteria 13731
1049 Ga0496125_0006235 3300048928 Bacteria 12966
1050 Ga0496125_0015371 3300048928 Bacteria 7408
1051 Ga0496125_0027647 3300048928 Bacteria 5137
1052 Ga0496125_0033709 3300048928 Bacteria 4526
1053 Ga0496125_0036209 3300048928 Bacteria 4313
1054 Ga0496125_0036277 3300048928 Bacteria 4309
1055 Ga0496125_0050898 3300048928 Bacteria 3423
1056 Ga0496125_0052457 3300048928 Bacteria 3353
1057 Ga0496125_0121994 3300048928 Bacteria 1856
1058 Ga0496125_0130661 3300048928 Bacteria 1769
1059 Ga0496125_0150298 3300048928 Bacteria 1601
1060 Ga0496126_0017913 3300048929 Bacteria 7046
1061 Ga0496126_0033815 3300048929 Bacteria 4808
1062 Ga0496126_0072120 3300048929 Bacteria 3072
1063 Ga0495678_000017 3300049459 Bacteria 282592
1064 Ga0495678_002786 3300049459 Bacteria 11404
1065 Ga0495678_004463 3300049459 Bacteria 8083
1066 Ga0495678_005530 3300049459 Bacteria 6949
1067 Ga0495678_005656 3300049459 Bacteria 6818
1068 Ga0495678_007223 3300049459 Bacteria 5786
1069 Ga0495678_008310 3300049459 Bacteria 5251
1070 Ga0495678_008395 3300049459 Bacteria 5212
1071 Ga0495678_010590 3300049459 Bacteria 4470
1072 Ga0495678_012667 3300049459 Bacteria 3989
1073 Ga0495678_013642 3300049459 Bacteria 3805
1074 Ga0495678_024836 3300049459 Bacteria 2582
1075 Ga0495682_0007167 3300049460 Bacteria 4455
1076 Ga0495682_0008498 3300049460 Bacteria 4041
1077 Ga0495682_0010677 3300049460 Bacteria 3548
1078 Ga0501032_0072466 3300049569 Bacteria 2296
1079 Ga0501034_0000165 3300049571 Bacteria 123084
1080 Ga0501222_000894 3300049662 Bacteria 4294
1081 Ga0501241_000551 3300049758 Bacteria 8051
1082 Ga0501226_001319 3300049853 Bacteria 3205
1083 nmdc:mga03683_33614_c1 3300050489 Bacteria 2071
1084 nmdc:mga00v17_107864_c1 3300050491 Bacteria 1764
1085 nmdc:mga00v17_141685_c1 3300050491 Bacteria 1542
1086 nmdc:mga00v17_296359_c1 3300050491 Bacteria 1050
1087 nmdc:mga08x19_250796_c1 3300050514 Bacteria 1222
1088 nmdc:mga08x19_513553_c1 3300050514 Bacteria 846
1089 Ga0500572_003714 3300053111 Bacteria 3463
1090 Ga0500659_0002861 3300053135 Bacteria 10319
1091 Ga0500573_0033947 3300053140 Bacteria 2943
1092 Ga0500589_104972 3300053147 Bacteria 1222
1093 Ga0500634_0028761 3300053161 Bacteria 3027

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025934 Ga0207686_10237362 Ga0207686_102373622 211
2 3300046501 Ga0495607_0101147 Ga0495607_0101147_462_1241 216
3 3300046507 Ga0495606_0087152 Ga0495606_0087152_818_1597 216
4 3300046491 Ga0495584_0023484 Ga0495584_0023484_2456_3115 219
5 3300050514 nmdc:mga08x19_513553_c1 nmdc:mga08x19_513553_c1_32_706 224
6 iso_pu_bacteria 640427133 640489786 229
7 3300048925 Ga0496122_0196875 Ga0496122_0196875_10_711 233
8 3300047320 Ga0495672_0055662 Ga0495672_0055662_1531_2277 235
9 3300014497 Ga0182008_10043649 Ga0182008_100436492 239
10 3300046512 Ga0495610_0107702 Ga0495610_0107702_508_1227 239
11 3300047470 Ga0495681_0011171 Ga0495681_0011171_4642_5361 239
12 3300053161 Ga0500634_0028761 Ga0500634_0028761_11_730 239
13 3300005290 Ga0065712_10067752 Ga0065712_1006775239 242
14 iso_pu_bacteria 3007252601 3007254631 243
15 iso_pu_bacteria 3007315729 3007316586 243
16 3300032004 Ga0307414_10002568 Ga0307414_100025685 246
17 3300046501 Ga0495607_0008061 Ga0495607_0008061_1427_2206 246
18 iso_pu_bacteria 2511231006 2511266075 246
19 iso_pu_bacteria 2511231007 2511272787 246
20 iso_pu_bacteria 2511231008 2511278869 246
21 iso_pu_bacteria 2511231011 2511297387 246
22 iso_pu_bacteria 2511231012 2511300142 246
23 iso_pu_bacteria 2511231014 2511316354 246
24 iso_pu_bacteria 2511231015 2511319410 246
25 iso_pu_bacteria 2511231016 2511323515 246
26 iso_pu_bacteria 2511231017 2511330954 246
27 iso_pu_bacteria 2511231020 2511349149 246
28 iso_pu_bacteria 2511231023 2511368955 246
29 iso_pu_bacteria 2511231024 2511376026 246
30 iso_pu_bacteria 2511231031 2511414334 246
31 iso_pu_bacteria 2511231156 2511822495 246
32 iso_pu_bacteria 2512047018 2512325990 246
33 iso_pu_bacteria 2554235231 2555247827 246
34 iso_pu_bacteria 2554235341 2555667464 246
35 iso_pu_bacteria 2582580891 2583789771 246
36 iso_pu_bacteria 2597489887 2597855695 246
37 iso_pu_bacteria 2597489888 2597861703 246
38 iso_pu_bacteria 2597489889 2597867426 246
39 iso_pu_bacteria 2599185155 2599327329 246
40 iso_pu_bacteria 2599185160 2599356685 246
41 iso_pu_bacteria 2599185161 2599363283 246
42 iso_pu_bacteria 2599185162 2599369765 246
43 iso_pu_bacteria 2599185163 2599376392 246
44 iso_pu_bacteria 2599185164 2599381790 246
45 iso_pu_bacteria 2599185165 2599388066 246
46 iso_pu_bacteria 2599185166 2599395410 246
47 iso_pu_bacteria 2599185167 2599398815 246
48 iso_pu_bacteria 2599185168 2599407175 246
49 iso_pu_bacteria 2599185179 2599450870 246
50 iso_pu_bacteria 2599185181 2599463518 246
51 iso_pu_bacteria 2599185182 2599469132 246
52 iso_pu_bacteria 2599185185 2599485597 246
53 iso_pu_bacteria 2599185186 2599492537 246
54 iso_pu_bacteria 2599185188 2599500069 246
55 iso_pu_bacteria 2599185189 2599506466 246
56 iso_pu_bacteria 2599185190 2599514184 246
57 iso_pu_bacteria 2599185191 2599518785 246
58 iso_pu_bacteria 2599185212 2599616656 246
59 iso_pu_bacteria 2599185248 2599769453 246
60 iso_pu_bacteria 2599185257 2599806726 246
61 iso_pu_bacteria 2599185288 2599883537 246
62 iso_pu_bacteria 2599185289 2599886873 246
63 iso_pu_bacteria 2599185290 2599893481 246
64 iso_pu_bacteria 2599185291 2599898202 246
65 iso_pu_bacteria 2599185300 2599930935 246
66 iso_pu_bacteria 2599185302 2599944686 246
67 iso_pu_bacteria 2599185303 2599950724 246
68 iso_pu_bacteria 2599185304 2599957306 246
69 iso_pu_bacteria 2599185305 2599962000 246
70 iso_pu_bacteria 2599185306 2599964588 246
71 iso_pu_bacteria 2599185307 2599973000 246
72 iso_pu_bacteria 2599185308 2599978871 246
73 iso_pu_bacteria 2599185309 2599983257 246
74 iso_pu_bacteria 2599185310 2599991644 246
75 iso_pu_bacteria 2599185311 2599994804 246
76 iso_pu_bacteria 2599185312 2600000933 246
77 iso_pu_bacteria 2599185313 2600004903 246
78 iso_pu_bacteria 2599185314 2600012831 246
79 iso_pu_bacteria 2599185315 2600018934 246
80 iso_pu_bacteria 2599185316 2600027030 246
81 iso_pu_bacteria 2599185317 2600030946 246
82 iso_pu_bacteria 2599185318 2600034621 246
83 iso_pu_bacteria 2599185319 2600043427 246
84 iso_pu_bacteria 2599185320 2600048264 246
85 iso_pu_bacteria 2599185321 2600053365 246
86 iso_pu_bacteria 2599185322 2600062739 246
87 iso_pu_bacteria 2599185323 2600068446 246
88 iso_pu_bacteria 2599185324 2600071832 246
89 iso_pu_bacteria 2599185325 2600077708 246
90 iso_pu_bacteria 2599185356 2600216147 246
91 iso_pu_bacteria 2600254930 2600360837 246
92 iso_pu_bacteria 2600254931 2600364844 246
93 iso_pu_bacteria 2600255283 2601627152 246
94 iso_pu_bacteria 2600255296 2601692385 246
95 iso_pu_bacteria 2600255313 2601776314 246
96 iso_pu_bacteria 2619619299 2621302143 246
97 iso_pu_bacteria 2623620443 2624478260 246
98 iso_pu_bacteria 2623620446 2624489803 246
99 iso_pu_bacteria 2643221571 2643872581 246
100 iso_pu_bacteria 2643221650 2644282032 246
101 iso_pu_bacteria 2643221713 2644619685 246
102 iso_pu_bacteria 2651869719 2652547009 246
103 iso_pu_bacteria 2667528170 2671090759 246
104 iso_pu_bacteria 2667528171 2671099925 246
105 iso_pu_bacteria 2667528176 2671127385 246
106 iso_pu_bacteria 2671180172 2671772377 246
107 iso_pu_bacteria 2675903420 2677898918 246
108 iso_pu_bacteria 2675903515 2678261032 246
109 iso_pu_bacteria 2713897148 2715749247 246
110 iso_pu_bacteria 2718217725 2718632198 246
111 iso_pu_bacteria 2721755607 2723246597 246
112 iso_pu_bacteria 2738541265 2738674122 246
113 iso_pu_bacteria 2738541271 2738687551 246
114 iso_pu_bacteria 2738541282 2738752515 246
115 iso_pu_bacteria 2738541294 2738807870 246
116 iso_pu_bacteria 2738541303 2738861556 246
117 iso_pu_bacteria 2738541309 2738895230 246
118 iso_pu_bacteria 2738543004 2739200501 246
119 iso_pu_bacteria 2738543015 2739260020 246
120 iso_pu_bacteria 2738543016 2739263172 246
121 iso_pu_bacteria 2738543025 2739311321 246
122 iso_pu_bacteria 2740892503 2743735112 246
123 iso_pu_bacteria 2744054620 2745006343 246
124 iso_pu_bacteria 2765235841 2765586407 246
125 iso_pu_bacteria 2773857673 2774134774 246
126 iso_pu_bacteria 2784132063 2784261007 246
127 iso_pu_bacteria 2791355520 2794594021 246
128 iso_pu_bacteria 2808606361 2808855983 246
129 iso_pu_bacteria 2808606376 2808922702 246
130 iso_pu_bacteria 2808606377 2808933123 246
131 iso_pu_bacteria 2808606378 2808936063 246
132 iso_pu_bacteria 2808606380 2808944389 246
133 iso_pu_bacteria 2808606381 2808955245 246
134 iso_pu_bacteria 2808606383 2808964440 246
135 iso_pu_bacteria 2808606385 2808976621 246
136 iso_pu_bacteria 2808606388 2808991941 246
137 iso_pu_bacteria 2808606389 2808999328 246
138 iso_pu_bacteria 2808606445 2809218018 246
139 iso_pu_bacteria 2816332298 2817488447 246
140 iso_pu_bacteria 2818991456 2819657272 246
141 iso_pu_bacteria 2818991464 2819705259 246
142 iso_pu_bacteria 2825651385 2825654226 246
143 iso_pu_bacteria 2826581358 2826586163 246
144 iso_pu_bacteria 2834028612 2834032176 246
145 iso_pu_bacteria 2842815866 2842817799 246
146 iso_pu_bacteria 2842826826 2842830543 246
147 iso_pu_bacteria 2842832357 2842834201 246
148 iso_pu_bacteria 2842837860 2842838674 246
149 iso_pu_bacteria 2842843487 2842846323 246
150 iso_pu_bacteria 2842849001 2842851747 246
151 iso_pu_bacteria 2842854478 2842858683 246
152 iso_pu_bacteria 2844665904 2844667942 246
153 iso_pu_bacteria 2852612431 2852617112 246
154 iso_pu_bacteria 2852657418 2852660413 246
155 iso_pu_bacteria 2852667396 2852671899 246
156 iso_pu_bacteria 2860339153 2860343600 246
157 iso_pu_bacteria 2860867994 2860868473 246
158 iso_pu_bacteria 2880230671 2880231152 246
159 iso_pu_bacteria 2904518522 2904519608 246
160 iso_pu_bacteria 2904550169 2904555520 246
161 iso_pu_bacteria 2908446538 2908447066 246
162 iso_pu_bacteria 2912963787 2912968682 246
163 iso_pu_bacteria 2913036834 2913037323 246
164 iso_pu_bacteria 2917070673 2917071214 246
165 iso_pu_bacteria 2919063839 2919066114 246
166 iso_pu_bacteria 2919155634 2919155720 246
167 iso_pu_bacteria 2919385768 2919389732 246
168 iso_pu_bacteria 2919481497 2919486940 246
169 iso_pu_bacteria 2919487758 2919488661 246
170 iso_pu_bacteria 2919697872 2919698917 246
171 iso_pu_bacteria 2923153595 2923154107 246
