F492166

General Info

Members Datasets Scaffolds Average Seq Length
1248 267 1247 226

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0009530|Ga0395900_0009530_9088_9828
Length 246
Sequence MKTGVWRGSRHAPAKEGNPMPLNPNASIEITAFRWVPEFAQGVVRDLRARWALEEAGLDYRVRLLDQQRPLDYLKEQPFDQVPCFKDGTVAIFETGAIVQYIGEKTESLLPRDPQGKFRAIQWTYAALNSVEPAIFNILAIDIFYAGEEWAKLRRPGAVDFAKLKLKRVSDWLGDKQWLEGDRFTIGDLIMVTSLRFLRHTNLVPEFPNLAAYVKRGQARPAFQQALNDQLAAYAANQPQPEGAAA

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
198 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
199 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
200 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
201 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
202 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
209 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
210 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
211 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
212 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
216 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
223 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
226 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
248 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
254 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
267 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 1.28
Isolates 0.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 2.24
Rhizosphere 96.88
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1018735 3300001904 Unclassified 1094
2 JGI24752J21851_1024427 3300001976 Bacteria 792
3 JGI24746J21847_1003684 3300001977 Bacteria 2419
4 JGI24740J21852_10002180 3300001979 Bacteria 8953
5 JGI24740J21852_10012385 3300001979 Bacteria 3215
6 JGI24739J22299_10000785 3300001989 Bacteria 11588
7 JGI24739J22299_10001236 3300001989 Bacteria 9612
8 JGI24739J22299_10003474 3300001989 Bacteria 6012
9 JGI24739J22299_10022013 3300001989 Bacteria 2264
10 JGI24737J22298_10000076 3300001990 Bacteria 29110
11 JGI24737J22298_10001280 3300001990 Bacteria 8902
12 JGI24737J22298_10016756 3300001990 Bacteria 2365
13 JGI24737J22298_10113929 3300001990 Bacteria 799
14 JGI24735J21928_10001228 3300002067 Bacteria 9104
15 JGI24735J21928_10017104 3300002067 Bacteria 2244
16 JGI24738J21930_10000015 3300002075 Bacteria 33032
17 JGI24738J21930_10004676 3300002075 Bacteria 3334
18 JGI24738J21930_10008744 3300002075 Bacteria 2297
19 JGI24744J21845_10020875 3300002077 Bacteria 1290
20 JGI24034J26672_10020429 3300002239 Bacteria 1038
21 JGI24742J22300_10004292 3300002244 Bacteria 2330
22 JGI24742J22300_10019384 3300002244 Bacteria 1155
23 Ga0065712_10092194 3300005290 Bacteria 2340
24 Ga0065712_10339754 3300005290 Unclassified 802
25 Ga0065715_10000390 3300005293 Bacteria 15687
26 Ga0065715_10037615 3300005293 Bacteria 1315
27 Ga0065715_10194445 3300005293 Bacteria 1396
28 Ga0070658_10001186 3300005327 Bacteria 22303
29 Ga0070658_10003103 3300005327 Bacteria 13704
30 Ga0070658_10039854 3300005327 Bacteria 3790
31 Ga0070658_10041084 3300005327 Bacteria 3731
32 Ga0070658_10079865 3300005327 Bacteria 2686
33 Ga0070658_10110552 3300005327 Bacteria 2276
34 Ga0070658_10139029 3300005327 Bacteria 2028
35 Ga0070658_10146442 3300005327 Bacteria 1975
36 Ga0070658_10157244 3300005327 Bacteria 1906
37 Ga0070658_10345722 3300005327 Bacteria 1273
38 Ga0070658_10368886 3300005327 Bacteria 1230
39 Ga0070676_10006688 3300005328 Bacteria 6175
40 Ga0070676_10086238 3300005328 Bacteria 1915
41 Ga0070676_10110149 3300005328 Bacteria 1713
42 Ga0070683_100004557 3300005329 Bacteria 11439
43 Ga0070683_100035204 3300005329 Bacteria 4577
44 Ga0070683_100084143 3300005329 Bacteria 2980
45 Ga0070683_100209754 3300005329 Bacteria 1850
46 Ga0070690_100046104 3300005330 Bacteria 2771
47 Ga0070690_100393950 3300005330 Unclassified 1015
48 Ga0070670_100000612 3300005331 Bacteria 27973
49 Ga0070670_100000872 3300005331 Bacteria 23718
50 Ga0070670_100011316 3300005331 Bacteria 7625
51 Ga0070670_100021727 3300005331 Bacteria 5519
52 Ga0070670_100076057 3300005331 Bacteria 2885
53 Ga0070670_100140534 3300005331 Bacteria 2088
54 Ga0070670_100173263 3300005331 Bacteria 1872
55 Ga0070670_100747909 3300005331 Bacteria 881
56 Ga0070677_10000095 3300005333 Bacteria 28939
57 Ga0070677_10037735 3300005333 Bacteria 1886
58 Ga0068869_100001204 3300005334 Bacteria 15210
59 Ga0068869_100027192 3300005334 Bacteria 3986
60 Ga0068869_100030426 3300005334 Bacteria 3790
61 Ga0068869_100043617 3300005334 Bacteria 3222
62 Ga0068869_100089257 3300005334 Bacteria 2315
63 Ga0068869_100376774 3300005334 Bacteria 1162
64 Ga0070666_10011522 3300005335 Bacteria 5552
65 Ga0070666_10024213 3300005335 Bacteria 3954
66 Ga0070666_10036945 3300005335 Bacteria 3245
67 Ga0070666_10052705 3300005335 Bacteria 2742
68 Ga0070680_100020621 3300005336 Bacteria 5233
69 Ga0070682_100213874 3300005337 Bacteria 1368
70 Ga0068868_100001432 3300005338 Bacteria 16459
71 Ga0068868_100006091 3300005338 Bacteria 8517
72 Ga0068868_100070790 3300005338 Bacteria 2781
73 Ga0068868_100293111 3300005338 Bacteria 1380
74 Ga0068868_100396756 3300005338 Bacteria 1190
75 Ga0070660_100000707 3300005339 Bacteria 22075
76 Ga0070660_100001378 3300005339 Bacteria 16502
77 Ga0070660_100001678 3300005339 Bacteria 15200
78 Ga0070660_100006342 3300005339 Bacteria 8193
79 Ga0070660_100021590 3300005339 Bacteria 4750
80 Ga0070660_100031855 3300005339 Bacteria 3963
81 Ga0070660_100064001 3300005339 Bacteria 2860
82 Ga0070660_100149511 3300005339 Bacteria 1877
83 Ga0070660_100165526 3300005339 Bacteria 1784
84 Ga0070660_100208754 3300005339 Bacteria 1585
85 Ga0070660_100249188 3300005339 Bacteria 1448
86 Ga0070660_100513327 3300005339 Bacteria 998
87 Ga0070687_100065059 3300005343 Bacteria 1939
88 Ga0070687_100076494 3300005343 Bacteria 1813
89 Ga0070687_100124531 3300005343 Bacteria 1479
90 Ga0070661_100000101 3300005344 Bacteria 70279
91 Ga0070661_100062884 3300005344 Bacteria 2725
92 Ga0070661_100114642 3300005344 Bacteria 2015
93 Ga0070661_100158146 3300005344 Bacteria 1715
94 Ga0070661_100193276 3300005344 Bacteria 1552
95 Ga0070661_100255138 3300005344 Bacteria 1354
96 Ga0070661_100311906 3300005344 Bacteria 1227
97 Ga0070661_100744118 3300005344 Unclassified 801
98 Ga0070692_10002258 3300005345 Bacteria 7394
99 Ga0070692_10027237 3300005345 Bacteria 2831