172 iso_pu_bacteria 2923586266 2923589827 246
173 iso_pu_bacteria 2929144301 2929144857 246
174 iso_pu_bacteria 2929189879 2929190334 246
175 iso_pu_bacteria 2931369376 2931371806 246
176 iso_pu_bacteria 2931390751 2931391416 246
177 iso_pu_bacteria 2931396565 2931398882 246
178 iso_pu_bacteria 2935353572 2935359042 246
179 iso_pu_bacteria 2939636861 2939641149 246
180 iso_pu_bacteria 2939651529 2939654022 246
181 iso_pu_bacteria 2945961074 2945967629 246
182 iso_pu_bacteria 2946006987 2946012473 246
183 iso_pu_bacteria 2946027586 2946028680 246
184 iso_pu_bacteria 2947233263 2947235209 246
185 iso_pu_bacteria 2969304461 2969304999 246
186 iso_pu_bacteria 2974289157 2974293310 246
187 iso_pu_bacteria 2984286254 2984291952 246
188 iso_pu_bacteria 2988728565 2988732245 246
189 iso_pu_bacteria 2998139840 2998140504 246
190 iso_pu_bacteria 3007395558 3007399659 246
191 iso_pu_bacteria 3007419365 3007420056 246
192 iso_pu_bacteria 3007614139 3007617835 246
193 iso_pu_bacteria 3007718800 3007720300 246
194 iso_pu_bacteria 3007803356 3007805385 246
195 iso_pu_bacteria 3007855910 3007859739 246
196 iso_pu_bacteria 3007866637 3007872123 246
197 iso_pu_bacteria 637000220 637317859 246
198 iso_pu_bacteria 8015687852 8015688356 246
199 iso_pu_bacteria 8019769354 8019770343 246
200 iso_pu_bacteria 8019775933 8019777379 246
201 iso_pu_bacteria 8029995093 8030000235 246
202 iso_pu_bacteria 8052494512 8052499618 246
203 iso_pu_bacteria 8054285046 8054290973 246
204 iso_pu_bacteria 8054347763 8054350094 246
205 iso_pu_bacteria 8054503363 8054504001 246
206 iso_pu_bacteria 8054929484 8054934204 246
207 iso_pu_bacteria 8055770955 8055771453 246
208 iso_pu_bacteria 8055817908 8055818401 246
209 iso_pu_bacteria 8055878733 8055879385 246
210 iso_pu_bacteria 8056115690 8056115941 246
211 iso_pu_bacteria 8056125926 8056126513 246
212 iso_pu_bacteria 8056131705 8056132375 246
213 iso_pu_bacteria 8056137416 8056137822 246
214 iso_pu_bacteria 8056143049 8056143785 246
215 iso_pu_bacteria 8056148874 8056152514 246
216 iso_pu_bacteria 8056155041 8056158555 246
217 iso_pu_bacteria 8056166840 8056170547 246
218 iso_pu_bacteria 8056172158 8056176667 246
219 iso_pu_bacteria 8056569372 8056572359 246
220 iso_pu_bacteria 8057798959 8057802745 246
221 3300003856 Ga0058692_1007720 Ga0058692_10077203 247
222 3300013100 Ga0157373_10151185 Ga0157373_101511853 247
223 3300013102 Ga0157371_10261010 Ga0157371_102610102 247
224 3300013105 Ga0157369_10375365 Ga0157369_103753652 247
225 3300015261 Ga0182006_1053598 Ga0182006_10535982 247
226 3300027312 Ga0209371_1000380 Ga0209371_100038013 247
227 3300030500 Ga0268256_1000428 Ga0268256_10004288 247
228 3300031548 Ga0307408_100000002 Ga0307408_100000002183 247
229 3300039450 Ga0436363_1717883 Ga0436363_1717883_97_846 247
230 3300042439 Ga0439464_0004794 Ga0439464_0004794_2489_3238 247
231 iso_pu_bacteria 2945928738 2945930129 247
232 iso_pu_bacteria 8056161164 8056164381 247
233 2124908027 MRS2a_Contig_540 MRS2a_00418160 250
234 2162886007 SwRhRL2b_contig_1465106 SwRhRL2b_0852.00005180 250
235 2162886007 SwRhRL2b_contig_1764872 SwRhRL2b_0772.00005810 250
236 3300002738 JGI25154J39366_1001521 JGI25154J39366_10015217 250
237 3300002771 JGI25163J39215_1000534 JGI25163J39215_10005343 250
238 3300002772 JGI25164J39214_1000148 JGI25164J39214_10001487 250
239 3300003214 JGI25165J46597_1000268 JGI25165J46597_10002687 250
240 3300003751 Ga0055538_1000037 Ga0055538_100003757 250
241 3300003752 Ga0055539_1000048 Ga0055539_100004857 250
242 3300003756 Ga0055533_1000059 Ga0055533_100005957 250
243 3300003758 Ga0055532_1000096 Ga0055532_100009622 250
244 3300003759 Ga0055525_1000189 Ga0055525_100018957 250
245 3300003761 Ga0055535_1006534 Ga0055535_10065341 250
246 3300003781 Ga0055536_1002298 Ga0055536_10022987 250
247 3300003791 Ga0055530_10000374 Ga0055530_100003748 250
248 3300003791 Ga0055530_10000913 Ga0055530_100009137 250
249 3300003792 Ga0055540_1000337 Ga0055540_10003377 250
250 3300003792 Ga0055540_1000657 Ga0055540_10006577 250
251 3300003841 Ga0055541_1000035 Ga0055541_1000035103 250
252 3300005288 Ga0065714_10004567 Ga0065714_100045674 250
253 3300005288 Ga0065714_10020298 Ga0065714_100202982 250
254 3300005288 Ga0065714_10066037 Ga0065714_100660377 250
255 3300005288 Ga0065714_10067559 Ga0065714_100675593 250
256 3300005288 Ga0065714_10094584 Ga0065714_100945842 250
257 3300005289 Ga0065704_10001014 Ga0065704_100010148 250
258 3300005289 Ga0065704_10095994 Ga0065704_100959942 250
259 3300005290 Ga0065712_10069162 Ga0065712_100691621 250
260 3300005331 Ga0070670_100001434 Ga0070670_10000143410 250
261 3300005331 Ga0070670_100014428 Ga0070670_1000144285 250
262 3300005344 Ga0070661_100000078 Ga0070661_10000007810 250
263 3300005353 Ga0070669_100001899 Ga0070669_1000018998 250
264 3300005353 Ga0070669_100034370 Ga0070669_1000343702 250
265 3300005366 Ga0070659_100084814 Ga0070659_1000848142 250
266 3300005457 Ga0070662_100003973 Ga0070662_1000039732 250
267 3300005457 Ga0070662_100040416 Ga0070662_1000404162 250
268 3300005539 Ga0068853_100000210 Ga0068853_10000021018 250
269 3300005548 Ga0070665_100017564 Ga0070665_1000175643 250
270 3300005548 Ga0070665_100081599 Ga0070665_1000815992 250
271 3300005564 Ga0070664_100007381 Ga0070664_1000073817 250
272 3300005564 Ga0070664_100017832 Ga0070664_1000178324 250
273 3300005578 Ga0068854_100002209 Ga0068854_1000022093 250
274 3300005834 Ga0068851_10000004 Ga0068851_10000004208 250
275 3300006051 Ga0075364_10184833 Ga0075364_101848332 250
276 3300006051 Ga0075364_10224019 Ga0075364_102240192 250
277 3300006051 Ga0075364_10270254 Ga0075364_102702542 250
278 3300006058 Ga0075432_10001130 Ga0075432_100011307 250
279 3300006058 Ga0075432_10015575 Ga0075432_100155753 250
280 3300006058 Ga0075432_10026479 Ga0075432_100264792 250
281 3300006058 Ga0075432_10043798 Ga0075432_100437982 250
282 3300006058 Ga0075432_10088766 Ga0075432_100887662 250
283 3300006058 Ga0075432_10170768 Ga0075432_101707681 250
284 3300006177 Ga0075362_10009085 Ga0075362_100090854 250
285 3300006177 Ga0075362_10050360 Ga0075362_100503602 250
286 3300006186 Ga0075369_10087520 Ga0075369_100875202 250
287 3300006914 Ga0075436_100064791 Ga0075436_1000647913 250
288 3300006914 Ga0075436_100521583 Ga0075436_1005215831 250
289 3300006944 Ga0099823_1000048 Ga0099823_10000486 250
290 3300006944 Ga0099823_1013050 Ga0099823_10130505 250
291 3300006946 Ga0079104_1000638 Ga0079104_10006388 250
292 3300006946 Ga0079104_1000654 Ga0079104_10006547 250
293 3300006948 Ga0099826_10018533 Ga0099826_100185336 250
294 3300009011 Ga0105251_10001807 Ga0105251_1000180712 250
295 3300009011 Ga0105251_10003211 Ga0105251_100032113 250
296 3300009011 Ga0105251_10004126 Ga0105251_100041267 250
297 3300009011 Ga0105251_10004337 Ga0105251_100043376 250
298 3300009011 Ga0105251_10015549 Ga0105251_100155494 250
299 3300009011 Ga0105251_10020559 Ga0105251_100205591 250
300 3300009011 Ga0105251_10061909 Ga0105251_100619092 250
301 3300009011 Ga0105251_10065340 Ga0105251_100653403 250
302 3300009011 Ga0105251_10066069 Ga0105251_100660692 250
303 3300009011 Ga0105251_10067635 Ga0105251_100676352 250
304 3300009036 Ga0105244_10000133 Ga0105244_1000013355 250
305 3300009036 Ga0105244_10001762 Ga0105244_100017627 250
306 3300009036 Ga0105244_10002007 Ga0105244_100020074 250
307 3300009036 Ga0105244_10002116 Ga0105244_1000211611 250
308 3300009036 Ga0105244_10004326 Ga0105244_100043262 250
309 3300009036 Ga0105244_10005610 Ga0105244_100056106 250
310 3300009036 Ga0105244_10022008 Ga0105244_100220083 250
311 3300009036 Ga0105244_10025182 Ga0105244_100251822 250
312 3300009036 Ga0105244_10027037 Ga0105244_100270374 250
313 3300009036 Ga0105244_10035328 Ga0105244_100353282 250
314 3300009036 Ga0105244_10056199 Ga0105244_100561991 250
315 3300009036 Ga0105244_10057443 Ga0105244_100574432 250
316 3300009036 Ga0105244_10062960 Ga0105244_100629602 250
317 3300009036 Ga0105244_10088423 Ga0105244_100884232 250
318 3300009036 Ga0105244_10137131 Ga0105244_101371311 250
319 3300009092 Ga0105250_10000423 Ga0105250_100004237 250
320 3300009092 Ga0105250_10002533 Ga0105250_100025336 250
321 3300009092 Ga0105250_10002789 Ga0105250_100027897 250
322 3300009092 Ga0105250_10006222 Ga0105250_100062222 250
323 3300009092 Ga0105250_10080460 Ga0105250_100804602 250
324 3300009148 Ga0105243_10001058 Ga0105243_1000105815 250
325 3300009148 Ga0105243_10001664 Ga0105243_1000166415 250
326 3300009148 Ga0105243_10002290 Ga0105243_1000229010 250
327 3300009148 Ga0105243_10007323 Ga0105243_100073234 250
328 3300009148 Ga0105243_10176636 Ga0105243_101766362 250
329 3300009176 Ga0105242_10004878 Ga0105242_100048788 250
330 3300009177 Ga0105248_10090654 Ga0105248_100906543 250
331 3300009545 Ga0105237_10007904 Ga0105237_100079048 250
332 3300009545 Ga0105237_10149704 Ga0105237_101497043 250
333 3300009553 Ga0105249_10949488 Ga0105249_109494882 250
334 3300011119 Ga0105246_10000489 Ga0105246_1000048910 250
335 3300011119 Ga0105246_10008716 Ga0105246_100087163 250
336 3300012498 Ga0157345_1000037 Ga0157345_10000377 250
337 3300013100 Ga0157373_10006181 Ga0157373_100061817 250
338 3300013100 Ga0157373_10008180 Ga0157373_100081805 250
339 3300013100 Ga0157373_10012146 Ga0157373_100121466 250
340 3300013100 Ga0157373_10022539 Ga0157373_100225393 250
341 3300013100 Ga0157373_10029077 Ga0157373_100290773 250
342 3300013100 Ga0157373_10032871 Ga0157373_100328714 250
343 3300013100 Ga0157373_10046190 Ga0157373_100461903 250
344 3300013100 Ga0157373_10049050 Ga0157373_100490502 250
345 3300013100 Ga0157373_10061019 Ga0157373_100610192 250
346 3300013100 Ga0157373_10177552 Ga0157373_101775522 250
347 3300013102 Ga0157371_10000839 Ga0157371_100008397 250
348 3300013102 Ga0157371_10027480 Ga0157371_100274802 250
349 3300013102 Ga0157371_10051956 Ga0157371_100519562 250
350 3300013104 Ga0157370_10014921 Ga0157370_100149214 250
351 3300013104 Ga0157370_10081362 Ga0157370_100813623 250
352 3300013104 Ga0157370_10206842 Ga0157370_102068422 250
353 3300013104 Ga0157370_10307829 Ga0157370_103078292 250
354 3300013104 Ga0157370_10448233 Ga0157370_104482332 250
355 3300013105 Ga0157369_10001610 Ga0157369_1000161020 250
356 3300013105 Ga0157369_10008368 Ga0157369_100083685 250
357 3300013105 Ga0157369_10018752 Ga0157369_100187523 250
358 3300013105 Ga0157369_10032980 Ga0157369_100329805 250
359 3300013105 Ga0157369_10040248 Ga0157369_100402482 250
360 3300013105 Ga0157369_10158309 Ga0157369_101583094 250
361 3300013105 Ga0157369_10894191 Ga0157369_108941912 250
362 3300013306 Ga0163162_10001133 Ga0163162_1000113322 250
363 3300013306 Ga0163162_10266616 Ga0163162_102666162 250
364 3300013307 Ga0157372_10000947 Ga0157372_1000094719 250
365 3300013307 Ga0157372_10006103 Ga0157372_100061035 250
366 3300013308 Ga0157375_10001804 Ga0157375_100018047 250
367 3300013308 Ga0157375_10008927 Ga0157375_100089274 250
368 3300013308 Ga0157375_10015868 Ga0157375_100158685 250
369 3300013308 Ga0157375_10149094 Ga0157375_101490943 250
370 3300013308 Ga0157375_11109097 Ga0157375_111090971 250
371 3300014497 Ga0182008_10000659 Ga0182008_1000065915 250
372 3300014497 Ga0182008_10002039 Ga0182008_100020397 250
373 3300014497 Ga0182008_10005131 Ga0182008_100051314 250
374 3300014497 Ga0182008_10012107 Ga0182008_100121073 250
375 3300014497 Ga0182008_10012497 Ga0182008_100124973 250
376 3300014497 Ga0182008_10030243 Ga0182008_100302433 250
377 3300015261 Ga0182006_1003547 Ga0182006_10035473 250
378 3300015261 Ga0182006_1003616 Ga0182006_10036166 250
379 3300015261 Ga0182006_1008819 Ga0182006_10088194 250
380 3300015261 Ga0182006_1012301 Ga0182006_10123012 250
381 3300015261 Ga0182006_1020170 Ga0182006_10201704 250
382 3300015261 Ga0182006_1039979 Ga0182006_10399792 250
383 3300015262 Ga0182007_10003898 Ga0182007_100038984 250
384 3300015262 Ga0182007_10007513 Ga0182007_100075134 250
385 3300015265 Ga0182005_1004402 Ga0182005_10044024 250
386 3300015265 Ga0182005_1030131 Ga0182005_10301312 250
387 3300015265 Ga0182005_1033189 Ga0182005_10331891 250
388 3300017792 Ga0163161_10000624 Ga0163161_1000062421 250
389 3300017792 Ga0163161_10010533 Ga0163161_100105334 250
390 3300017792 Ga0163161_10047538 Ga0163161_100475383 250
391 3300017792 Ga0163161_10201690 Ga0163161_102016902 250
392 3300017792 Ga0163161_10376536 Ga0163161_103765362 250
393 3300025207 Ga0209760_100215 Ga0209760_10021515 250
394 3300025224 Ga0209784_100028 Ga0209784_100028102 250
395 3300025225 Ga0209566_100028 Ga0209566_100028102 250
396 3300025226 Ga0209674_100047 Ga0209674_100047102 250
397 3300025229 Ga0209147_100031 Ga0209147_100031102 250
398 3300025230 Ga0209563_100050 Ga0209563_100050102 250
399 3300025230 Ga0209563_100488 Ga0209563_1004887 250
400 3300025231 Ga0207427_100014 Ga0207427_100014415 250
401 3300025233 Ga0209437_100016 Ga0209437_100016222 250
402 3300025233 Ga0209437_105032 Ga0209437_1050323 250
403 3300025242 Ga0209258_100150 Ga0209258_10015057 250
404 3300025246 Ga0209646_1000165 Ga0209646_100016553 250
405 3300025253 Ga0209677_100029 Ga0209677_100029102 250
406 3300025261 Ga0209233_1000036 Ga0209233_1000036415 250
407 3300025292 Ga0209676_1000032 Ga0209676_1000032385 250
408 3300025292 Ga0209676_1000326 Ga0209676_10003268 250
409 3300025292 Ga0209676_1001232 Ga0209676_100123213 250
410 3300025292 Ga0209676_1001980 Ga0209676_10019806 250
411 3300025292 Ga0209676_1015080 Ga0209676_10150804 250
412 3300025298 Ga0209050_1000025 Ga0209050_1000025386 250
413 3300025298 Ga0209050_1000028 Ga0209050_1000028305 250
414 3300025298 Ga0209050_1001079 Ga0209050_100107920 250
415 3300025303 Ga0209051_1000080 Ga0209051_1000080138 250
416 3300025303 Ga0209051_1000334 Ga0209051_100033415 250
417 3300025303 Ga0209051_1003650 Ga0209051_10036506 250
418 3300025304 Ga0209257_1006869 Ga0209257_10068695 250
419 3300025321 Ga0207656_10000007 Ga0207656_1000000748 250
420 3300025711 Ga0207696_1000057 Ga0207696_100005760 250
421 3300025711 Ga0207696_1000064 Ga0207696_1000064107 250
422 3300025711 Ga0207696_1000229 Ga0207696_100022962 250
423 3300025711 Ga0207696_1003169 Ga0207696_10031694 250
424 3300025711 Ga0207696_1013025 Ga0207696_10130252 250
425 3300025711 Ga0207696_1018357 Ga0207696_10183572 250
426 3300025728 Ga0207655_1000014 Ga0207655_1000014190 250
427 3300025728 Ga0207655_1000406 Ga0207655_100040644 250
428 3300025728 Ga0207655_1000565 Ga0207655_100056531 250
429 3300025728 Ga0207655_1000815 Ga0207655_100081526 250
430 3300025728 Ga0207655_1000922 Ga0207655_10009227 250
431 3300025728 Ga0207655_1001160 Ga0207655_10011605 250
432 3300025728 Ga0207655_1001818 Ga0207655_10018187 250
433 3300025728 Ga0207655_1002787 Ga0207655_10027877 250
434 3300025728 Ga0207655_1003594 Ga0207655_10035943 250
435 3300025728 Ga0207655_1003980 Ga0207655_10039807 250
436 3300025728 Ga0207655_1004144 Ga0207655_10041447 250
437 3300025728 Ga0207655_1005546 Ga0207655_10055465 250
438 3300025728 Ga0207655_1006369 Ga0207655_10063697 250
439 3300025728 Ga0207655_1010151 Ga0207655_10101515 250
440 3300025728 Ga0207655_1022645 Ga0207655_10226452 250
441 3300025728 Ga0207655_1031921 Ga0207655_10319213 250
442 3300025728 Ga0207655_1040099 Ga0207655_10400992 250
443 3300025728 Ga0207655_1041210 Ga0207655_10412103 250
444 3300025728 Ga0207655_1049466 Ga0207655_10494662 250
445 3300025728 Ga0207655_1071585 Ga0207655_10715852 250
446 3300025735 Ga0207713_1000031 Ga0207713_1000031172 250
447 3300025735 Ga0207713_1000759 Ga0207713_10007595 250
448 3300025735 Ga0207713_1001119 Ga0207713_10011197 250
449 3300025735 Ga0207713_1001942 Ga0207713_10019427 250
450 3300025735 Ga0207713_1002040 Ga0207713_10020408 250
451 3300025735 Ga0207713_1003833 Ga0207713_10038337 250
452 3300025735 Ga0207713_1004233 Ga0207713_10042335 250
453 3300025735 Ga0207713_1012137 Ga0207713_10121373 250
454 3300025735 Ga0207713_1016374 Ga0207713_10163742 250
455 3300025735 Ga0207713_1037730 Ga0207713_10377302 250
456 3300025735 Ga0207713_1044022 Ga0207713_10440222 250
457 3300025735 Ga0207713_1115546 Ga0207713_11155461 250
458 3300025914 Ga0207671_10000015 Ga0207671_10000015298 250
459 3300025914 Ga0207671_10123450 Ga0207671_101234501 250
460 3300025920 Ga0207649_10000001 Ga0207649_10000001189 250
461 3300025923 Ga0207681_10000480 Ga0207681_1000048012 250
462 3300025923 Ga0207681_10021836 Ga0207681_100218364 250
463 3300025923 Ga0207681_10106403 Ga0207681_101064032 250
464 3300025925 Ga0207650_10000868 Ga0207650_1000086812 250
465 3300025925 Ga0207650_10001058 Ga0207650_100010587 250
466 3300025932 Ga0207690_10070554 Ga0207690_100705543 250
467 3300025933 Ga0207706_10000624 Ga0207706_100006248 250
468 3300025933 Ga0207706_10006689 Ga0207706_100066897 250
469 3300025934 Ga0207686_10001543 Ga0207686_100015438 250
470 3300025935 Ga0207709_10000022 Ga0207709_10000022226 250
471 3300025935 Ga0207709_10000578 Ga0207709_100005787 250
472 3300025935 Ga0207709_10000971 Ga0207709_1000097110 250
473 3300025935 Ga0207709_10009944 Ga0207709_100099441 250
474 3300025935 Ga0207709_10024304 Ga0207709_100243042 250
475 3300025941 Ga0207711_10066327 Ga0207711_100663271 250
476 3300025945 Ga0207679_10000011 Ga0207679_10000011189 250
477 3300025945 Ga0207679_10511024 Ga0207679_105110242 250
478 3300026041 Ga0207639_10000706 Ga0207639_100007066 250
479 3300027111 Ga0209281_1000026 Ga0209281_1000026339 250
480 3300027111 Ga0209281_1000033 Ga0209281_1000033187 250
481 3300027111 Ga0209281_1004796 Ga0209281_10047963 250
482 3300027296 Ga0209389_1000095 Ga0209389_100009521 250
483 3300027312 Ga0209371_1000217 Ga0209371_10002178 250
484 3300027360 Ga0209969_1008703 Ga0209969_10087032 250
485 3300027378 Ga0209981_1006694 Ga0209981_10066942 250
486 3300027395 Ga0209996_1001711 Ga0209996_10017112 250
487 3300027471 Ga0209995_1006297 Ga0209995_10062972 250
488 3300027543 Ga0209999_1020395 Ga0209999_10203952 250
489 3300027552 Ga0209982_1001176 Ga0209982_10011762 250
490 3300027614 Ga0209970_1022668 Ga0209970_10226681 250
491 3300027665 Ga0209983_1006729 Ga0209983_10067292 250
492 3300027665 Ga0209983_1043713 Ga0209983_10437132 250
493 3300027666 Ga0209282_1048537 Ga0209282_10485372 250
494 3300027682 Ga0209971_1002229 Ga0209971_10022294 250
495 3300027876 Ga0209974_10006031 Ga0209974_100060312 250
496 3300027907 Ga0207428_10018345 Ga0207428_100183453 250
497 3300027907 Ga0207428_10032695 Ga0207428_100326953 250
498 3300027907 Ga0207428_10051303 Ga0207428_100513032 250
499 3300027907 Ga0207428_10099582 Ga0207428_100995823 250
500 3300028379 Ga0268266_10007054 Ga0268266_100070546 250
501 3300028786 Ga0307517_10046926 Ga0307517_100469262 250
502 3300028794 Ga0307515_10287028 Ga0307515_102870282 250
503 3300030500 Ga0268256_1000173 Ga0268256_100017360 250
504 3300030521 Ga0307511_10055991 Ga0307511_100559912 250
505 3300030521 Ga0307511_10083045 Ga0307511_100830451 250
506 3300030731 Ga0316177_1136448 Ga0316177_11364484 250
507 3300030733 Ga0314311_1115640 Ga0314311_11156404 250
508 3300030734 Ga0316179_1116990 Ga0316179_11169902 250
509 3300030735 Ga0316178_1078135 Ga0316178_107813510 250
510 3300030742 Ga0316183_1053680 Ga0316183_10536803 250
511 3300030742 Ga0316183_1157733 Ga0316183_11577332 250
512 3300031507 Ga0307509_10497779 Ga0307509_104977792 250
513 3300031548 Ga0307408_100013668 Ga0307408_1000136684 250
514 3300031548 Ga0307408_100025940 Ga0307408_1000259403 250
515 3300031548 Ga0307408_100032095 Ga0307408_1000320952 250
516 3300031548 Ga0307408_100040414 Ga0307408_1000404142 250
517 3300031548 Ga0307408_100083810 Ga0307408_1000838102 250
518 3300031548 Ga0307408_100169604 Ga0307408_1001696042 250
519 3300031548 Ga0307408_100226140 Ga0307408_1002261402 250
520 3300031548 Ga0307408_100518356 Ga0307408_1005183562 250
521 3300031730 Ga0307516_10039930 Ga0307516_100399303 250
522 3300031730 Ga0307516_10297067 Ga0307516_102970672 250
523 3300031731 Ga0307405_10000474 Ga0307405_100004746 250
524 3300031731 Ga0307405_10009426 Ga0307405_100094263 250
525 3300031731 Ga0307405_10013191 Ga0307405_100131914 250
526 3300031824 Ga0307413_10052125 Ga0307413_100521252 250
527 3300031824 Ga0307413_10061646 Ga0307413_100616462 250
528 3300031901 Ga0307406_10053723 Ga0307406_100537232 250
529 3300031903 Ga0307407_10054914 Ga0307407_100549142 250
530 3300031903 Ga0307407_10166335 Ga0307407_101663352 250
531 3300031911 Ga0307412_10006654 Ga0307412_100066544 250
532 3300031911 Ga0307412_10012666 Ga0307412_100126663 250
533 3300031911 Ga0307412_10014146 Ga0307412_100141465 250
534 3300031911 Ga0307412_10016071 Ga0307412_100160712 250
535 3300031911 Ga0307412_10020189 Ga0307412_100201892 250