100 Ga0070692_10030763 3300005345 Bacteria 2686
101 Ga0070692_10051245 3300005345 Bacteria 2146
102 Ga0070692_10088609 3300005345 Bacteria 1679
103 Ga0070668_100031616 3300005347 Bacteria 4027
104 Ga0070668_100103566 3300005347 Bacteria 2258
105 Ga0070668_100161290 3300005347 Bacteria 1819
106 Ga0070668_100171623 3300005347 Bacteria 1766
107 Ga0070668_100231156 3300005347 Bacteria 1529
108 Ga0070668_100297356 3300005347 Bacteria 1353
109 Ga0070668_100600029 3300005347 Bacteria 963
110 Ga0070669_100000194 3300005353 Bacteria 53799
111 Ga0070669_100000586 3300005353 Bacteria 27126
112 Ga0070669_100018539 3300005353 Bacteria 4972
113 Ga0070669_100029256 3300005353 Bacteria 3971
114 Ga0070669_100127263 3300005353 Bacteria 1950
115 Ga0070675_100128886 3300005354 Bacteria 2154
116 Ga0070675_100140553 3300005354 Bacteria 2064
117 Ga0070675_100597215 3300005354 Bacteria 1001
118 Ga0070671_100000357 3300005355 Bacteria 31415
119 Ga0070671_100003627 3300005355 Bacteria 12081
120 Ga0070671_100010793 3300005355 Bacteria 7330
121 Ga0070671_100017343 3300005355 Bacteria 5830
122 Ga0070671_100063120 3300005355 Bacteria 3084
123 Ga0070671_100072230 3300005355 Bacteria 2881
124 Ga0070671_100085184 3300005355 Bacteria 2644
125 Ga0070671_100086364 3300005355 Bacteria 2625
126 Ga0070671_100217453 3300005355 Bacteria 1621
127 Ga0070671_100608654 3300005355 Bacteria 944
128 Ga0070674_100005167 3300005356 Bacteria 7507
129 Ga0070674_100092802 3300005356 Bacteria 2183
130 Ga0070674_100121187 3300005356 Bacteria 1937
131 Ga0070674_100139437 3300005356 Bacteria 1818
132 Ga0070674_100236308 3300005356 Bacteria 1428
133 Ga0070674_100280836 3300005356 Bacteria 1320
134 Ga0070673_100004896 3300005364 Bacteria 8527
135 Ga0070673_100017031 3300005364 Bacteria 5156
136 Ga0070673_100023973 3300005364 Bacteria 4466
137 Ga0070673_100026517 3300005364 Bacteria 4280
138 Ga0070673_100111719 3300005364 Bacteria 2267
139 Ga0070673_100629007 3300005364 Unclassified 981
140 Ga0070659_100000045 3300005366 Bacteria 101520
141 Ga0070659_100004168 3300005366 Bacteria 10307
142 Ga0070659_100005431 3300005366 Bacteria 9152
143 Ga0070659_100029813 3300005366 Bacteria 4218
144 Ga0070659_100050660 3300005366 Bacteria 3264
145 Ga0070659_100052844 3300005366 Bacteria 3196
146 Ga0070659_100102284 3300005366 Bacteria 2306
147 Ga0070659_100109734 3300005366 Bacteria 2227
148 Ga0070659_100216017 3300005366 Bacteria 1581
149 Ga0070659_100228102 3300005366 Bacteria 1539
150 Ga0070659_100382188 3300005366 Bacteria 1186
151 Ga0070659_100451141 3300005366 Bacteria 1091
152 Ga0070659_100565218 3300005366 Bacteria 975
153 Ga0070659_100847373 3300005366 Unclassified 797
154 Ga0070667_100003196 3300005367 Bacteria 14038
155 Ga0070667_100003945 3300005367 Bacteria 12596
156 Ga0070667_100004283 3300005367 Bacteria 12052
157 Ga0070667_100006778 3300005367 Bacteria 9511
158 Ga0070667_100018626 3300005367 Bacteria 5759
159 Ga0070667_100021775 3300005367 Bacteria 5319
160 Ga0070667_100044366 3300005367 Bacteria 3733
161 Ga0070667_100052504 3300005367 Bacteria 3440
162 Ga0070667_100060754 3300005367 Bacteria 3198
163 Ga0070667_100088488 3300005367 Bacteria 2659
164 Ga0070667_100122307 3300005367 Bacteria 2265
165 Ga0070667_100251938 3300005367 Archaea 1579
166 Ga0070667_100453931 3300005367 Unclassified 1171
167 Ga0070667_100791600 3300005367 Bacteria 880
168 Ga0070709_10061609 3300005434 Bacteria 2389
169 Ga0070709_10153277 3300005434 Bacteria 1595
170 Ga0070714_100122385 3300005435 Bacteria 2315
171 Ga0070714_100132511 3300005435 Bacteria 2228
172 Ga0070713_100043907 3300005436 Bacteria 3657
173 Ga0070713_100048427 3300005436 Bacteria 3499
174 Ga0070701_10358789 3300005438 Bacteria 913
175 Ga0070700_100251784 3300005441 Bacteria 1267
176 Ga0070663_100001602 3300005455 Bacteria 12480
177 Ga0070663_100012120 3300005455 Bacteria 5442
178 Ga0070663_100020747 3300005455 Bacteria 4354
179 Ga0070663_100052244 3300005455 Bacteria 2914
180 Ga0070663_100059755 3300005455 Bacteria 2740
181 Ga0070663_100088603 3300005455 Bacteria 2289
182 Ga0070663_100115407 3300005455 Bacteria 2023
183 Ga0070663_100124192 3300005455 Bacteria 1953
184 Ga0070663_100142225 3300005455 Bacteria 1833
185 Ga0070663_100178955 3300005455 Bacteria 1643
186 Ga0070663_100242293 3300005455 Unclassified 1424
187 Ga0070663_100246880 3300005455 Bacteria 1411
188 Ga0070663_100522071 3300005455 Bacteria 989
189 Ga0070678_100001956 3300005456 Bacteria 11120
190 Ga0070678_100041245 3300005456 Bacteria 3271
191 Ga0070678_100083384 3300005456 Bacteria 2430
192 Ga0070678_100182167 3300005456 Bacteria 1720
193 Ga0070662_100000036 3300005457 Bacteria 77190
194 Ga0070662_100001074 3300005457 Bacteria 16646
195 Ga0070662_100003645 3300005457 Bacteria 9614
196 Ga0070662_100005153 3300005457 Bacteria 8335
197 Ga0070662_100005622 3300005457 Bacteria 8016
198 Ga0070662_100009695 3300005457 Bacteria 6301
199 Ga0070662_100012424 3300005457 Bacteria 5648
200 Ga0070662_100085631 3300005457 Bacteria 2355
201 Ga0070662_100090707 3300005457 Bacteria 2294
202 Ga0070662_100279028 3300005457 Bacteria 1352
203 Ga0070681_10079481 3300005458 Bacteria 3236
204 Ga0070681_10181935 3300005458 Bacteria 2023
205 Ga0070681_10311433 3300005458 Bacteria 1484
206 Ga0070681_10548513 3300005458 Bacteria 1070
207 Ga0068867_100001734 3300005459 Bacteria 15196
208 Ga0068867_100006111 3300005459 Bacteria 8523
209 Ga0068867_100014205 3300005459 Bacteria 5640
210 Ga0068867_100023821 3300005459 Bacteria 4385
211 Ga0068867_100087922 3300005459 Bacteria 2354
212 Ga0068867_100230728 3300005459 Bacteria 1496
213 Ga0070685_10058613 3300005466 Bacteria 2245
214 Ga0070679_100069555 3300005530 Bacteria 3511
215 Ga0070679_100117772 3300005530 Bacteria 2641
216 Ga0070679_100277920 3300005530 Bacteria 1627
217 Ga0070679_100481303 3300005530 Bacteria 1185
218 Ga0070679_100500734 3300005530 Bacteria 1159
219 Ga0070679_100593542 3300005530 Bacteria 1051
220 Ga0070684_100044777 3300005535 Bacteria 3829
221 Ga0070684_100507802 3300005535 Unclassified 1117
222 Ga0068853_100000059 3300005539 Bacteria 78301
223 Ga0068853_100002189 3300005539 Bacteria 14573
224 Ga0068853_100014861 3300005539 Bacteria 6392
225 Ga0068853_100034173 3300005539 Bacteria 4315
226 Ga0068853_100077506 3300005539 Bacteria 2903
227 Ga0068853_100143262 3300005539 Bacteria 2146
228 Ga0068853_100244513 3300005539 Bacteria 1645