536 3300031911 Ga0307412_10060063 Ga0307412_100600632 250
537 3300031995 Ga0307409_100015570 Ga0307409_1000155704 250
538 3300031995 Ga0307409_100017296 Ga0307409_1000172962 250
539 3300032002 Ga0307416_100070455 Ga0307416_1000704553 250
540 3300032002 Ga0307416_100199104 Ga0307416_1001991042 250
541 3300032002 Ga0307416_100793822 Ga0307416_1007938222 250
542 3300032002 Ga0307416_100951958 Ga0307416_1009519582 250
543 3300032004 Ga0307414_10015030 Ga0307414_100150304 250
544 3300032004 Ga0307414_10027227 Ga0307414_100272272 250
545 3300032004 Ga0307414_10054038 Ga0307414_100540382 250
546 3300032004 Ga0307414_10126516 Ga0307414_101265162 250
547 3300032004 Ga0307414_10164504 Ga0307414_101645041 250
548 3300032005 Ga0307411_10010536 Ga0307411_100105364 250
549 3300032005 Ga0307411_10036524 Ga0307411_100365244 250
550 3300032005 Ga0307411_10102466 Ga0307411_101024662 250
551 3300032005 Ga0307411_10161157 Ga0307411_101611572 250
552 3300033180 Ga0307510_10003578 Ga0307510_100035789 250
553 3300038726 Ga0400490_60050 Ga0400490_60050_1589_2386 250
554 3300038735 Ga0400485_15060 Ga0400485_15060_4418_5215 250
555 3300038741 Ga0400488_51383 Ga0400488_51383_5507_6304 250
556 3300038742 Ga0400486_08953 Ga0400486_08953_11338_12135 250
557 3300038742 Ga0400486_30125 Ga0400486_30125_777_1565 250
558 3300039062 Ga0400483_016299 Ga0400483_016299_1951_2748 250
559 3300039062 Ga0400483_063543 Ga0400483_063543_973_1770 250
560 3300039062 Ga0400483_178362 Ga0400483_178362_1630_2427 250
561 3300039093 Ga0400489_85272 Ga0400489_85272_3564_4361 250
562 3300039110 Ga0400487_25087 Ga0400487_25087_475_1329 250
563 3300041404 Ga0439436_0000202 Ga0439436_0000202_708_1463 250
564 3300041405 Ga0439438_000621 Ga0439438_000621_7097_7849 250
565 3300041405 Ga0439438_003204 Ga0439438_003204_3387_4142 250
566 3300041405 Ga0439438_004970 Ga0439438_004970_1502_2254 250
567 3300041405 Ga0439438_005713 Ga0439438_005713_2172_2924 250
568 3300041405 Ga0439438_006379 Ga0439438_006379_1868_2620 250
569 3300041405 Ga0439438_006390 Ga0439438_006390_1555_2307 250
570 3300041405 Ga0439438_008403 Ga0439438_008403_2286_3038 250
571 3300041407 Ga0439447_000763 Ga0439447_000763_9642_10397 250
572 3300041407 Ga0439447_004452 Ga0439447_004452_2203_2955 250
573 3300041407 Ga0439447_005358 Ga0439447_005358_1145_1897 250
574 3300041407 Ga0439447_006643 Ga0439447_006643_2498_3250 250
575 3300041407 Ga0439447_016900 Ga0439447_016900_649_1401 250
576 3300041407 Ga0439447_037128 Ga0439447_037128_220_972 250
577 3300041411 Ga0439466_0001219 Ga0439466_0001219_817_1569 250
578 3300041411 Ga0439466_0001604 Ga0439466_0001604_6280_7035 250
579 3300041411 Ga0439466_0003680 Ga0439466_0003680_2724_3476 250
580 3300041411 Ga0439466_0007035 Ga0439466_0007035_2728_3480 250
581 3300041411 Ga0439466_0012287 Ga0439466_0012287_1394_2146 250
582 3300041411 Ga0439466_0013009 Ga0439466_0013009_43_795 250
583 3300041411 Ga0439466_0024657 Ga0439466_0024657_565_1317 250
584 3300041411 Ga0439466_0024736 Ga0439466_0024736_512_1264 250
585 3300041411 Ga0439466_0032823 Ga0439466_0032823_797_1549 250
586 3300041997 Ga0439431_0002341 Ga0439431_0002341_1003_1755 250
587 3300042004 Ga0439445_0006292 Ga0439445_0006292_493_1245 250
588 3300042004 Ga0439445_0008605 Ga0439445_0008605_858_1610 250
589 3300042006 Ga0439432_000649 Ga0439432_000649_4258_5010 250
590 3300042006 Ga0439432_001572 Ga0439432_001572_2154_2906 250
591 3300042006 Ga0439432_002096 Ga0439432_002096_3211_3966 250
592 3300042006 Ga0439432_006769 Ga0439432_006769_2752_3504 250
593 3300042006 Ga0439432_006983 Ga0439432_006983_1426_2178 250
594 3300042006 Ga0439432_019565 Ga0439432_019565_911_1663 250
595 3300042006 Ga0439432_026755 Ga0439432_026755_287_1039 250
596 3300042006 Ga0439432_027343 Ga0439432_027343_428_1180 250
597 3300042009 Ga0439451_004270 Ga0439451_004270_1138_1890 250
598 3300042009 Ga0439451_005659 Ga0439451_005659_93_845 250
599 3300042009 Ga0439451_006718 Ga0439451_006718_710_1462 250
600 3300042009 Ga0439451_009129 Ga0439451_009129_806_1558 250
601 3300042010 Ga0439452_000992 Ga0439452_000992_10401_11156 250
602 3300042010 Ga0439452_002398 Ga0439452_002398_3489_4241 250
603 3300042010 Ga0439452_008686 Ga0439452_008686_2149_2901 250
604 3300042010 Ga0439452_008843 Ga0439452_008843_1156_1908 250
605 3300042010 Ga0439452_011809 Ga0439452_011809_1178_1930 250
606 3300042013 Ga0439456_000329 Ga0439456_000329_9845_10597 250
607 3300042013 Ga0439456_004980 Ga0439456_004980_1827_2579 250
608 3300042013 Ga0439456_009525 Ga0439456_009525_1155_1907 250
609 3300042013 Ga0439456_014999 Ga0439456_014999_713_1465 250
610 3300042013 Ga0439456_034069 Ga0439456_034069_307_1059 250
611 3300042016 Ga0439463_000057 Ga0439463_000057_14587_15342 250
612 3300042016 Ga0439463_001908 Ga0439463_001908_2141_2893 250
613 3300042016 Ga0439463_014918 Ga0439463_014918_917_1672 250
614 3300042016 Ga0439463_021251 Ga0439463_021251_284_1036 250
615 3300042016 Ga0439463_036364 Ga0439463_036364_318_1070 250
616 3300042115 Ga0450911_000192 Ga0450911_000192_2139_2891 250
617 3300042115 Ga0450911_003230 Ga0450911_003230_1057_1809 250
618 3300042121 Ga0450919_006216 Ga0450919_006216_83_835 250
619 3300042122 Ga0450920_006500 Ga0450920_006500_964_1716 250
620 3300042123 Ga0450921_000021 Ga0450921_000021_880_1632 250
621 3300042124 Ga0450922_000566 Ga0450922_000566_2338_3090 250
622 3300042124 Ga0450922_001365 Ga0450922_001365_1230_1982 250
623 3300042125 Ga0450923_001080 Ga0450923_001080_688_1443 250
624 3300042125 Ga0450923_007581 Ga0450923_007581_604_1356 250
625 3300042136 Ga0450900_000138 Ga0450900_000138_1508_2260 250
626 3300042137 Ga0450902_002820 Ga0450902_002820_249_1001 250
627 3300042138 Ga0450903_004345 Ga0450903_004345_126_878 250
628 3300042139 Ga0450904_002227 Ga0450904_002227_732_1484 250
629 3300042142 Ga0450905_000086 Ga0450905_000086_1113_1865 250
630 3300042142 Ga0450905_001045 Ga0450905_001045_340_1092 250
631 3300042142 Ga0450905_011992 Ga0450905_011992_97_849 250
632 3300042145 Ga0450906_002085 Ga0450906_002085_3376_4128 250
633 3300042145 Ga0450906_019177 Ga0450906_019177_163_915 250
634 3300042146 Ga0450907_002425 Ga0450907_002425_2566_3318 250
635 3300042146 Ga0450907_011886 Ga0450907_011886_404_1156 250
636 3300042146 Ga0450907_013972 Ga0450907_013972_481_1233 250
637 3300042147 Ga0450910_002201 Ga0450910_002201_1758_2510 250
638 3300042156 Ga0439446_0002511 Ga0439446_0002511_2389_3141 250
639 3300042156 Ga0439446_0022836 Ga0439446_0022836_691_1446 250
640 3300042185 Ga0450909_001760 Ga0450909_001760_414_1169 250
641 3300042185 Ga0450909_003244 Ga0450909_003244_699_1451 250
642 3300042435 Ga0439434_0002067 Ga0439434_0002067_2703_3458 250
643 3300042435 Ga0439434_0015945 Ga0439434_0015945_518_1270 250
644 3300042439 Ga0439464_0001991 Ga0439464_0001991_2245_2997 250
645 3300042461 Ga0439460_0003385 Ga0439460_0003385_2751_3503 250
646 3300042461 Ga0439460_0044925 Ga0439460_0044925_450_1202 250
647 3300042531 Ga0450918_013510 Ga0450918_013510_187_939 250
648 3300042993 Ga0439440_0000861 Ga0439440_0000861_2654_3406 250
649 3300046452 Ga0495617_000900 Ga0495617_000900_11254_12006 250
650 3300046452 Ga0495617_001444 Ga0495617_001444_7254_8006 250
651 3300046452 Ga0495617_005638 Ga0495617_005638_2535_3287 250
652 3300046452 Ga0495617_013843 Ga0495617_013843_1790_2542 250
653 3300046452 Ga0495617_032809 Ga0495617_032809_808_1560 250
654 3300046452 Ga0495617_040468 Ga0495617_040468_600_1352 250
655 3300046452 Ga0495617_057721 Ga0495617_057721_479_1231 250
656 3300046452 Ga0495617_063492 Ga0495617_063492_296_1048 250
657 3300046453 Ga0495627_000529 Ga0495627_000529_22602_23354 250
658 3300046453 Ga0495627_000662 Ga0495627_000662_8430_9209 250
659 3300046453 Ga0495627_000811 Ga0495627_000811_8528_9280 250
660 3300046453 Ga0495627_001567 Ga0495627_001567_11227_11979 250
661 3300046453 Ga0495627_003516 Ga0495627_003516_5074_5826 250
662 3300046453 Ga0495627_006948 Ga0495627_006948_109_861 250
663 3300046453 Ga0495627_007132 Ga0495627_007132_493_1257 250
664 3300046453 Ga0495627_031799 Ga0495627_031799_154_906 250
665 3300046455 Ga0495603_0023960 Ga0495603_0023960_788_1540 250
666 3300046455 Ga0495603_0095554 Ga0495603_0095554_218_970 250
667 3300046457 Ga0495590_0002060 Ga0495590_0002060_6088_6840 250
668 3300046457 Ga0495590_0006040 Ga0495590_0006040_1506_2258 250
669 3300046457 Ga0495590_0007173 Ga0495590_0007173_899_1651 250
670 3300046457 Ga0495590_0013729 Ga0495590_0013729_2117_2869 250
671 3300046457 Ga0495590_0015849 Ga0495590_0015849_1647_2402 250
672 3300046458 Ga0495591_000417 Ga0495591_000417_29827_30582 250
673 3300046458 Ga0495591_000692 Ga0495591_000692_15433_16212 250
674 3300046458 Ga0495591_004076 Ga0495591_004076_1833_2585 250
675 3300046458 Ga0495591_004675 Ga0495591_004675_4193_4945 250
676 3300046458 Ga0495591_005356 Ga0495591_005356_296_1048 250
677 3300046458 Ga0495591_006221 Ga0495591_006221_1947_2699 250
678 3300046458 Ga0495591_007785 Ga0495591_007785_1041_1793 250
679 3300046458 Ga0495591_008359 Ga0495591_008359_1571_2326 250
680 3300046458 Ga0495591_010252 Ga0495591_010252_795_1547 250
681 3300046458 Ga0495591_014123 Ga0495591_014123_1685_2437 250
682 3300046458 Ga0495591_014281 Ga0495591_014281_25_777 250
683 3300046458 Ga0495591_017460 Ga0495591_017460_922_1674 250
684 3300046458 Ga0495591_022627 Ga0495591_022627_1156_1908 250
685 3300046458 Ga0495591_025032 Ga0495591_025032_62_817 250
686 3300046460 Ga0495638_0006393 Ga0495638_0006393_2555_3307 250
687 3300046460 Ga0495638_0023255 Ga0495638_0023255_2990_3742 250
688 3300046460 Ga0495638_0029363 Ga0495638_0029363_834_1586 250
689 3300046460 Ga0495638_0031538 Ga0495638_0031538_487_1239 250
690 3300046460 Ga0495638_0040012 Ga0495638_0040012_158_910 250
691 3300046460 Ga0495638_0044269 Ga0495638_0044269_1069_1821 250
692 3300046460 Ga0495638_0079396 Ga0495638_0079396_812_1564 250
693 3300046460 Ga0495638_0094551 Ga0495638_0094551_980_1732 250
694 3300046460 Ga0495638_0112069 Ga0495638_0112069_671_1423 250
695 3300046463 Ga0495653_0023867 Ga0495653_0023867_2161_2913 250
696 3300046463 Ga0495653_0028038 Ga0495653_0028038_1087_1839 250
697 3300046471 Ga0495650_0006531 Ga0495650_0006531_6344_7108 250
698 3300046471 Ga0495650_0008276 Ga0495650_0008276_3640_4395 250
699 3300046471 Ga0495650_0008803 Ga0495650_0008803_3393_4145 250
700 3300046471 Ga0495650_0012860 Ga0495650_0012860_2268_3023 250
701 3300046471 Ga0495650_0013274 Ga0495650_0013274_2735_3487 250
702 3300046471 Ga0495650_0017190 Ga0495650_0017190_1021_1773 250
703 3300046471 Ga0495650_0044807 Ga0495650_0044807_32_784 250
704 3300046471 Ga0495650_0050278 Ga0495650_0050278_884_1636 250
705 3300046474 Ga0495605_0000062 Ga0495605_0000062_66427_67191 250
706 3300046474 Ga0495605_0000646 Ga0495605_0000646_17543_18298 250
707 3300046474 Ga0495605_0001077 Ga0495605_0001077_9114_9869 250
708 3300046474 Ga0495605_0001339 Ga0495605_0001339_8217_8972 250
709 3300046474 Ga0495605_0001776 Ga0495605_0001776_8564_9343 250
710 3300046474 Ga0495605_0006187 Ga0495605_0006187_2132_2884 250
711 3300046474 Ga0495605_0009458 Ga0495605_0009458_875_1627 250
712 3300046474 Ga0495605_0012296 Ga0495605_0012296_2454_3206 250
713 3300046474 Ga0495605_0015068 Ga0495605_0015068_2573_3325 250
714 3300046474 Ga0495605_0016679 Ga0495605_0016679_3160_3912 250
715 3300046474 Ga0495605_0019443 Ga0495605_0019443_766_1518 250
716 3300046474 Ga0495605_0030925 Ga0495605_0030925_1261_2037 250
717 3300046474 Ga0495605_0071978 Ga0495605_0071978_766_1518 250
718 3300046474 Ga0495605_0099032 Ga0495605_0099032_540_1292 250
719 3300046475 Ga0495639_0001422 Ga0495639_0001422_7196_7948 250
720 3300046475 Ga0495639_0050385 Ga0495639_0050385_151_903 250
721 3300046491 Ga0495584_0002039 Ga0495584_0002039_7174_7926 250
722 3300046491 Ga0495584_0002652 Ga0495584_0002652_2365_3117 250
723 3300046491 Ga0495584_0002719 Ga0495584_0002719_2085_2837 250
724 3300046491 Ga0495584_0012017 Ga0495584_0012017_3192_3947 250
725 3300046491 Ga0495584_0022672 Ga0495584_0022672_163_915 250
726 3300046491 Ga0495584_0024169 Ga0495584_0024169_219_971 250
727 3300046491 Ga0495584_0025701 Ga0495584_0025701_165_917 250
728 3300046491 Ga0495584_0032469 Ga0495584_0032469_1442_2194 250
729 3300046492 Ga0495585_0013923 Ga0495585_0013923_2813_3565 250
730 3300046492 Ga0495585_0017389 Ga0495585_0017389_1167_1919 250
731 3300046492 Ga0495585_0019417 Ga0495585_0019417_2114_2866 250
732 3300046492 Ga0495585_0024659 Ga0495585_0024659_2122_2874 250
733 3300046492 Ga0495585_0044316 Ga0495585_0044316_1655_2407 250
734 3300046492 Ga0495585_0093283 Ga0495585_0093283_46_798 250
735 3300046492 Ga0495585_0101357 Ga0495585_0101357_744_1496 250
736 3300046492 Ga0495585_0115135 Ga0495585_0115135_617_1369 250
737 3300046492 Ga0495585_0134065 Ga0495585_0134065_104_856 250
738 3300046492 Ga0495585_0273654 Ga0495585_0273654_30_782 250
739 3300046499 Ga0495594_0001089 Ga0495594_0001089_11733_12497 250
740 3300046499 Ga0495594_0014895 Ga0495594_0014895_2422_3174 250
741 3300046499 Ga0495594_0042261 Ga0495594_0042261_1594_2346 250
742 3300046500 Ga0495596_0009975 Ga0495596_0009975_1475_2227 250
743 3300046500 Ga0495596_0029630 Ga0495596_0029630_63_818 250
744 3300046500 Ga0495596_0040968 Ga0495596_0040968_216_968 250
745 3300046501 Ga0495607_0000535 Ga0495607_0000535_28183_28938 250
746 3300046501 Ga0495607_0001879 Ga0495607_0001879_8351_9130 250
747 3300046501 Ga0495607_0002217 Ga0495607_0002217_5374_6129 250
748 3300046501 Ga0495607_0003116 Ga0495607_0003116_8655_9407 250
749 3300046501 Ga0495607_0003678 Ga0495607_0003678_2425_3177 250
750 3300046501 Ga0495607_0004041 Ga0495607_0004041_8007_8762 250
751 3300046501 Ga0495607_0005642 Ga0495607_0005642_1023_1775 250
752 3300046501 Ga0495607_0008397 Ga0495607_0008397_5899_6651 250
753 3300046501 Ga0495607_0008623 Ga0495607_0008623_1516_2268 250
754 3300046501 Ga0495607_0016067 Ga0495607_0016067_3349_4101 250
755 3300046501 Ga0495607_0016115 Ga0495607_0016115_1348_2100 250
756 3300046501 Ga0495607_0021197 Ga0495607_0021197_3183_3935 250
757 3300046501 Ga0495607_0022358 Ga0495607_0022358_2262_3014 250
758 3300046501 Ga0495607_0024864 Ga0495607_0024864_789_1541 250
759 3300046501 Ga0495607_0027840 Ga0495607_0027840_753_1505 250
760 3300046501 Ga0495607_0035316 Ga0495607_0035316_2190_2942 250
761 3300046501 Ga0495607_0035669 Ga0495607_0035669_881_1636 250
762 3300046501 Ga0495607_0035839 Ga0495607_0035839_2132_2884 250
763 3300046501 Ga0495607_0036473 Ga0495607_0036473_2076_2828 250
764 3300046501 Ga0495607_0040027 Ga0495607_0040027_868_1623 250
765 3300046501 Ga0495607_0118487 Ga0495607_0118487_41_793 250
766 3300046501 Ga0495607_0148017 Ga0495607_0148017_251_1006 250
767 3300046501 Ga0495607_0158011 Ga0495607_0158011_331_1086 250
768 3300046501 Ga0495607_0188238 Ga0495607_0188238_251_1003 250
769 3300046506 Ga0495583_0000015 Ga0495583_0000015_239726_240490 250
770 3300046506 Ga0495583_0000821 Ga0495583_0000821_28921_29676 250
771 3300046506 Ga0495583_0001917 Ga0495583_0001917_8949_9704 250
772 3300046506 Ga0495583_0002771 Ga0495583_0002771_8252_9007 250
773 3300046506 Ga0495583_0002903 Ga0495583_0002903_1696_2448 250
774 3300046506 Ga0495583_0003231 Ga0495583_0003231_9408_10160 250
775 3300046506 Ga0495583_0003968 Ga0495583_0003968_8147_8902 250
776 3300046506 Ga0495583_0013052 Ga0495583_0013052_2502_3254 250
777 3300046506 Ga0495583_0021871 Ga0495583_0021871_358_1110 250
778 3300046506 Ga0495583_0070392 Ga0495583_0070392_175_927 250
779 3300046507 Ga0495606_0000214 Ga0495606_0000214_12162_12917 250
780 3300046507 Ga0495606_0000352 Ga0495606_0000352_4772_5527 250
781 3300046507 Ga0495606_0008604 Ga0495606_0008604_4693_5445 250
782 3300046507 Ga0495606_0010283 Ga0495606_0010283_2271_3023 250
783 3300046507 Ga0495606_0016147 Ga0495606_0016147_205_957 250
784 3300046507 Ga0495606_0017442 Ga0495606_0017442_2134_2886 250
785 3300046507 Ga0495606_0018459 Ga0495606_0018459_4335_5087 250
786 3300046507 Ga0495606_0018966 Ga0495606_0018966_1948_2700 250
787 3300046507 Ga0495606_0029803 Ga0495606_0029803_2143_2895 250
788 3300046507 Ga0495606_0045423 Ga0495606_0045423_172_924 250
789 3300046507 Ga0495606_0054683 Ga0495606_0054683_1692_2444 250
790 3300046507 Ga0495606_0083043 Ga0495606_0083043_942_1694 250
791 3300046512 Ga0495610_0001409 Ga0495610_0001409_2037_2789 250
792 3300046512 Ga0495610_0007419 Ga0495610_0007419_6463_7215 250
793 3300046512 Ga0495610_0009058 Ga0495610_0009058_1376_2131 250
794 3300046512 Ga0495610_0013793 Ga0495610_0013793_2663_3415 250
795 3300046512 Ga0495610_0016903 Ga0495610_0016903_1897_2649 250
796 3300046512 Ga0495610_0017393 Ga0495610_0017393_2649_3401 250
797 3300046512 Ga0495610_0018833 Ga0495610_0018833_23_775 250
798 3300046512 Ga0495610_0029194 Ga0495610_0029194_635_1390 250
799 3300046512 Ga0495610_0040845 Ga0495610_0040845_81_833 250
800 3300046512 Ga0495610_0043460 Ga0495610_0043460_1101_1853 250
801 3300046513 Ga0495616_0002776 Ga0495616_0002776_2463_3218 250
802 3300046513 Ga0495616_0006934 Ga0495616_0006934_1596_2348 250
803 3300046513 Ga0495616_0007447 Ga0495616_0007447_3549_4301 250
804 3300046513 Ga0495616_0013570 Ga0495616_0013570_2693_3445 250
805 3300046513 Ga0495616_0014709 Ga0495616_0014709_928_1680 250
806 3300046513 Ga0495616_0014717 Ga0495616_0014717_1041_1793 250
807 3300046513 Ga0495616_0026903 Ga0495616_0026903_194_946 250
808 3300046513 Ga0495616_0034667 Ga0495616_0034667_875_1627 250
809 3300046513 Ga0495616_0069666 Ga0495616_0069666_918_1670 250
810 3300046515 Ga0495620_0000033 Ga0495620_0000033_107327_108079 250
811 3300046515 Ga0495620_0000050 Ga0495620_0000050_75890_76654 250
812 3300046515 Ga0495620_0001299 Ga0495620_0001299_7510_8265 250
813 3300046515 Ga0495620_0001883 Ga0495620_0001883_3280_4032 250
814 3300046515 Ga0495620_0001955 Ga0495620_0001955_2752_3507 250
815 3300046515 Ga0495620_0014580 Ga0495620_0014580_455_1207 250
816 3300046515 Ga0495620_0014816 Ga0495620_0014816_2113_2865 250
817 3300046515 Ga0495620_0018478 Ga0495620_0018478_1660_2412 250
818 3300046515 Ga0495620_0024034 Ga0495620_0024034_2111_2863 250
819 3300046515 Ga0495620_0025048 Ga0495620_0025048_186_938 250
820 3300046515 Ga0495620_0026656 Ga0495620_0026656_639_1391 250
821 3300046515 Ga0495620_0106713 Ga0495620_0106713_125_877 250
822 3300046515 Ga0495620_0110020 Ga0495620_0110020_230_985 250
823 3300046518 Ga0495631_0001124 Ga0495631_0001124_8411_9163 250
824 3300046518 Ga0495631_0002205 Ga0495631_0002205_6912_7664 250
825 3300046518 Ga0495631_0002647 Ga0495631_0002647_851_1606 250
826 3300046518 Ga0495631_0004919 Ga0495631_0004919_2665_3417 250
827 3300046518 Ga0495631_0015810 Ga0495631_0015810_814_1566 250
828 3300046518 Ga0495631_0022043 Ga0495631_0022043_2013_2765 250
829 3300046518 Ga0495631_0030774 Ga0495631_0030774_285_1040 250
830 3300046518 Ga0495631_0131461 Ga0495631_0131461_257_1009 250
831 3300046519 Ga0495632_0000411 Ga0495632_0000411_38644_39396 250
832 3300046519 Ga0495632_0000919 Ga0495632_0000919_22997_23749 250
833 3300046519 Ga0495632_0001245 Ga0495632_0001245_1531_2286 250
834 3300046519 Ga0495632_0005948 Ga0495632_0005948_2283_3038 250
835 3300046519 Ga0495632_0015336 Ga0495632_0015336_2651_3403 250
836 3300046519 Ga0495632_0015397 Ga0495632_0015397_2335_3087 250
837 3300046519 Ga0495632_0020513 Ga0495632_0020513_119_871 250
838 3300046519 Ga0495632_0029326 Ga0495632_0029326_2005_2757 250
839 3300046519 Ga0495632_0034921 Ga0495632_0034921_1278_2033 250
840 3300046519 Ga0495632_0041423 Ga0495632_0041423_1191_1943 250
841 3300046519 Ga0495632_0055385 Ga0495632_0055385_205_957 250
842 3300046519 Ga0495632_0057487 Ga0495632_0057487_113_865 250
843 3300046519 Ga0495632_0114922 Ga0495632_0114922_472_1227 250
844 3300046519 Ga0495632_0154919 Ga0495632_0154919_30_782 250
845 3300046520 Ga0495637_0000020 Ga0495637_0000020_44088_44843 250
846 3300046520 Ga0495637_0001280 Ga0495637_0001280_4901_5656 250
847 3300046520 Ga0495637_0001840 Ga0495637_0001840_11251_12003 250
848 3300046520 Ga0495637_0001968 Ga0495637_0001968_2448_3200 250
849 3300046520 Ga0495637_0006061 Ga0495637_0006061_4569_5324 250
850 3300046520 Ga0495637_0006923 Ga0495637_0006923_2392_3144 250
851 3300046520 Ga0495637_0014561 Ga0495637_0014561_1937_2689 250
852 3300046520 Ga0495637_0014633 Ga0495637_0014633_1082_1834 250
853 3300046520 Ga0495637_0015329 Ga0495637_0015329_185_937 250
854 3300046520 Ga0495637_0015667 Ga0495637_0015667_113_865 250
855 3300046520 Ga0495637_0018055 Ga0495637_0018055_924_1703 250
856 3300046520 Ga0495637_0041090 Ga0495637_0041090_435_1187 250