229 Ga0068853_100250539 3300005539 Bacteria 1625
230 Ga0068853_100570719 3300005539 Bacteria 1073
231 Ga0068853_100882479 3300005539 Bacteria 858
232 Ga0070672_100001067 3300005543 Bacteria 16705
233 Ga0070672_100004161 3300005543 Bacteria 9445
234 Ga0070672_100014258 3300005543 Bacteria 5628
235 Ga0070672_100022654 3300005543 Bacteria 4618
236 Ga0070672_100033110 3300005543 Bacteria 3910
237 Ga0070672_100130101 3300005543 Bacteria 2068
238 Ga0070672_100188320 3300005543 Bacteria 1722
239 Ga0070696_100170459 3300005546 Bacteria 1609
240 Ga0070696_100629415 3300005546 Unclassified 868
241 Ga0070693_100002442 3300005547 Bacteria 8560
242 Ga0070693_100049169 3300005547 Bacteria 2404
243 Ga0070693_100053714 3300005547 Bacteria 2314
244 Ga0070693_100103777 3300005547 Bacteria 1737
245 Ga0070693_100288494 3300005547 Bacteria 1102
246 Ga0070693_100476089 3300005547 Unclassified 881
247 Ga0070665_100014501 3300005548 Bacteria 7905
248 Ga0070665_100034809 3300005548 Bacteria 5066
249 Ga0070665_100092908 3300005548 Bacteria 3022
250 Ga0070665_100117141 3300005548 Bacteria 2666
251 Ga0070665_100130561 3300005548 Bacteria 2514
252 Ga0070665_100574224 3300005548 Bacteria 1140
253 Ga0070665_100626036 3300005548 Bacteria 1089
254 Ga0070665_100634122 3300005548 Bacteria 1082
255 Ga0068855_100000036 3300005563 Bacteria 162849
256 Ga0068855_100002788 3300005563 Bacteria 21511
257 Ga0068855_100003816 3300005563 Bacteria 18418
258 Ga0068855_100011032 3300005563 Bacteria 10904
259 Ga0068855_100031364 3300005563 Bacteria 6346
260 Ga0068855_100070143 3300005563 Bacteria 4078
261 Ga0068855_100333767 3300005563 Bacteria 1673
262 Ga0068855_100578810 3300005563 Bacteria 1213
263 Ga0070664_100000027 3300005564 Bacteria 90881
264 Ga0070664_100006979 3300005564 Bacteria 9108
265 Ga0070664_100015371 3300005564 Bacteria 6259
266 Ga0070664_100017935 3300005564 Bacteria 5812
267 Ga0070664_100032977 3300005564 Bacteria 4333
268 Ga0070664_100069792 3300005564 Bacteria 3007
269 Ga0070664_100082285 3300005564 Bacteria 2776
270 Ga0070664_100087670 3300005564 Bacteria 2691
271 Ga0070664_100249387 3300005564 Bacteria 1595
272 Ga0070664_100282006 3300005564 Bacteria 1498
273 Ga0070664_100411659 3300005564 Unclassified 1237
274 Ga0068857_100000338 3300005577 Bacteria 32330
275 Ga0068857_100015563 3300005577 Bacteria 6644
276 Ga0068857_100029228 3300005577 Bacteria 4864
277 Ga0068857_100044585 3300005577 Bacteria 3934
278 Ga0068857_100115113 3300005577 Bacteria 2419
279 Ga0068857_100142447 3300005577 Bacteria 2167
280 Ga0068857_100153291 3300005577 Bacteria 2089
281 Ga0068857_100200796 3300005577 Bacteria 1817
282 Ga0068857_100417181 3300005577 Bacteria 1251
283 Ga0068854_100001900 3300005578 Bacteria 12728
284 Ga0068854_100007395 3300005578 Bacteria 7016
285 Ga0068854_100010386 3300005578 Bacteria 6036
286 Ga0068854_100015348 3300005578 Bacteria 5071
287 Ga0068854_100054569 3300005578 Bacteria 2875
288 Ga0068854_100419215 3300005578 Bacteria 1112
289 Ga0068856_100000699 3300005614 Bacteria 36354
290 Ga0068856_100010727 3300005614 Bacteria 8902
291 Ga0068856_100107488 3300005614 Bacteria 2785
292 Ga0068856_100122416 3300005614 Unclassified 2603
293 Ga0068856_100168998 3300005614 Bacteria 2198
294 Ga0068856_100177675 3300005614 Bacteria 2141
295 Ga0068852_100000647 3300005616 Bacteria 22808
296 Ga0068852_100001883 3300005616 Bacteria 14288
297 Ga0068852_100009371 3300005616 Bacteria 7271
298 Ga0068852_100030978 3300005616 Bacteria 4408
299 Ga0068852_100092570 3300005616 Bacteria 2708
300 Ga0068852_100102296 3300005616 Bacteria 2588
301 Ga0068852_100108724 3300005616 Bacteria 2517
302 Ga0068852_100109938 3300005616 Bacteria 2504
303 Ga0068852_100135484 3300005616 Bacteria 2273
304 Ga0068852_100137698 3300005616 Bacteria 2255
305 Ga0068852_100163309 3300005616 Bacteria 2081
306 Ga0068852_100164721 3300005616 Bacteria 2073
307 Ga0068852_100541898 3300005616 Bacteria 1163
308 Ga0068852_100571504 3300005616 Bacteria 1132
309 Ga0068859_100000464 3300005617 Bacteria 40106
310 Ga0068859_100000676 3300005617 Bacteria 34199
311 Ga0068859_100002854 3300005617 Bacteria 17530
312 Ga0068859_100006502 3300005617 Bacteria 11862
313 Ga0068859_100021966 3300005617 Bacteria 6399
314 Ga0068859_100038532 3300005617 Bacteria 4795
315 Ga0068859_100099240 3300005617 Bacteria 2967
316 Ga0068859_100105668 3300005617 Bacteria 2875
317 Ga0068859_100145064 3300005617 Bacteria 2448
318 Ga0068859_100297521 3300005617 Bacteria 1707
319 Ga0068859_101040042 3300005617 Unclassified 900
320 Ga0068859_101196941 3300005617 Unclassified 837
321 Ga0068864_100000247 3300005618 Bacteria 48323
322 Ga0068864_100001691 3300005618 Bacteria 18148
323 Ga0068864_100013694 3300005618 Bacteria 6726
324 Ga0068864_100069820 3300005618 Bacteria 3055
325 Ga0068864_100379330 3300005618 Bacteria 1339
326 Ga0068866_10038108 3300005718 Bacteria 2365
327 Ga0068866_10075551 3300005718 Bacteria 1794
328 Ga0068866_10191120 3300005718 Bacteria 1216
329 Ga0068866_10420916 3300005718 Unclassified 866
330 Ga0068861_100000174 3300005719 Bacteria 34073
331 Ga0068861_100045633 3300005719 Bacteria 3301
332 Ga0068861_100093585 3300005719 Bacteria 2376
333 Ga0068861_100146639 3300005719 Bacteria 1932
334 Ga0068861_101055135 3300005719 Bacteria 779
335 Ga0068851_10016921 3300005834 Bacteria 3495
336 Ga0068851_10035164 3300005834 Bacteria 2503
337 Ga0068851_10057767 3300005834 Bacteria 1981
338 Ga0068851_10107312 3300005834 Bacteria 1487
339 Ga0068870_10052764 3300005840 Bacteria 2157
340 Ga0068870_10148625 3300005840 Bacteria 1378
341 Ga0068863_100008572 3300005841 Bacteria 9991
342 Ga0068863_100009619 3300005841 Bacteria 9429
343 Ga0068863_100018768 3300005841 Bacteria 6618
344 Ga0068863_100032857 3300005841 Bacteria 4944
345 Ga0068863_100038901 3300005841 Bacteria 4526
346 Ga0068863_100185377 3300005841 Bacteria 1998
347 Ga0068863_100194306 3300005841 Bacteria 1951
348 Ga0068863_100224623 3300005841 Bacteria 1810
349 Ga0068863_100472417 3300005841 Bacteria 1232
350 Ga0068863_100616648 3300005841 Bacteria 1075
351 Ga0068858_100001175 3300005842 Bacteria 27134
352 Ga0068858_100001436 3300005842 Bacteria 24507
353 Ga0068858_100002849 3300005842 Bacteria 17391
354 Ga0068858_100020686 3300005842 Bacteria 6146
355 Ga0068858_100020943 3300005842 Bacteria 6110
356 Ga0068858_100062472 3300005842 Bacteria 3443
357 Ga0068858_100105083 3300005842 Bacteria 2635