857 3300046520 Ga0495637_0043708 Ga0495637_0043708_1082_1834 250
858 3300046520 Ga0495637_0052733 Ga0495637_0052733_569_1321 250
859 3300046520 Ga0495637_0065071 Ga0495637_0065071_667_1419 250
860 3300046520 Ga0495637_0118924 Ga0495637_0118924_168_920 250
861 3300046522 Ga0495643_0000320 Ga0495643_0000320_55296_56048 250
862 3300046522 Ga0495643_0001218 Ga0495643_0001218_8392_9144 250
863 3300046522 Ga0495643_0004327 Ga0495643_0004327_8146_8901 250
864 3300046522 Ga0495643_0021725 Ga0495643_0021725_800_1552 250
865 3300046522 Ga0495643_0022745 Ga0495643_0022745_2105_2857 250
866 3300046522 Ga0495643_0022942 Ga0495643_0022942_1476_2228 250
867 3300046522 Ga0495643_0088688 Ga0495643_0088688_830_1582 250
868 3300046522 Ga0495643_0101346 Ga0495643_0101346_104_856 250
869 3300046523 Ga0495644_0004800 Ga0495644_0004800_3888_4643 250
870 3300046523 Ga0495644_0083901 Ga0495644_0083901_120_872 250
871 3300046523 Ga0495644_0106367 Ga0495644_0106367_81_833 250
872 3300046524 Ga0495648_0001594 Ga0495648_0001594_7517_8269 250
873 3300046524 Ga0495648_0003563 Ga0495648_0003563_8147_8902 250
874 3300046524 Ga0495648_0005817 Ga0495648_0005817_7594_8346 250
875 3300046524 Ga0495648_0011636 Ga0495648_0011636_1649_2413 250
876 3300046524 Ga0495648_0016613 Ga0495648_0016613_2209_2961 250
877 3300046524 Ga0495648_0016627 Ga0495648_0016627_3054_3806 250
878 3300046524 Ga0495648_0017390 Ga0495648_0017390_1857_2609 250
879 3300046524 Ga0495648_0020938 Ga0495648_0020938_1122_1874 250
880 3300046524 Ga0495648_0021864 Ga0495648_0021864_2092_2844 250
881 3300046524 Ga0495648_0024558 Ga0495648_0024558_2930_3685 250
882 3300046524 Ga0495648_0026749 Ga0495648_0026749_2075_2827 250
883 3300046524 Ga0495648_0029807 Ga0495648_0029807_509_1261 250
884 3300046524 Ga0495648_0033225 Ga0495648_0033225_444_1196 250
885 3300046524 Ga0495648_0104606 Ga0495648_0104606_492_1244 250
886 3300046524 Ga0495648_0106166 Ga0495648_0106166_180_932 250
887 3300046526 Ga0495666_0017492 Ga0495666_0017492_1222_1974 250
888 3300046526 Ga0495666_0023671 Ga0495666_0023671_1241_1993 250
889 3300046526 Ga0495666_0038261 Ga0495666_0038261_945_1697 250
890 3300046528 Ga0495642_0004922 Ga0495642_0004922_1957_2709 250
891 3300046528 Ga0495642_0005686 Ga0495642_0005686_2502_3254 250
892 3300046529 Ga0495652_0224785 Ga0495652_0224785_159_911 250
893 3300046530 Ga0495654_0001141 Ga0495654_0001141_8527_9279 250
894 3300046530 Ga0495654_0001487 Ga0495654_0001487_2639_3403 250
895 3300046530 Ga0495654_0002649 Ga0495654_0002649_9266_10021 250
896 3300046530 Ga0495654_0003927 Ga0495654_0003927_3060_3812 250
897 3300046530 Ga0495654_0004238 Ga0495654_0004238_4834_5586 250
898 3300046530 Ga0495654_0004593 Ga0495654_0004593_2685_3437 250
899 3300046530 Ga0495654_0009894 Ga0495654_0009894_2459_3211 250
900 3300046530 Ga0495654_0010887 Ga0495654_0010887_2117_2869 250
901 3300046530 Ga0495654_0011698 Ga0495654_0011698_889_1641 250
902 3300046530 Ga0495654_0013026 Ga0495654_0013026_3107_3859 250
903 3300046530 Ga0495654_0014506 Ga0495654_0014506_2200_2952 250
904 3300046530 Ga0495654_0017585 Ga0495654_0017585_2188_2940 250
905 3300046530 Ga0495654_0024381 Ga0495654_0024381_444_1196 250
906 3300046530 Ga0495654_0024611 Ga0495654_0024611_33_785 250
907 3300046530 Ga0495654_0024770 Ga0495654_0024770_142_921 250
908 3300046530 Ga0495654_0038507 Ga0495654_0038507_1583_2335 250
909 3300046530 Ga0495654_0053248 Ga0495654_0053248_42_797 250
910 3300046530 Ga0495654_0133051 Ga0495654_0133051_223_975 250
911 3300046536 Ga0495587_0024624 Ga0495587_0024624_2024_2776 250
912 3300046538 Ga0495609_0000143 Ga0495609_0000143_67185_67949 250
913 3300046538 Ga0495609_0000372 Ga0495609_0000372_8407_9162 250
914 3300046538 Ga0495609_0000461 Ga0495609_0000461_8367_9122 250
915 3300046538 Ga0495609_0002012 Ga0495609_0002012_854_1606 250
916 3300046538 Ga0495609_0007912 Ga0495609_0007912_257_1009 250
917 3300046538 Ga0495609_0009727 Ga0495609_0009727_2131_2883 250
918 3300046538 Ga0495609_0012135 Ga0495609_0012135_2119_2871 250
919 3300046538 Ga0495609_0036586 Ga0495609_0036586_632_1387 250
920 3300046538 Ga0495609_0060380 Ga0495609_0060380_357_1109 250
921 3300046538 Ga0495609_0080702 Ga0495609_0080702_649_1404 250
922 3300046538 Ga0495609_0110548 Ga0495609_0110548_407_1159 250
923 3300046538 Ga0495609_0142220 Ga0495609_0142220_156_908 250
924 3300046538 Ga0495609_0159029 Ga0495609_0159029_188_940 250
925 3300046542 Ga0495597_0001205 Ga0495597_0001205_2298_3050 250
926 3300046542 Ga0495597_0001312 Ga0495597_0001312_9210_9989 250
927 3300046542 Ga0495597_0027032 Ga0495597_0027032_1461_2213 250
928 3300046542 Ga0495597_0051245 Ga0495597_0051245_229_981 250
929 3300046542 Ga0495597_0115660 Ga0495597_0115660_17_769 250
930 3300046543 Ga0495645_0046593 Ga0495645_0046593_61_813 250
931 3300046543 Ga0495645_0139413 Ga0495645_0139413_576_1334 250
932 3300046557 Ga0495622_0003397 Ga0495622_0003397_2996_3751 250
933 3300046557 Ga0495622_0004267 Ga0495622_0004267_4834_5586 250
934 3300046557 Ga0495622_0016895 Ga0495622_0016895_701_1453 250
935 3300046557 Ga0495622_0022545 Ga0495622_0022545_912_1664 250
936 3300046557 Ga0495622_0077097 Ga0495622_0077097_623_1375 250
937 3300046558 Ga0495633_0000084 Ga0495633_0000084_48304_49068 250
938 3300046558 Ga0495633_0002008 Ga0495633_0002008_11709_12461 250
939 3300046558 Ga0495633_0042381 Ga0495633_0042381_728_1480 250
940 3300046558 Ga0495633_0050811 Ga0495633_0050811_1030_1782 250
941 3300046558 Ga0495633_0059785 Ga0495633_0059785_68_820 250
942 3300046558 Ga0495633_0081463 Ga0495633_0081463_287_1039 250
943 3300046558 Ga0495633_0101063 Ga0495633_0101063_550_1302 250
944 3300046616 Ga0495668_0016198 Ga0495668_0016198_2663_3439 250
945 3300046616 Ga0495668_0039081 Ga0495668_0039081_220_972 250
946 3300046616 Ga0495668_0048596 Ga0495668_0048596_614_1366 250
947 3300046616 Ga0495668_0086471 Ga0495668_0086471_393_1148 250
948 3300046616 Ga0495668_0111135 Ga0495668_0111135_118_870 250
949 3300046642 Ga0495634_0016154 Ga0495634_0016154_1935_2687 250
950 3300046642 Ga0495634_0034059 Ga0495634_0034059_270_1022 250
951 3300046648 Ga0495611_0000246 Ga0495611_0000246_34570_35322 250
952 3300046648 Ga0495611_0000318 Ga0495611_0000318_29432_30187 250
953 3300046648 Ga0495611_0000910 Ga0495611_0000910_9288_10052 250
954 3300046648 Ga0495611_0012327 Ga0495611_0012327_1932_2684 250
955 3300046648 Ga0495611_0012423 Ga0495611_0012423_1423_2178 250
956 3300046648 Ga0495611_0039250 Ga0495611_0039250_114_866 250
957 3300046648 Ga0495611_0065125 Ga0495611_0065125_833_1585 250
958 3300046660 Ga0495625_0000133 Ga0495625_0000133_37718_38473 250
959 3300046660 Ga0495625_0002266 Ga0495625_0002266_18525_19277 250
960 3300046660 Ga0495625_0016901 Ga0495625_0016901_1924_2676 250
961 3300046660 Ga0495625_0023380 Ga0495625_0023380_1532_2284 250
962 3300046660 Ga0495625_0024270 Ga0495625_0024270_2918_3670 250
963 3300046660 Ga0495625_0049514 Ga0495625_0049514_893_1672 250
964 3300046660 Ga0495625_0068197 Ga0495625_0068197_567_1319 250
965 3300046660 Ga0495625_0080567 Ga0495625_0080567_983_1735 250
966 3300046660 Ga0495625_0082889 Ga0495625_0082889_113_865 250
967 3300046660 Ga0495625_0099666 Ga0495625_0099666_1185_1937 250
968 3300046660 Ga0495625_0134445 Ga0495625_0134445_133_885 250
969 3300046660 Ga0495625_0165042 Ga0495625_0165042_641_1393 250
970 3300046663 Ga0495635_0020355 Ga0495635_0020355_1316_2068 250
971 3300046664 Ga0495659_0000898 Ga0495659_0000898_2642_3394 250
972 3300046664 Ga0495659_0015064 Ga0495659_0015064_777_1529 250
973 3300046664 Ga0495659_0015433 Ga0495659_0015433_1605_2357 250
974 3300046665 Ga0495661_0000065 Ga0495661_0000065_75912_76676 250
975 3300046665 Ga0495661_0000370 Ga0495661_0000370_9158_9913 250
976 3300046665 Ga0495661_0000542 Ga0495661_0000542_8407_9162 250
977 3300046665 Ga0495661_0002713 Ga0495661_0002713_8023_8775 250
978 3300046665 Ga0495661_0004103 Ga0495661_0004103_1241_1993 250
979 3300046665 Ga0495661_0017257 Ga0495661_0017257_1043_1798 250
980 3300046665 Ga0495661_0020962 Ga0495661_0020962_2612_3364 250
981 3300046665 Ga0495661_0028388 Ga0495661_0028388_2115_2867 250
982 3300046665 Ga0495661_0037566 Ga0495661_0037566_2072_2824 250
983 3300046665 Ga0495661_0096538 Ga0495661_0096538_883_1635 250
984 3300046665 Ga0495661_0139530 Ga0495661_0139530_133_885 250
985 3300046674 Ga0495588_0026370 Ga0495588_0026370_677_1429 250
986 3300046674 Ga0495588_0038874 Ga0495588_0038874_828_1580 250
987 3300046674 Ga0495588_0133844 Ga0495588_0133844_442_1194 250
988 3300046679 Ga0495623_0014638 Ga0495623_0014638_1904_2656 250
989 3300046680 Ga0495646_0038893 Ga0495646_0038893_147_899 250
990 3300046680 Ga0495646_0042505 Ga0495646_0042505_209_961 250
991 3300046684 Ga0495669_0009543 Ga0495669_0009543_1067_1819 250
992 3300046689 Ga0495613_0036395 Ga0495613_0036395_2581_3333 250
993 3300046689 Ga0495613_0096462 Ga0495613_0096462_326_1078 250
994 3300046689 Ga0495613_0246713 Ga0495613_0246713_485_1237 250
995 3300046690 Ga0495624_0019569 Ga0495624_0019569_1085_1837 250
996 3300046691 Ga0495670_0000196 Ga0495670_0000196_1919_2671 250
997 3300046691 Ga0495670_0007919 Ga0495670_0007919_2212_2964 250
998 3300046691 Ga0495670_0008305 Ga0495670_0008305_1131_1883 250
999 3300046691 Ga0495670_0019556 Ga0495670_0019556_188_940 250
1000 3300046691 Ga0495670_0043044 Ga0495670_0043044_11_763 250
1001 3300046691 Ga0495670_0071733 Ga0495670_0071733_783_1535 250
1002 3300046691 Ga0495670_0155482 Ga0495670_0155482_284_1039 250
1003 3300046691 Ga0495670_0180922 Ga0495670_0180922_183_935 250
1004 3300046692 Ga0495671_0001993 Ga0495671_0001993_6630_7382 250
1005 3300046692 Ga0495671_0003014 Ga0495671_0003014_8492_9247 250
1006 3300046692 Ga0495671_0005998 Ga0495671_0005998_3753_4505 250
1007 3300046692 Ga0495671_0015164 Ga0495671_0015164_3060_3824 250
1008 3300046692 Ga0495671_0016969 Ga0495671_0016969_79_831 250
1009 3300046692 Ga0495671_0020083 Ga0495671_0020083_2670_3422 250
1010 3300046692 Ga0495671_0026931 Ga0495671_0026931_110_862 250
1011 3300046692 Ga0495671_0032740 Ga0495671_0032740_214_966 250
1012 3300046692 Ga0495671_0037455 Ga0495671_0037455_1620_2372 250
1013 3300046692 Ga0495671_0037575 Ga0495671_0037575_683_1435 250
1014 3300046692 Ga0495671_0077881 Ga0495671_0077881_74_826 250
1015 3300046692 Ga0495671_0226931 Ga0495671_0226931_42_797 250
1016 3300046694 Ga0495649_0004325 Ga0495649_0004325_7494_8249 250
1017 3300046694 Ga0495649_0005670 Ga0495649_0005670_4708_5460 250
1018 3300046694 Ga0495649_0011853 Ga0495649_0011853_3452_4204 250
1019 3300046694 Ga0495649_0015412 Ga0495649_0015412_44_796 250
1020 3300046694 Ga0495649_0016436 Ga0495649_0016436_3351_4103 250
1021 3300046694 Ga0495649_0016885 Ga0495649_0016885_968_1720 250
1022 3300046694 Ga0495649_0023537 Ga0495649_0023537_1793_2545 250
1023 3300046694 Ga0495649_0026907 Ga0495649_0026907_105_857 250
1024 3300046694 Ga0495649_0036840 Ga0495649_0036840_1294_2046 250
1025 3300046694 Ga0495649_0050329 Ga0495649_0050329_416_1168 250
1026 3300046694 Ga0495649_0064061 Ga0495649_0064061_1176_1928 250
1027 3300046694 Ga0495649_0095171 Ga0495649_0095171_90_842 250
1028 3300046694 Ga0495649_0207827 Ga0495649_0207827_23_802 250
1029 3300046794 Ga0495589_0000779 Ga0495589_0000779_8250_9002 250
1030 3300046794 Ga0495589_0001384 Ga0495589_0001384_8422_9174 250
1031 3300046794 Ga0495589_0001986 Ga0495589_0001986_8817_9581 250
1032 3300046794 Ga0495589_0005362 Ga0495589_0005362_3994_4746 250
1033 3300046794 Ga0495589_0012516 Ga0495589_0012516_2250_3002 250
1034 3300046794 Ga0495589_0013358 Ga0495589_0013358_1320_2072 250
1035 3300046794 Ga0495589_0016506 Ga0495589_0016506_2011_2763 250
1036 3300046794 Ga0495589_0026167 Ga0495589_0026167_87_839 250
1037 3300046794 Ga0495589_0067482 Ga0495589_0067482_798_1550 250
1038 3300046794 Ga0495589_0075021 Ga0495589_0075021_772_1524 250
1039 3300046809 Ga0495600_0029082 Ga0495600_0029082_2453_3205 250
1040 3300046810 Ga0495660_0000797 Ga0495660_0000797_17940_18716 250
1041 3300046810 Ga0495660_0002243 Ga0495660_0002243_2477_3256 250
1042 3300046810 Ga0495660_0002803 Ga0495660_0002803_2863_3627 250
1043 3300046810 Ga0495660_0008873 Ga0495660_0008873_1595_2347 250
1044 3300046810 Ga0495660_0010257 Ga0495660_0010257_1636_2388 250
1045 3300046810 Ga0495660_0020048 Ga0495660_0020048_1001_1753 250
1046 3300046810 Ga0495660_0020182 Ga0495660_0020182_956_1708 250
1047 3300046810 Ga0495660_0022695 Ga0495660_0022695_888_1640 250
1048 3300046810 Ga0495660_0031653 Ga0495660_0031653_1113_1865 250
1049 3300046810 Ga0495660_0040945 Ga0495660_0040945_1275_2030 250
1050 3300046810 Ga0495660_0041129 Ga0495660_0041129_1640_2392 250
1051 3300046810 Ga0495660_0056596 Ga0495660_0056596_824_1576 250
1052 3300046810 Ga0495660_0191448 Ga0495660_0191448_122_874 250
1053 3300047315 Ga0495581_0016653 Ga0495581_0016653_850_1602 250
1054 3300047317 Ga0495604_0074768 Ga0495604_0074768_834_1586 250
1055 3300047318 Ga0495636_0068344 Ga0495636_0068344_504_1256 250
1056 3300047319 Ga0495674_0026203 Ga0495674_0026203_2578_3330 250
1057 3300047320 Ga0495672_0000763 Ga0495672_0000763_25893_26645 250
1058 3300047320 Ga0495672_0006798 Ga0495672_0006798_6279_7031 250
1059 3300047320 Ga0495672_0007247 Ga0495672_0007247_400_1152 250
1060 3300047320 Ga0495672_0017675 Ga0495672_0017675_1522_2274 250
1061 3300047320 Ga0495672_0018132 Ga0495672_0018132_2736_3488 250
1062 3300047320 Ga0495672_0022743 Ga0495672_0022743_1220_1972 250
1063 3300047320 Ga0495672_0026683 Ga0495672_0026683_2516_3268 250
1064 3300047320 Ga0495672_0028332 Ga0495672_0028332_730_1482 250
1065 3300047320 Ga0495672_0029664 Ga0495672_0029664_171_923 250
1066 3300047320 Ga0495672_0033268 Ga0495672_0033268_2207_2959 250
1067 3300047320 Ga0495672_0033865 Ga0495672_0033865_2231_2983 250
1068 3300047320 Ga0495672_0038784 Ga0495672_0038784_589_1344 250
1069 3300047320 Ga0495672_0048938 Ga0495672_0048938_98_874 250
1070 3300047320 Ga0495672_0107078 Ga0495672_0107078_125_877 250
1071 3300047321 Ga0495676_0000181 Ga0495676_0000181_39416_40171 250
1072 3300047321 Ga0495676_0027747 Ga0495676_0027747_1965_2717 250
1073 3300047321 Ga0495676_0034485 Ga0495676_0034485_3331_4083 250
1074 3300047322 Ga0495680_0023975 Ga0495680_0023975_1904_2656 250
1075 3300047322 Ga0495680_0031499 Ga0495680_0031499_2625_3377 250
1076 3300047322 Ga0495680_0128016 Ga0495680_0128016_899_1651 250
1077 3300047323 Ga0495683_0000109 Ga0495683_0000109_7818_8582 250
1078 3300047323 Ga0495683_0011206 Ga0495683_0011206_1734_2486 250
1079 3300047323 Ga0495683_0012454 Ga0495683_0012454_1053_1805 250
1080 3300047323 Ga0495683_0014543 Ga0495683_0014543_3095_3847 250
1081 3300047323 Ga0495683_0017273 Ga0495683_0017273_2075_2827 250
1082 3300047323 Ga0495683_0031175 Ga0495683_0031175_921_1676 250
1083 3300047323 Ga0495683_0057945 Ga0495683_0057945_506_1258 250
1084 3300047323 Ga0495683_0083113 Ga0495683_0083113_195_947 250
1085 3300047323 Ga0495683_0089182 Ga0495683_0089182_565_1320 250
1086 3300047323 Ga0495683_0091486 Ga0495683_0091486_30_782 250
1087 3300047323 Ga0495683_0097942 Ga0495683_0097942_576_1328 250
1088 3300047323 Ga0495683_0111518 Ga0495683_0111518_541_1293 250
1089 3300047443 Ga0495687_002205 Ga0495687_002205_1612_2364 250
1090 3300047443 Ga0495687_011390 Ga0495687_011390_1879_2631 250
1091 3300047443 Ga0495687_017368 Ga0495687_017368_2742_3494 250
1092 3300047443 Ga0495687_021739 Ga0495687_021739_2257_3009 250
1093 3300047444 Ga0495675_0023506 Ga0495675_0023506_1523_2275 250
1094 3300047446 Ga0495679_000132 Ga0495679_000132_27750_28505 250
1095 3300047446 Ga0495679_001170 Ga0495679_001170_8819_9583 250
1096 3300047446 Ga0495679_001404 Ga0495679_001404_1574_2326 250
1097 3300047446 Ga0495679_004863 Ga0495679_004863_1408_2160 250
1098 3300047446 Ga0495679_009430 Ga0495679_009430_97_849 250
1099 3300047446 Ga0495679_009497 Ga0495679_009497_1215_1967 250
1100 3300047446 Ga0495679_011133 Ga0495679_011133_1192_1944 250
1101 3300047446 Ga0495679_013934 Ga0495679_013934_106_858 250
1102 3300047446 Ga0495679_048035 Ga0495679_048035_529_1281 250
1103 3300047447 Ga0495685_006140 Ga0495685_006140_1166_1918 250
1104 3300047469 Ga0495673_0001604 Ga0495673_0001604_8378_9133 250
1105 3300047469 Ga0495673_0002244 Ga0495673_0002244_8180_8935 250
1106 3300047469 Ga0495673_0002585 Ga0495673_0002585_3464_4216 250
1107 3300047469 Ga0495673_0002908 Ga0495673_0002908_2648_3403 250
1108 3300047469 Ga0495673_0003031 Ga0495673_0003031_8401_9180 250
1109 3300047469 Ga0495673_0007181 Ga0495673_0007181_5326_6081 250
1110 3300047469 Ga0495673_0007528 Ga0495673_0007528_3389_4141 250
1111 3300047469 Ga0495673_0010899 Ga0495673_0010899_3748_4512 250
1112 3300047469 Ga0495673_0013618 Ga0495673_0013618_2398_3150 250
1113 3300047469 Ga0495673_0016693 Ga0495673_0016693_876_1628 250
1114 3300047469 Ga0495673_0017586 Ga0495673_0017586_1999_2754 250
1115 3300047469 Ga0495673_0030699 Ga0495673_0030699_1674_2429 250
1116 3300047469 Ga0495673_0040906 Ga0495673_0040906_143_898 250
1117 3300047469 Ga0495673_0077383 Ga0495673_0077383_414_1166 250
1118 3300047469 Ga0495673_0109790 Ga0495673_0109790_306_1058 250
1119 3300047469 Ga0495673_0119249 Ga0495673_0119249_18_770 250
1120 3300047470 Ga0495681_0000608 Ga0495681_0000608_2227_2979 250
1121 3300047470 Ga0495681_0001925 Ga0495681_0001925_5749_6504 250
1122 3300047470 Ga0495681_0005164 Ga0495681_0005164_6510_7274 250
1123 3300047470 Ga0495681_0009549 Ga0495681_0009549_3548_4300 250
1124 3300047470 Ga0495681_0011308 Ga0495681_0011308_3483_4235 250
1125 3300047470 Ga0495681_0013682 Ga0495681_0013682_1206_1958 250
1126 3300047470 Ga0495681_0013946 Ga0495681_0013946_2318_3070 250
1127 3300047470 Ga0495681_0015218 Ga0495681_0015218_2482_3234 250
1128 3300047470 Ga0495681_0023851 Ga0495681_0023851_2279_3031 250
1129 3300047470 Ga0495681_0026196 Ga0495681_0026196_2030_2782 250
1130 3300047470 Ga0495681_0031858 Ga0495681_0031858_377_1129 250
1131 3300047470 Ga0495681_0040042 Ga0495681_0040042_31_783 250
1132 3300047470 Ga0495681_0062302 Ga0495681_0062302_44_796 250
1133 3300047470 Ga0495681_0103775 Ga0495681_0103775_347_1099 250
1134 3300047471 Ga0495684_0036875 Ga0495684_0036875_2621_3373 250
1135 3300047472 Ga0495686_0015884 Ga0495686_0015884_3223_3975 250
1136 3300047472 Ga0495686_0026840 Ga0495686_0026840_906_1658 250
1137 3300047472 Ga0495686_0050489 Ga0495686_0050489_939_1694 250
1138 3300047472 Ga0495686_0080947 Ga0495686_0080947_1149_1901 250
1139 3300047472 Ga0495686_0100527 Ga0495686_0100527_304_1056 250
1140 3300047673 Ga0495593_0020514 Ga0495593_0020514_2613_3365 250
1141 3300047673 Ga0495593_0056814 Ga0495593_0056814_394_1146 250
1142 3300048088 Ga0495602_0041830 Ga0495602_0041830_2548_3300 250
1143 3300048088 Ga0495602_0126370 Ga0495602_0126370_692_1444 250
1144 3300048091 Ga0495626_0000218 Ga0495626_0000218_29889_30644 250
1145 3300048091 Ga0495626_0003946 Ga0495626_0003946_2567_3319 250
1146 3300048091 Ga0495626_0004767 Ga0495626_0004767_4734_5486 250
1147 3300048091 Ga0495626_0008938 Ga0495626_0008938_3066_3818 250
1148 3300048091 Ga0495626_0010760 Ga0495626_0010760_2569_3321 250
1149 3300048091 Ga0495626_0011220 Ga0495626_0011220_1458_2210 250
1150 3300048091 Ga0495626_0016408 Ga0495626_0016408_2120_2872 250
1151 3300048091 Ga0495626_0028826 Ga0495626_0028826_183_935 250
1152 3300048091 Ga0495626_0068403 Ga0495626_0068403_643_1395 250
1153 3300048903 Ga0496100_0404148 Ga0496100_0404148_253_1005 250
1154 3300048905 Ga0496102_0022878 Ga0496102_0022878_2812_3564 250
1155 3300048905 Ga0496102_0307138 Ga0496102_0307138_597_1349 250
1156 3300048906 Ga0496103_0014475 Ga0496103_0014475_2257_3009 250
1157 3300048909 Ga0496106_0175324 Ga0496106_0175324_876_1628 250
1158 3300048909 Ga0496106_0338029 Ga0496106_0338029_445_1197 250
1159 3300048910 Ga0496107_0395273 Ga0496107_0395273_120_872 250
1160 3300048913 Ga0496110_0139108 Ga0496110_0139108_1153_1908 250
1161 3300048914 Ga0496111_0094806 Ga0496111_0094806_327_1079 250
1162 3300048917 Ga0496114_0037332 Ga0496114_0037332_2174_2926 250
1163 3300048918 Ga0496115_0088224 Ga0496115_0088224_189_941 250
1164 3300048919 Ga0496116_0000567 Ga0496116_0000567_40503_41255 250
1165 3300048919 Ga0496116_0000699 Ga0496116_0000699_34541_35293 250
1166 3300048919 Ga0496116_0005627 Ga0496116_0005627_2693_3445 250
1167 3300048919 Ga0496116_0017648 Ga0496116_0017648_1241_1993 250
1168 3300048919 Ga0496116_0018115 Ga0496116_0018115_1739_2494 250
1169 3300048919 Ga0496116_0021247 Ga0496116_0021247_2261_3013 250
1170 3300048919 Ga0496116_0032467 Ga0496116_0032467_1802_2554 250
1171 3300048919 Ga0496116_0044587 Ga0496116_0044587_123_875 250