358 Ga0068858_100184461 3300005842 Bacteria 1971
359 Ga0068858_100201025 3300005842 Bacteria 1884
360 Ga0068860_100003357 3300005843 Bacteria 16477
361 Ga0068860_100007229 3300005843 Bacteria 11101
362 Ga0068860_100008755 3300005843 Bacteria 10079
363 Ga0068860_100016409 3300005843 Bacteria 7221
364 Ga0068860_100089325 3300005843 Bacteria 2933
365 Ga0068860_100114012 3300005843 Bacteria 2585
366 Ga0068860_100116750 3300005843 Bacteria 2553
367 Ga0068860_100119685 3300005843 Bacteria 2521
368 Ga0068860_100120832 3300005843 Bacteria 2508
369 Ga0068860_100252527 3300005843 Unclassified 1718
370 Ga0068862_100001250 3300005844 Bacteria 23893
371 Ga0068862_100010033 3300005844 Bacteria 7823
372 Ga0068862_100011431 3300005844 Bacteria 7327
373 Ga0068862_100011808 3300005844 Bacteria 7213
374 Ga0068862_100059052 3300005844 Bacteria 3292
375 Ga0068862_100135387 3300005844 Bacteria 2183
376 Ga0068862_100372124 3300005844 Bacteria 1330
377 Ga0068862_100498063 3300005844 Bacteria 1156
378 Ga0081539_10045417 3300005985 Bacteria 2526
379 Ga0070717_10003812 3300006028 Bacteria 10845
380 Ga0070717_10170285 3300006028 Bacteria 1894
381 Ga0070712_100116958 3300006175 Bacteria 2000
382 Ga0075362_10040443 3300006177 Bacteria 2053
383 Ga0097621_100070742 3300006237 Bacteria 2881
384 Ga0097621_100083859 3300006237 Bacteria 2656
385 Ga0097621_100100013 3300006237 Bacteria 2439
386 Ga0068871_100007119 3300006358 Bacteria 7974
387 Ga0068871_100017620 3300006358 Bacteria 5410
388 Ga0068871_100095707 3300006358 Bacteria 2480
389 Ga0068871_100122214 3300006358 Bacteria 2201
390 Ga0068871_100426595 3300006358 Unclassified 1185
391 Ga0075433_10023458 3300006852 Bacteria 5193
392 Ga0075434_100850865 3300006871 Bacteria 927
393 Ga0068865_100008988 3300006881 Bacteria 6182
394 Ga0068865_100071820 3300006881 Bacteria 2456
395 Ga0068865_100126922 3300006881 Bacteria 1906
396 Ga0097620_100000464 3300006931 Bacteria 40106
397 Ga0097620_100000676 3300006931 Bacteria 34199
398 Ga0097620_100002854 3300006931 Bacteria 17530
399 Ga0097620_100006502 3300006931 Bacteria 11862
400 Ga0097620_100021966 3300006931 Bacteria 6399
401 Ga0097620_100033638 3300006931 Bacteria 5148
402 Ga0097620_100038532 3300006931 Bacteria 4795
403 Ga0097620_100099230 3300006931 Bacteria 2967
404 Ga0097620_100105674 3300006931 Bacteria 2875
405 Ga0097620_100145055 3300006931 Bacteria 2448
406 Ga0097620_100297501 3300006931 Bacteria 1707
407 Ga0097620_101040086 3300006931 Unclassified 900
408 Ga0097620_101196736 3300006931 Unclassified 837
409 Ga0105250_10044635 3300009092 Bacteria 1777
410 Ga0105250_10224127 3300009092 Bacteria 798
411 Ga0105240_10049777 3300009093 Bacteria 5286
412 Ga0105240_10078808 3300009093 Bacteria 4056
413 Ga0105240_10137598 3300009093 Bacteria 2923
414 Ga0111539_10676664 3300009094 Bacteria 1201
415 Ga0105245_10000128 3300009098 Bacteria 72249
416 Ga0105245_10608557 3300009098 Bacteria 1120
417 Ga0105247_10000055 3300009101 Bacteria 134197
418 Ga0105247_10093455 3300009101 Bacteria 1912
419 Ga0105243_10066967 3300009148 Bacteria 2890
420 Ga0105243_10079565 3300009148 Bacteria 2672
421 Ga0105243_10271306 3300009148 Bacteria 1523
422 Ga0105243_10321729 3300009148 Bacteria 1410
423 Ga0105243_10383270 3300009148 Bacteria 1301
424 Ga0105241_10043824 3300009174 Bacteria 3389
425 Ga0105241_10101340 3300009174 Bacteria 2289
426 Ga0105241_10324439 3300009174 Bacteria 1329
427 Ga0105241_10786727 3300009174 Bacteria 875
428 Ga0105242_10026706 3300009176 Bacteria 4578
429 Ga0105242_10561846 3300009176 Bacteria 1096
430 Ga0105248_10000308 3300009177 Bacteria 58132
431 Ga0105248_10000787 3300009177 Bacteria 35583
432 Ga0105248_10001529 3300009177 Bacteria 25755
433 Ga0105248_10001839 3300009177 Bacteria 23502
434 Ga0105248_10009667 3300009177 Bacteria 10623
435 Ga0105248_10031888 3300009177 Bacteria 5888
436 Ga0105248_10034069 3300009177 Bacteria 5692
437 Ga0105248_10052947 3300009177 Bacteria 4554
438 Ga0105248_10129693 3300009177 Bacteria 2844
439 Ga0105248_10425957 3300009177 Bacteria 1494
440 Ga0105248_10538745 3300009177 Bacteria 1317
441 Ga0105248_10569546 3300009177 Bacteria 1278
442 Ga0105237_10139744 3300009545 Bacteria 2416
443 Ga0105238_10012788 3300009551 Bacteria 8470
444 Ga0105238_10043173 3300009551 Bacteria 4563
445 Ga0105238_10047673 3300009551 Bacteria 4319
446 Ga0105238_10055078 3300009551 Bacteria 3993
447 Ga0105238_10080147 3300009551 Bacteria 3254
448 Ga0105238_10087741 3300009551 Bacteria 3098
449 Ga0105238_11017068 3300009551 Unclassified 850
450 Ga0105249_10009746 3300009553 Bacteria 8416
451 Ga0105249_10020722 3300009553 Bacteria 5879
452 Ga0105249_10025831 3300009553 Bacteria 5289
453 Ga0105249_10079425 3300009553 Bacteria 3045
454 Ga0105249_10120229 3300009553 Bacteria 2495
455 Ga0105249_10217999 3300009553 Bacteria 1876
456 Ga0105249_10556965 3300009553 Bacteria 1198
457 Ga0105239_10062778 3300010375 Bacteria 4077
458 Ga0105239_10646034 3300010375 Bacteria 1208
459 Ga0105239_11004794 3300010375 Bacteria 959
460 Ga0105246_10023623 3300011119 Bacteria 3980
461 Ga0105246_10485421 3300011119 Bacteria 1046
462 Ga0157373_10001744 3300013100 Bacteria 16546
463 Ga0157373_10015980 3300013100 Bacteria 5480
464 Ga0157373_10018969 3300013100 Bacteria 5007
465 Ga0157373_10021132 3300013100 Bacteria 4724
466 Ga0157373_10021311 3300013100 Bacteria 4707
467 Ga0157373_10080132 3300013100 Bacteria 2303
468 Ga0157373_10083156 3300013100 Bacteria 2257
469 Ga0157373_10103748 3300013100 Bacteria 2000
470 Ga0157373_10181960 3300013100 Bacteria 1480
471 Ga0157373_10203535 3300013100 Bacteria 1395
472 Ga0157373_10257693 3300013100 Bacteria 1234
473 Ga0157373_10673910 3300013100 Bacteria 756
474 Ga0157371_10000850 3300013102 Bacteria 34892
475 Ga0157371_10002283 3300013102 Bacteria 18475
476 Ga0157371_10004543 3300013102 Bacteria 12085
477 Ga0157371_10009105 3300013102 Bacteria 7845
478 Ga0157371_10037370 3300013102 Bacteria 3475
479 Ga0157371_10050896 3300013102 Bacteria 2944
480 Ga0157371_10100881 3300013102 Bacteria 2048
481 Ga0157371_10144554 3300013102 Bacteria 1694
482 Ga0157371_10422825 3300013102 Bacteria 977
483 Ga0157370_10028289 3300013104 Bacteria 5516
484 Ga0157370_10079692 3300013104 Bacteria 3084
485 Ga0157370_10090878 3300013104 Bacteria 2866
486 Ga0157370_10253095 3300013104 Bacteria 1629
487 Ga0157370_10408614 3300013104 Bacteria 1249
488 Ga0157369_10002894 3300013105 Bacteria 20507