1172 3300048919 Ga0496116_0167660 Ga0496116_0167660_365_1117 250
1173 3300048920 Ga0496117_0000970 Ga0496117_0000970_10554_11306 250
1174 3300048920 Ga0496117_0003533 Ga0496117_0003533_2181_2933 250
1175 3300048920 Ga0496117_0004132 Ga0496117_0004132_13990_14742 250
1176 3300048920 Ga0496117_0005390 Ga0496117_0005390_8023_8775 250
1177 3300048920 Ga0496117_0005662 Ga0496117_0005662_4826_5578 250
1178 3300048920 Ga0496117_0019503 Ga0496117_0019503_2030_2782 250
1179 3300048920 Ga0496117_0022678 Ga0496117_0022678_4233_4985 250
1180 3300048920 Ga0496117_0046809 Ga0496117_0046809_2234_2986 250
1181 3300048920 Ga0496117_0049246 Ga0496117_0049246_118_870 250
1182 3300048920 Ga0496117_0067810 Ga0496117_0067810_1031_1786 250
1183 3300048920 Ga0496117_0076958 Ga0496117_0076958_1412_2164 250
1184 3300048920 Ga0496117_0082920 Ga0496117_0082920_572_1327 250
1185 3300048920 Ga0496117_0084966 Ga0496117_0084966_571_1323 250
1186 3300048920 Ga0496117_0129610 Ga0496117_0129610_648_1400 250
1187 3300048920 Ga0496117_0132791 Ga0496117_0132791_183_935 250
1188 3300048920 Ga0496117_0231622 Ga0496117_0231622_212_964 250
1189 3300048921 Ga0496118_0003741 Ga0496118_0003741_8279_9031 250
1190 3300048921 Ga0496118_0006996 Ga0496118_0006996_1141_1893 250
1191 3300048921 Ga0496118_0013161 Ga0496118_0013161_1432_2184 250
1192 3300048921 Ga0496118_0027624 Ga0496118_0027624_2754_3506 250
1193 3300048921 Ga0496118_0035067 Ga0496118_0035067_2235_2987 250
1194 3300048921 Ga0496118_0038682 Ga0496118_0038682_1370_2122 250
1195 3300048921 Ga0496118_0041588 Ga0496118_0041588_168_920 250
1196 3300048921 Ga0496118_0047002 Ga0496118_0047002_1603_2355 250
1197 3300048921 Ga0496118_0050421 Ga0496118_0050421_1935_2687 250
1198 3300048921 Ga0496118_0054304 Ga0496118_0054304_2127_2879 250
1199 3300048921 Ga0496118_0079652 Ga0496118_0079652_1052_1804 250
1200 3300048921 Ga0496118_0104428 Ga0496118_0104428_559_1314 250
1201 3300048921 Ga0496118_0209951 Ga0496118_0209951_46_798 250
1202 3300048922 Ga0496119_0000071 Ga0496119_0000071_97402_98154 250
1203 3300048922 Ga0496119_0012870 Ga0496119_0012870_1334_2086 250
1204 3300048922 Ga0496119_0018070 Ga0496119_0018070_4243_4995 250
1205 3300048922 Ga0496119_0045801 Ga0496119_0045801_1868_2620 250
1206 3300048923 Ga0496120_0001138 Ga0496120_0001138_28716_29468 250
1207 3300048923 Ga0496120_0010521 Ga0496120_0010521_1712_2464 250
1208 3300048923 Ga0496120_0015296 Ga0496120_0015296_4245_4997 250
1209 3300048923 Ga0496120_0061911 Ga0496120_0061911_111_863 250
1210 3300048924 Ga0496121_0001560 Ga0496121_0001560_28376_29131 250
1211 3300048924 Ga0496121_0001800 Ga0496121_0001800_8246_8998 250
1212 3300048924 Ga0496121_0002238 Ga0496121_0002238_10456_11211 250
1213 3300048924 Ga0496121_0017913 Ga0496121_0017913_3185_3937 250
1214 3300048924 Ga0496121_0022105 Ga0496121_0022105_115_867 250
1215 3300048924 Ga0496121_0034112 Ga0496121_0034112_3635_4387 250
1216 3300048924 Ga0496121_0051576 Ga0496121_0051576_2483_3235 250
1217 3300048924 Ga0496121_0064601 Ga0496121_0064601_945_1697 250
1218 3300048924 Ga0496121_0100967 Ga0496121_0100967_1192_1944 250
1219 3300048924 Ga0496121_0103755 Ga0496121_0103755_1108_1860 250
1220 3300048924 Ga0496121_0290287 Ga0496121_0290287_55_807 250
1221 3300048924 Ga0496121_0425762 Ga0496121_0425762_26_778 250
1222 3300048925 Ga0496122_0001196 Ga0496122_0001196_33839_34594 250
1223 3300048925 Ga0496122_0002157 Ga0496122_0002157_3969_4721 250
1224 3300048925 Ga0496122_0010986 Ga0496122_0010986_5574_6326 250
1225 3300048925 Ga0496122_0011862 Ga0496122_0011862_7672_8424 250
1226 3300048925 Ga0496122_0013092 Ga0496122_0013092_4535_5287 250
1227 3300048925 Ga0496122_0026651 Ga0496122_0026651_3255_4019 250
1228 3300048925 Ga0496122_0030146 Ga0496122_0030146_2631_3383 250
1229 3300048925 Ga0496122_0112687 Ga0496122_0112687_443_1195 250
1230 3300048925 Ga0496122_0146723 Ga0496122_0146723_120_872 250
1231 3300048926 Ga0496123_0000594 Ga0496123_0000594_51326_52081 250
1232 3300048926 Ga0496123_0001464 Ga0496123_0001464_7897_8649 250
1233 3300048926 Ga0496123_0010203 Ga0496123_0010203_5478_6230 250
1234 3300048926 Ga0496123_0014657 Ga0496123_0014657_3816_4568 250
1235 3300048926 Ga0496123_0020924 Ga0496123_0020924_4275_5027 250
1236 3300048926 Ga0496123_0021000 Ga0496123_0021000_3270_4025 250
1237 3300048926 Ga0496123_0045647 Ga0496123_0045647_2131_2883 250
1238 3300048926 Ga0496123_0066389 Ga0496123_0066389_801_1553 250
1239 3300048926 Ga0496123_0069627 Ga0496123_0069627_1112_1864 250
1240 3300048927 Ga0496124_0001266 Ga0496124_0001266_8401_9156 250
1241 3300048927 Ga0496124_0007109 Ga0496124_0007109_4124_4876 250
1242 3300048927 Ga0496124_0010051 Ga0496124_0010051_8498_9250 250
1243 3300048927 Ga0496124_0011281 Ga0496124_0011281_5590_6342 250
1244 3300048927 Ga0496124_0015327 Ga0496124_0015327_4693_5445 250
1245 3300048927 Ga0496124_0028965 Ga0496124_0028965_4023_4775 250
1246 3300048927 Ga0496124_0049689 Ga0496124_0049689_1620_2372 250
1247 3300048927 Ga0496124_0050723 Ga0496124_0050723_400_1152 250
1248 3300048927 Ga0496124_0054961 Ga0496124_0054961_979_1734 250
1249 3300048927 Ga0496124_0058314 Ga0496124_0058314_265_1044 250
1250 3300048927 Ga0496124_0059149 Ga0496124_0059149_1963_2715 250
1251 3300048927 Ga0496124_0066815 Ga0496124_0066815_1634_2389 250
1252 3300048927 Ga0496124_0145107 Ga0496124_0145107_41_793 250
1253 3300048927 Ga0496124_0158153 Ga0496124_0158153_856_1608 250
1254 3300048927 Ga0496124_0159552 Ga0496124_0159552_973_1725 250
1255 3300048927 Ga0496124_0160345 Ga0496124_0160345_785_1537 250
1256 3300048927 Ga0496124_0200465 Ga0496124_0200465_108_860 250
1257 3300048928 Ga0496125_0003386 Ga0496125_0003386_2633_3385 250
1258 3300048928 Ga0496125_0005700 Ga0496125_0005700_8010_8762 250
1259 3300048928 Ga0496125_0006235 Ga0496125_0006235_7921_8673 250
1260 3300048928 Ga0496125_0015371 Ga0496125_0015371_2664_3416 250
1261 3300048928 Ga0496125_0027647 Ga0496125_0027647_703_1455 250
1262 3300048928 Ga0496125_0033709 Ga0496125_0033709_2520_3272 250
1263 3300048928 Ga0496125_0036209 Ga0496125_0036209_147_899 250
1264 3300048928 Ga0496125_0036277 Ga0496125_0036277_2657_3409 250
1265 3300048928 Ga0496125_0050898 Ga0496125_0050898_1001_1753 250
1266 3300048928 Ga0496125_0052457 Ga0496125_0052457_407_1159 250
1267 3300048928 Ga0496125_0121994 Ga0496125_0121994_116_868 250
1268 3300048928 Ga0496125_0130661 Ga0496125_0130661_79_831 250
1269 3300048928 Ga0496125_0150298 Ga0496125_0150298_62_814 250
1270 3300048929 Ga0496126_0017913 Ga0496126_0017913_4713_5465 250
1271 3300048929 Ga0496126_0033815 Ga0496126_0033815_1612_2364 250
1272 3300048929 Ga0496126_0072120 Ga0496126_0072120_544_1296 250
1273 3300049459 Ga0495678_000017 Ga0495678_000017_205918_206682 250
1274 3300049459 Ga0495678_002786 Ga0495678_002786_8519_9271 250
1275 3300049459 Ga0495678_004463 Ga0495678_004463_4995_5747 250
1276 3300049459 Ga0495678_005530 Ga0495678_005530_5350_6105 250
1277 3300049459 Ga0495678_005656 Ga0495678_005656_845_1600 250
1278 3300049459 Ga0495678_007223 Ga0495678_007223_1970_2722 250
1279 3300049459 Ga0495678_008310 Ga0495678_008310_2308_3060 250
1280 3300049459 Ga0495678_008395 Ga0495678_008395_3556_4308 250
1281 3300049459 Ga0495678_010590 Ga0495678_010590_1543_2295 250
1282 3300049459 Ga0495678_012667 Ga0495678_012667_188_940 250
1283 3300049459 Ga0495678_013642 Ga0495678_013642_2143_2895 250
1284 3300049459 Ga0495678_024836 Ga0495678_024836_133_885 250
1285 3300049460 Ga0495682_0007167 Ga0495682_0007167_1015_1767 250
1286 3300049460 Ga0495682_0008498 Ga0495682_0008498_595_1347 250
1287 3300049460 Ga0495682_0010677 Ga0495682_0010677_2445_3197 250
1288 3300049569 Ga0501032_0072466 Ga0501032_0072466_595_1350 250
1289 3300049571 Ga0501034_0000165 Ga0501034_0000165_17364_18116 250
1290 3300049662 Ga0501222_000894 Ga0501222_000894_2320_3072 250
1291 3300049758 Ga0501241_000551 Ga0501241_000551_4940_5692 250
1292 3300049853 Ga0501226_001319 Ga0501226_001319_1661_2413 250
1293 3300050489 nmdc:mga03683_33614_c1 nmdc:mga03683_33614_c1_635_1387 250
1294 3300050491 nmdc:mga00v17_107864_c1 nmdc:mga00v17_107864_c1_857_1609 250
1295 3300050491 nmdc:mga00v17_141685_c1 nmdc:mga00v17_141685_c1_657_1409 250
1296 3300050491 nmdc:mga00v17_296359_c1 nmdc:mga00v17_296359_c1_129_881 250
1297 3300050514 nmdc:mga08x19_250796_c1 nmdc:mga08x19_250796_c1_427_1179 250
1298 3300053111 Ga0500572_003714 Ga0500572_003714_770_1522 250
1299 3300053135 Ga0500659_0002861 Ga0500659_0002861_1312_2064 250
1300 3300053140 Ga0500573_0033947 Ga0500573_0033947_1499_2278 250
1301 3300053147 Ga0500589_104972 Ga0500589_104972_439_1191 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06293

Kdo

Lipopolysaccharide kinase (Kdo/WaaP) family

22

223

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jbp-assembly11.cif.gz_K protein kinase mk2 in complex with an inhibitor (crystal form-2, co- crystallization) 0.7079 30 203
3ka0-assembly1.cif.gz_A mk2 complex with inhibitor 6-(5-(2-aminopyrimidin-4-ylamino)-2-hydroxyphenyl)-n-methylbenzo[b]thiophene-2-carboxamide 0.7068 45 202
6dfl-assembly1.cif.gz_A waap in complex with acyl carrier protein 0.6973 1 244
4yzb-assembly2.cif.gz_B cdpk1 from eimeria tenella in complex with inhibitor uw1521 0.6907 27 192
6dfl-assembly1.cif.gz_A waap in complex with acyl carrier protein 0.6898 1 244
ID Description Score Start End Superfamily
af_P27294_11_213_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8386 24 223 1.10.510.10
af_P27294_11_213_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8236 24 223 1.10.510.10
af_A0A1D8PK98_270_538_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8219 123 189 1.10.510.10
af_O16940_300_542_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8176 122 189 1.10.510.10
af_Q9Y7W4_138_388_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8042 122 189 1.10.510.10
ID Description Score Start End GO Terms
AF-A0A2R7TCH5-F1-model_v4 deleted 0.9959 1 117
AF-A0A423HIS5-F1-model_v4 Lipopolysaccharide kinase 0.9917 5 184 GO:0016301
AF-A0A2R7TCH5-F1-model_v4 deleted 0.9875 1 117
AF-A0A2U1BXV5-F1-model_v4 deleted 0.9872 1 250
AF-A0A3D3M3X6-F1-model_v4 Lipopolysaccharide kinase 0.987 1 143 GO:0016301

Feature Viewer

pLDDT pTM Quality
95.42 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map