489 Ga0157369_10009511 3300013105 Bacteria 11112
490 Ga0157369_10052357 3300013105 Bacteria 4417
491 Ga0157369_10052864 3300013105 Bacteria 4393
492 Ga0157369_10055618 3300013105 Bacteria 4271
493 Ga0157369_10064033 3300013105 Bacteria 3960
494 Ga0157369_10120570 3300013105 Bacteria 2783
495 Ga0157374_10003921 3300013296 Bacteria 12501
496 Ga0157374_10029635 3300013296 Bacteria 4959
497 Ga0157374_10086562 3300013296 Bacteria 2981
498 Ga0157374_10356950 3300013296 Bacteria 1453
499 Ga0157378_10000396 3300013297 Bacteria 42907
500 Ga0157378_10125238 3300013297 Bacteria 2373
501 Ga0157378_10532718 3300013297 Bacteria 1177
502 Ga0163162_10013878 3300013306 Bacteria 7870
503 Ga0163162_10018653 3300013306 Bacteria 6796
504 Ga0163162_10462220 3300013306 Bacteria 1401
505 Ga0157372_10009481 3300013307 Bacteria 10352
506 Ga0157372_10101395 3300013307 Bacteria 3286
507 Ga0157372_10119986 3300013307 Bacteria 3019
508 Ga0157372_10156390 3300013307 Bacteria 2633
509 Ga0157372_10326296 3300013307 Bacteria 1787
510 Ga0157372_11048991 3300013307 Bacteria 944
511 Ga0157372_11163686 3300013307 Bacteria 892
512 Ga0157375_10007359 3300013308 Bacteria 9639
513 Ga0157375_10108703 3300013308 Bacteria 2868
514 Ga0157375_10186967 3300013308 Bacteria 2225
515 Ga0157375_11269592 3300013308 Bacteria 865
516 Ga0163163_10000139 3300014325 Bacteria 75197
517 Ga0163163_10000187 3300014325 Bacteria 63661
518 Ga0163163_10040890 3300014325 Bacteria 4530
519 Ga0163163_10182752 3300014325 Bacteria 2144
520 Ga0163163_10267522 3300014325 Bacteria 1760
521 Ga0163163_10397400 3300014325 Bacteria 1436
522 Ga0157380_10008229 3300014326 Bacteria 7430
523 Ga0157380_10062506 3300014326 Bacteria 2983
524 Ga0157380_10091989 3300014326 Bacteria 2505
525 Ga0157377_10011952 3300014745 Bacteria 4351
526 Ga0157379_10030794 3300014968 Bacteria 4778
527 Ga0157379_10048511 3300014968 Bacteria 3790
528 Ga0157379_10075203 3300014968 Bacteria 3024
529 Ga0157379_10122647 3300014968 Bacteria 2338
530 Ga0157379_10281246 3300014968 Bacteria 1514
531 Ga0157379_10313593 3300014968 Bacteria 1431
532 Ga0163161_10239404 3300017792 Bacteria 1411
533 Ga0207666_1008321 3300025271 Bacteria 1383
534 Ga0207697_10000461 3300025315 Bacteria 22887
535 Ga0207697_10221490 3300025315 Bacteria 835
536 Ga0207656_10021230 3300025321 Bacteria 2592
537 Ga0207656_10034371 3300025321 Bacteria 2117
538 Ga0207656_10039230 3300025321 Bacteria 2002
539 Ga0207656_10093132 3300025321 Bacteria 1370
540 Ga0207656_10351362 3300025321 Bacteria 736
541 Ga0207682_10001963 3300025893 Bacteria 9333
542 Ga0207642_10013751 3300025899 Bacteria 2963
543 Ga0207642_10021942 3300025899 Bacteria 2523
544 Ga0207642_10061375 3300025899 Bacteria 1748
545 Ga0207710_10000398 3300025900 Bacteria 29022
546 Ga0207688_10000063 3300025901 Bacteria 38711
547 Ga0207688_10022773 3300025901 Bacteria 3430
548 Ga0207688_10145492 3300025901 Bacteria 1397
549 Ga0207680_10000896 3300025903 Bacteria 14078
550 Ga0207680_10001103 3300025903 Bacteria 12733
551 Ga0207680_10149288 3300025903 Bacteria 1557
552 Ga0207647_10000227 3300025904 Bacteria 46631
553 Ga0207647_10004309 3300025904 Bacteria 10552
554 Ga0207647_10009693 3300025904 Bacteria 6834
555 Ga0207647_10015314 3300025904 Bacteria 5261
556 Ga0207647_10016088 3300025904 Bacteria 5109
557 Ga0207647_10026559 3300025904 Bacteria 3786
558 Ga0207647_10028513 3300025904 Bacteria 3624
559 Ga0207647_10034774 3300025904 Bacteria 3215
560 Ga0207647_10036981 3300025904 Bacteria 3099
561 Ga0207647_10243279 3300025904 Bacteria 1033
562 Ga0207645_10016242 3300025907 Bacteria 4930
563 Ga0207645_10034882 3300025907 Bacteria 3231
564 Ga0207645_10051985 3300025907 Bacteria 2618
565 Ga0207645_10304067 3300025907 Bacteria 1062
566 Ga0207645_10472685 3300025907 Unclassified 847
567 Ga0207643_10031639 3300025908 Bacteria 2951
568 Ga0207643_10060979 3300025908 Bacteria 2154
569 Ga0207705_10000912 3300025909 Bacteria 24200
570 Ga0207705_10003269 3300025909 Bacteria 12336
571 Ga0207705_10011932 3300025909 Bacteria 6278
572 Ga0207705_10012840 3300025909 Bacteria 6047
573 Ga0207705_10016493 3300025909 Bacteria 5292
574 Ga0207705_10019346 3300025909 Bacteria 4870
575 Ga0207705_10020659 3300025909 Bacteria 4702
576 Ga0207705_10024261 3300025909 Bacteria 4329
577 Ga0207705_10059604 3300025909 Bacteria 2755
578 Ga0207705_10066043 3300025909 Bacteria 2616
579 Ga0207705_10268916 3300025909 Bacteria 1303
580 Ga0207705_10300388 3300025909 Bacteria 1231
581 Ga0207705_10539331 3300025909 Bacteria 907
582 Ga0207654_10036098 3300025911 Bacteria 2759
583 Ga0207654_10050615 3300025911 Bacteria 2388
584 Ga0207654_10616957 3300025911 Bacteria 775
585 Ga0207707_10003841 3300025912 Bacteria 13310
586 Ga0207707_10235422 3300025912 Bacteria 1593
587 Ga0207707_10412298 3300025912 Unclassified 1159
588 Ga0207695_10022897 3300025913 Bacteria 7076
589 Ga0207693_10059469 3300025915 Bacteria 2993
590 Ga0207693_10211540 3300025915 Bacteria 1524
591 Ga0207660_10007790 3300025917 Bacteria 6933
592 Ga0207660_10007977 3300025917 Bacteria 6844
593 Ga0207660_10112479 3300025917 Bacteria 2051
594 Ga0207662_10097497 3300025918 Bacteria 1817
595 Ga0207662_10103494 3300025918 Bacteria 1767
596 Ga0207657_10000133 3300025919 Bacteria 75282
597 Ga0207657_10002137 3300025919 Bacteria 21415
598 Ga0207657_10002530 3300025919 Bacteria 19780
599 Ga0207657_10003883 3300025919 Bacteria 15855
600 Ga0207657_10004049 3300025919 Bacteria 15569
601 Ga0207657_10004252 3300025919 Bacteria 15168
602 Ga0207657_10004324 3300025919 Bacteria 15053
603 Ga0207657_10021889 3300025919 Bacteria 6004
604 Ga0207657_10027012 3300025919 Bacteria 5262
605 Ga0207657_10032620 3300025919 Bacteria 4703
606 Ga0207657_10038898 3300025919 Bacteria 4230
607 Ga0207657_10084970 3300025919 Bacteria 2652
608 Ga0207657_10174856 3300025919 Bacteria 1738
609 Ga0207657_10221221 3300025919 Bacteria 1517
610 Ga0207657_10287818 3300025919 Bacteria 1303
611 Ga0207657_10420524 3300025919 Bacteria 1050
612 Ga0207657_10421477 3300025919 Bacteria 1049
613 Ga0207649_10000680 3300025920 Bacteria 22565
614 Ga0207649_10001548 3300025920 Bacteria 13488
615 Ga0207649_10008878 3300025920 Bacteria 5489
616 Ga0207649_10040348 3300025920 Bacteria 2836
617 Ga0207649_10051590 3300025920 Bacteria 2548
618 Ga0207649_10104019 3300025920 Bacteria 1885
619 Ga0207649_10134951 3300025920 Bacteria 1681
620 Ga0207649_10375036 3300025920 Bacteria 1059
621 Ga0207649_10506143 3300025920 Bacteria 919
622 Ga0207652_10004117 3300025921 Bacteria 11871
623 Ga0207652_10024944 3300025921 Bacteria 4965
624 Ga0207652_10391741 3300025921 Bacteria 1254
625 Ga0207652_10405789 3300025921 Bacteria 1230
626 Ga0207652_10738166 3300025921 Bacteria 877
627 Ga0207681_10012950 3300025923 Bacteria 5154
628 Ga0207681_10036883 3300025923 Bacteria 3227
629 Ga0207681_10171787 3300025923 Bacteria 1643
630 Ga0207681_10236142 3300025923 Bacteria 1421
631 Ga0207681_10330980 3300025923 Bacteria 1214
632 Ga0207694_10023343 3300025924 Bacteria 4695
633 Ga0207694_10049653 3300025924 Bacteria 3248
634 Ga0207694_10099061 3300025924 Bacteria 2308
635 Ga0207650_10001992 3300025925 Bacteria 14312
636 Ga0207650_10008596 3300025925 Bacteria 6972
637 Ga0207650_10017397 3300025925 Bacteria 5033
638 Ga0207650_10105537 3300025925 Bacteria 2175
639 Ga0207650_10112317 3300025925 Bacteria 2111
640 Ga0207650_10414317 3300025925 Bacteria 1117
641 Ga0207650_10427472 3300025925 Bacteria 1100
642 Ga0207659_10027635 3300025926 Bacteria 3844
643 Ga0207659_10279827 3300025926 Unclassified 1363
644 Ga0207659_10328156 3300025926 Bacteria 1264
645 Ga0207687_10003689 3300025927 Bacteria 10311
646 Ga0207700_10030459 3300025928 Bacteria 3822
647 Ga0207700_10044512 3300025928 Bacteria 3269
648 Ga0207700_10949673 3300025928 Bacteria 770
649 Ga0207644_10003590 3300025931 Bacteria 10047
650 Ga0207644_10004269 3300025931 Bacteria 9273
651 Ga0207644_10011336 3300025931 Bacteria 5897
652 Ga0207644_10013462 3300025931 Bacteria 5454
653 Ga0207644_10023258 3300025931 Bacteria 4242
654 Ga0207644_10039094 3300025931 Bacteria 3347
655 Ga0207644_10041305 3300025931 Bacteria 3262
656 Ga0207644_10124196 3300025931 Bacteria 1968
657 Ga0207644_10402163 3300025931 Bacteria 1119
658 Ga0207644_10458763 3300025931 Bacteria 1047
659 Ga0207690_10000080 3300025932 Bacteria 82082
660 Ga0207690_10006257 3300025932 Bacteria 7048
661 Ga0207690_10007462 3300025932 Bacteria 6489
662 Ga0207690_10007933 3300025932 Bacteria 6303
663 Ga0207690_10032177 3300025932 Bacteria 3363
664 Ga0207690_10060991 3300025932 Bacteria 2562
665 Ga0207690_10147159 3300025932 Bacteria 1742
666 Ga0207690_10174674 3300025932 Bacteria 1612
667 Ga0207690_10252156 3300025932 Bacteria 1364
668 Ga0207690_10471912 3300025932 Unclassified 1011
669 Ga0207690_10728161 3300025932 Unclassified 817
670 Ga0207706_10000159 3300025933 Bacteria 75284
671 Ga0207706_10000648 3300025933 Bacteria 36742
672 Ga0207706_10001809 3300025933 Bacteria 20995
673 Ga0207706_10003286 3300025933 Bacteria 15472
674 Ga0207706_10004902 3300025933 Bacteria 12522
675 Ga0207706_10010695 3300025933 Bacteria 8382
676 Ga0207706_10014378 3300025933 Bacteria 7173
677 Ga0207706_10019749 3300025933 Bacteria 6060
678 Ga0207706_10022333 3300025933 Bacteria 5678
679 Ga0207706_10023147 3300025933 Bacteria 5580
680 Ga0207706_10176351 3300025933 Bacteria 1877
681 Ga0207706_10237305 3300025933 Bacteria 1594
682 Ga0207706_10282701 3300025933 Bacteria 1447
683 Ga0207706_10658674 3300025933 Bacteria 896
684 Ga0207686_10060083 3300025934 Bacteria 2404
685 Ga0207709_10042267 3300025935 Bacteria 2740
686 Ga0207709_10054543 3300025935 Bacteria 2465
687 Ga0207709_10181886 3300025935 Bacteria 1485
688 Ga0207709_10560229 3300025935 Bacteria 900
689 Ga0207670_10021925 3300025936 Bacteria 3948
690 Ga0207670_10338816 3300025936 Bacteria 1188
691 Ga0207669_10028716 3300025937 Bacteria 3064
692 Ga0207669_10030429 3300025937 Bacteria 3000
693 Ga0207669_10102521 3300025937 Bacteria 1896
694 Ga0207669_10109044 3300025937 Bacteria 1850
695 Ga0207691_10000447 3300025940 Bacteria 40805
696 Ga0207691_10002211 3300025940 Bacteria 19028
697 Ga0207691_10009742 3300025940 Bacteria 9221
698 Ga0207691_10057936 3300025940 Bacteria 3525
699 Ga0207691_10096495 3300025940 Bacteria 2643
700 Ga0207691_10096645 3300025940 Bacteria 2641
701 Ga0207691_10214503 3300025940 Bacteria 1671
702 Ga0207711_10000258 3300025941 Bacteria 57473
703 Ga0207711_10001621 3300025941 Bacteria 20768
704 Ga0207711_10040709 3300025941 Bacteria 3954
705 Ga0207711_10049612 3300025941 Bacteria 3593
706 Ga0207711_10130294 3300025941 Bacteria 2254
707 Ga0207711_10365827 3300025941 Bacteria 1337
708 Ga0207689_10001047 3300025942 Bacteria 26563
709 Ga0207689_10013150 3300025942 Bacteria 7062
710 Ga0207689_10246172 3300025942 Bacteria 1478
711 Ga0207689_10268837 3300025942 Bacteria 1411
712 Ga0207661_10013062 3300025944 Bacteria 6060
713 Ga0207661_10071222 3300025944 Bacteria 2840
714 Ga0207661_10434749 3300025944 Bacteria 1193
715 Ga0207679_10001226 3300025945 Bacteria 16305
716 Ga0207679_10001563 3300025945 Bacteria 14327
717 Ga0207679_10010663 3300025945 Bacteria 5925
718 Ga0207679_10013084 3300025945 Bacteria 5432
719 Ga0207679_10106878 3300025945 Bacteria 2200
720 Ga0207679_10125170 3300025945 Bacteria 2053
721 Ga0207679_10136845 3300025945 Bacteria 1973
722 Ga0207679_10172457 3300025945 Bacteria 1782
723 Ga0207679_10366182 3300025945 Bacteria 1260
724 Ga0207667_10000007 3300025949 Bacteria 630590
725 Ga0207667_10005833 3300025949 Bacteria 15008
726 Ga0207667_10007031 3300025949 Bacteria 13597
727 Ga0207667_10012556 3300025949 Bacteria 9746
728 Ga0207667_10018013 3300025949 Bacteria 7931
729 Ga0207667_10032837 3300025949 Bacteria 5587
730 Ga0207667_10058979 3300025949 Bacteria 4023
731 Ga0207667_10064850 3300025949 Bacteria 3811
732 Ga0207667_10238971 3300025949 Bacteria 1859
733 Ga0207667_10514986 3300025949 Bacteria 1212
734 Ga0207667_10690273 3300025949 Unclassified 1024
735 Ga0207651_10000629 3300025960 Bacteria 14894
736 Ga0207651_10013037 3300025960 Bacteria 4736
737 Ga0207651_10025465 3300025960 Bacteria 3677
738 Ga0207651_10030204 3300025960 Bacteria 3446
739 Ga0207651_10074093 3300025960 Bacteria 2423
740 Ga0207712_10021608 3300025961 Bacteria 4226
741 Ga0207712_10082985 3300025961 Bacteria 2338
742 Ga0207712_10142101 3300025961 Bacteria 1843
743 Ga0207668_10001078 3300025972 Bacteria 16262
744 Ga0207668_10024934 3300025972 Bacteria 3865
745 Ga0207668_10184993 3300025972 Bacteria 1646
746 Ga0207668_10278130 3300025972 Bacteria 1371
747 Ga0207640_10005399 3300025981 Bacteria 6968
748 Ga0207640_10021744 3300025981 Bacteria 3828
749 Ga0207640_10031952 3300025981 Bacteria 3260
750 Ga0207640_10081355 3300025981 Bacteria 2214
751 Ga0207640_10113439 3300025981 Bacteria 1926
752 Ga0207640_10196162 3300025981 Bacteria 1526
753 Ga0207640_10204441 3300025981 Bacteria 1499
754 Ga0207640_10223440 3300025981 Bacteria 1443
755 Ga0207658_10001325 3300025986 Bacteria 19392
756 Ga0207658_10003447 3300025986 Bacteria 11189
757 Ga0207658_10005642 3300025986 Bacteria 8564
758 Ga0207658_10019684 3300025986 Bacteria 4668
759 Ga0207658_10032573 3300025986 Bacteria 3710
760 Ga0207658_10036949 3300025986 Bacteria 3504
761 Ga0207658_10044959 3300025986 Bacteria 3217
762 Ga0207658_10090244 3300025986 Bacteria 2374
763 Ga0207658_10125618 3300025986 Bacteria 2052
764 Ga0207658_10254934 3300025986 Bacteria 1492
765 Ga0207658_10265974 3300025986 Bacteria 1463
766 Ga0207658_10308030 3300025986 Bacteria 1367
767 Ga0207677_10016567 3300026023 Bacteria 4370
768 Ga0207677_10054950 3300026023 Bacteria 2720
769 Ga0207677_10083985 3300026023 Bacteria 2294
770 Ga0207677_10287758 3300026023 Bacteria 1352
771 Ga0207703_10003448 3300026035 Bacteria 13245
772 Ga0207703_10003807 3300026035 Bacteria 12533
773 Ga0207703_10004976 3300026035 Bacteria 10784
774 Ga0207703_10007219 3300026035 Bacteria 8837
775 Ga0207703_10010957 3300026035 Bacteria 7066
776 Ga0207703_10012033 3300026035 Bacteria 6738
777 Ga0207703_10038709 3300026035 Bacteria 3808
778 Ga0207703_10046478 3300026035 Bacteria 3496
779 Ga0207639_10001590 3300026041 Bacteria 15258
780 Ga0207639_10008347 3300026041 Bacteria 7099
781 Ga0207639_10053731 3300026041 Bacteria 3075
782 Ga0207639_10059445 3300026041 Bacteria 2944
783 Ga0207639_10060888 3300026041 Bacteria 2913
784 Ga0207639_10204580 3300026041 Bacteria 1695
785 Ga0207639_10249297 3300026041 Bacteria 1548
786 Ga0207639_10396807 3300026041 Bacteria 1242
787 Ga0207639_10469780 3300026041 Bacteria 1145
788 Ga0207678_10002822 3300026067 Bacteria 15762
789 Ga0207678_10003713 3300026067 Bacteria 13727
790 Ga0207678_10006907 3300026067 Bacteria 10070
791 Ga0207678_10008361 3300026067 Bacteria 9126
792 Ga0207678_10016129 3300026067 Bacteria 6560
793 Ga0207678_10018775 3300026067 Bacteria 6074
794 Ga0207678_10018808 3300026067 Bacteria 6068
795 Ga0207678_10020896 3300026067 Bacteria 5738
796 Ga0207678_10042518 3300026067 Bacteria 3935
797 Ga0207678_10072753 3300026067 Bacteria 2946
798 Ga0207678_10116168 3300026067 Bacteria 2283
799 Ga0207678_10165968 3300026067 Bacteria 1885
800 Ga0207678_10625393 3300026067 Bacteria 945
801 Ga0207708_10368731 3300026075 Bacteria 1182
802 Ga0207702_10000246 3300026078 Bacteria 63201
803 Ga0207702_10015039 3300026078 Bacteria 6417
804 Ga0207702_10054472 3300026078 Bacteria 3390
805 Ga0207702_10075460 3300026078 Bacteria 2913
806 Ga0207702_10077157 3300026078 Bacteria 2881
807 Ga0207702_10078359 3300026078 Plasmid 2860
808 Ga0207702_10124149 3300026078 Bacteria 2315
809 Ga0207702_10293748 3300026078 Bacteria 1540
810 Ga0207641_10000621 3300026088 Bacteria 38687
811 Ga0207641_10002559 3300026088 Bacteria 16736
812 Ga0207641_10007838 3300026088 Bacteria 8867
813 Ga0207641_10012445 3300026088 Bacteria 6975
814 Ga0207641_10039969 3300026088 Bacteria 3924
815 Ga0207641_10050897 3300026088 Bacteria 3506
816 Ga0207641_10097521 3300026088 Bacteria 2584
817 Ga0207641_10121646 3300026088 Bacteria 2330
818 Ga0207641_10226094 3300026088 Bacteria 1737
819 Ga0207641_10390123 3300026088 Bacteria 1335
820 Ga0207641_10469539 3300026088 Bacteria 1218
821 Ga0207641_10832189 3300026088 Bacteria 914
822 Ga0207648_10000876 3300026089 Bacteria 33914
823 Ga0207648_10001177 3300026089 Bacteria 29264
824 Ga0207648_10010366 3300026089 Bacteria 8838
825 Ga0207648_10056432 3300026089 Bacteria 3428
826 Ga0207648_10347111 3300026089 Bacteria 1337
827 Ga0207676_10000220 3300026095 Bacteria 49329
828 Ga0207676_10003623 3300026095 Bacteria 10922
829 Ga0207676_10006555 3300026095 Bacteria 8231
830 Ga0207676_10093523 3300026095 Bacteria 2475
831 Ga0207676_10415713 3300026095 Bacteria 1260
832 Ga0207674_10000859 3300026116 Bacteria 39717
833 Ga0207674_10001201 3300026116 Bacteria 33701
834 Ga0207674_10008100 3300026116 Bacteria 12183
835 Ga0207674_10009817 3300026116 Bacteria 10900
836 Ga0207674_10010441 3300026116 Bacteria 10517
837 Ga0207674_10018416 3300026116 Bacteria 7590
838 Ga0207674_10044796 3300026116 Bacteria 4556
839 Ga0207674_10102426 3300026116 Bacteria 2843
840 Ga0207674_10157626 3300026116 Bacteria 2225
841 Ga0207674_10274287 3300026116 Bacteria 1634
842 Ga0207674_10809119 3300026116 Bacteria 904
843 Ga0207675_100000459 3300026118 Bacteria 39628
844 Ga0207675_100058275 3300026118 Bacteria 3604
845 Ga0207675_100171169 3300026118 Bacteria 2076
846 Ga0207675_100211920 3300026118 Bacteria 1864
847 Ga0207675_100294306 3300026118 Bacteria 1580
848 Ga0207675_100803994 3300026118 Unclassified 954
849 Ga0207683_10002206 3300026121 Bacteria 17112
850 Ga0207683_10033588 3300026121 Bacteria 4457
851 Ga0207683_10041230 3300026121 Bacteria 4030
852 Ga0207683_10061059 3300026121 Bacteria 3316
853 Ga0207683_10073117 3300026121 Bacteria 3033
854 Ga0207683_10110020 3300026121 Bacteria 2467
855 Ga0207698_10000759 3300026142 Bacteria 18757
856 Ga0207698_10001817 3300026142 Bacteria 12468
857 Ga0207698_10007246 3300026142 Bacteria 6949
858 Ga0207698_10024898 3300026142 Bacteria 4206
859 Ga0207698_10025969 3300026142 Bacteria 4137
860 Ga0207698_10083853 3300026142 Bacteria 2581
861 Ga0207698_10102932 3300026142 Bacteria 2372
862 Ga0207698_10113805 3300026142 Bacteria 2274
863 Ga0207698_10284834 3300026142 Bacteria 1530
864 Ga0207698_11014198 3300026142 Bacteria 841
865 Ga0268266_10002361 3300028379 Bacteria 20409
866 Ga0268266_10081081 3300028379 Bacteria 2828
867 Ga0268266_10245440 3300028379 Bacteria 1654
868 Ga0268266_10380452 3300028379 Bacteria 1331
869 Ga0268266_10391809 3300028379 Bacteria 1312
870 Ga0268266_10520336 3300028379 Bacteria 1137
871 Ga0268266_10537731 3300028379 Bacteria 1118
872 Ga0268265_10002320 3300028380 Bacteria 14466
873 Ga0268265_10002704 3300028380 Bacteria 13122
874 Ga0268265_10007997 3300028380 Bacteria 7140
875 Ga0268265_10008738 3300028380 Bacteria 6847
876 Ga0268265_10121031 3300028380 Bacteria 2156
877 Ga0268265_10146331 3300028380 Bacteria 1986
878 Ga0268265_10157964 3300028380 Bacteria 1921
879 Ga0268265_10446049 3300028380 Bacteria 1207
880 Ga0268265_10496211 3300028380 Bacteria 1149
881 Ga0268265_10855762 3300028380 Bacteria 890
882 Ga0268265_10941754 3300028380 Bacteria 850
883 Ga0268264_10001852 3300028381 Bacteria 19235
884 Ga0268264_10003780 3300028381 Bacteria 12991
885 Ga0268264_10007833 3300028381 Bacteria 8891
886 Ga0268264_10032074 3300028381 Bacteria 4310
887 Ga0268264_10036795 3300028381 Bacteria 4033
888 Ga0268264_10039723 3300028381 Bacteria 3888
889 Ga0268264_10098861 3300028381 Bacteria 2531
890 Ga0268264_10105546 3300028381 Bacteria 2457
891 Ga0268264_10209216 3300028381 Unclassified 1790
892 Ga0268264_10523466 3300028381 Bacteria 1160
893 Ga0307515_10513784 3300028794 Unclassified 808
894 Ga0316177_1076192 3300030731 Bacteria 1688
895 Ga0307408_100029127 3300031548 Bacteria 3822
896 Ga0307408_100033219 3300031548 Bacteria 3603
897 Ga0307408_100539758 3300031548 Bacteria 1027
898 Ga0307408_100635466 3300031548 Bacteria 952
899 Ga0307405_10008760 3300031731 Bacteria 5147
900 Ga0307405_10016190 3300031731 Bacteria 4059
901 Ga0307405_10179162 3300031731 Bacteria 1520
902 Ga0307413_10012283 3300031824 Bacteria 4256
903 Ga0307413_10054579 3300031824 Bacteria 2425
904 Ga0307413_10055408 3300031824 Bacteria 2412
905 Ga0307413_10067357 3300031824 Bacteria 2238
906 Ga0307410_10114263 3300031852 Bacteria 1958
907 Ga0307410_10187555 3300031852 Bacteria 1570
908 Ga0307410_10448463 3300031852 Bacteria 1052
909 Ga0307406_10008918 3300031901 Bacteria 5607
910 Ga0307406_10033256 3300031901 Bacteria 3155
911 Ga0307406_10050197 3300031901 Bacteria 2643
912 Ga0307406_10166874 3300031901 Bacteria 1589
913 Ga0307406_10561320 3300031901 Bacteria 935
914 Ga0307406_10589015 3300031901 Bacteria 915
915 Ga0307407_10010320 3300031903 Bacteria 4397
916 Ga0307407_10035237 3300031903 Bacteria 2748
917 Ga0307407_10072381 3300031903 Bacteria 2055
918 Ga0307407_10073482 3300031903 Bacteria 2043
919 Ga0307407_10291291 3300031903 Bacteria 1135
920 Ga0307407_10727695 3300031903 Bacteria 749
921 Ga0307412_10176387 3300031911 Bacteria 1603
922 Ga0307412_10446498 3300031911 Bacteria 1064
923 Ga0307409_100010349 3300031995 Bacteria 5793
924 Ga0307409_100014101 3300031995 Bacteria 5181
925 Ga0307409_100077430 3300031995 Bacteria 2671
926 Ga0307409_100147932 3300031995 Bacteria 2034
927 Ga0307409_100228268 3300031995 Bacteria 1685
928 Ga0307409_100291194 3300031995 Bacteria 1514
929 Ga0307409_100513195 3300031995 Bacteria 1169
930 Ga0307416_100021460 3300032002 Bacteria 4637
931 Ga0307416_100764813 3300032002 Bacteria 1059
932 Ga0307416_101020838 3300032002 Bacteria 930
933 Ga0307416_101522727 3300032002 Bacteria 774
934 Ga0307414_10009642 3300032004 Bacteria 5558
935 Ga0307414_10030411 3300032004 Bacteria 3527
936 Ga0307414_10055986 3300032004 Bacteria 2763
937 Ga0307414_10073960 3300032004 Bacteria 2467
938 Ga0307414_10143711 3300032004 Bacteria 1871
939 Ga0307414_10152153 3300032004 Bacteria 1827
940 Ga0307414_10190899 3300032004 Bacteria 1657
941 Ga0307414_10285803 3300032004 Bacteria 1388
942 Ga0307411_10030849 3300032005 Bacteria 3290
943 Ga0307411_10155256 3300032005 Bacteria 1706
944 Ga0307411_10175601 3300032005 Bacteria 1620
945 Ga0307411_10184294 3300032005 Bacteria 1587
946 Ga0307411_10260471 3300032005 Bacteria 1369
947 Ga0307411_10263880 3300032005 Bacteria 1361
948 Ga0307411_10276379 3300032005 Bacteria 1334
949 Ga0307411_10378221 3300032005 Bacteria 1164
950 Ga0307415_100011203 3300032126 Bacteria 5119
951 Ga0307415_100134897 3300032126 Bacteria 1875
952 Ga0307415_100646360 3300032126 Bacteria 947
953 Ga0307415_100733465 3300032126 Unclassified 895
954 Ga0373932_0072863 3300035112 Bacteria 1069
955 Ga0373943_0100735 3300035170 Unclassified 1510
956 Ga0373942_0011502 3300035207 Bacteria 2099
957 Ga0373931_0068977 3300035691 Bacteria 1926
958 Ga0373935_0058992 3300035692 Bacteria 2452
959 Ga0373927_0049184 3300035695 Bacteria 2727
960 Ga0373925_0019664 3300037068 Bacteria 4914
961 Ga0395899_0000244 3300037312 Bacteria 72329
962 Ga0395899_0000795 3300037312 Bacteria 30889
963 Ga0395899_0005996 3300037312 Bacteria 9441
964 Ga0395899_0010088 3300037312 Bacteria 7242
965 Ga0395899_0015242 3300037312 Bacteria 5860
966 Ga0395899_0031251 3300037312 Bacteria 4002
967 Ga0395899_0032112 3300037312 Bacteria 3944
968 Ga0395899_0064874 3300037312 Bacteria 2684
969 Ga0395899_0095627 3300037312 Bacteria 2149
970 Ga0395899_0109634 3300037312 Bacteria 1986
971 Ga0395899_0122289 3300037312 Bacteria 1863
972 Ga0395899_0164360 3300037312 Bacteria 1566
973 Ga0395899_0268041 3300037312 Bacteria 1165
974 Ga0395899_0268178 3300037312 Bacteria 1165
975 Ga0395899_0326573 3300037312 Bacteria 1032
976 Ga0395899_0392086 3300037312 Bacteria 920
977 Ga0395899_0424628 3300037312 Bacteria 875
978 Ga0395899_0453241 3300037312 Unclassified 839
979 Ga0395899_0538872 3300037312 Bacteria 752
980 Ga0395899_0548212 3300037312 Bacteria 743
981 Ga0395900_0001277 3300037418 Bacteria 30753
982 Ga0395900_0004242 3300037418 Bacteria 15213
983 Ga0395900_0009530 3300037418 Bacteria 9956
984 Ga0395900_0010411 3300037418 Bacteria 9510
985 Ga0395900_0011561 3300037418 Bacteria 9033
986 Ga0395900_0013700 3300037418 Bacteria 8278
987 Ga0395900_0015280 3300037418 Bacteria 7828
988 Ga0395900_0024204 3300037418 Bacteria 6217
989 Ga0395900_0030421 3300037418 Bacteria 5545
990 Ga0395900_0037001 3300037418 Bacteria 5031
991 Ga0395900_0056366 3300037418 Bacteria 4045
992 Ga0395900_0056710 3300037418 Bacteria 4032
993 Ga0395900_0063753 3300037418 Bacteria 3788
994 Ga0395900_0067684 3300037418 Bacteria 3669
995 Ga0395900_0080725 3300037418 Bacteria 3342
996 Ga0395900_0093648 3300037418 Bacteria 3086
997 Ga0395900_0126255 3300037418 Bacteria 2624
998 Ga0395900_0154897 3300037418 Unclassified 2340
999 Ga0395900_0167869 3300037418 Bacteria 2235
1000 Ga0395900_0170559 3300037418 Bacteria 2216
1001 Ga0395900_0185334 3300037418 Bacteria 2113
1002 Ga0395900_0192160 3300037418 Bacteria 2070
1003 Ga0395900_0262896 3300037418 Bacteria 1722
1004 Ga0395900_0274796 3300037418 Unclassified 1678
1005 Ga0395900_0287704 3300037418 Bacteria 1633
1006 Ga0395900_0342714 3300037418 Bacteria 1469
1007 Ga0395900_0370464 3300037418 Bacteria 1402
1008 Ga0395900_0591251 3300037418 Bacteria 1051
1009 Ga0395900_0621537 3300037418 Bacteria 1019
1010 Ga0395898_0007414 3300037466 Bacteria 11646
1011 Ga0395898_0008628 3300037466 Bacteria 10755
1012 Ga0395898_0012270 3300037466 Bacteria 8861
1013 Ga0395898_0047882 3300037466 Bacteria 4193
1014 Ga0395898_0064763 3300037466 Bacteria 3544
1015 Ga0395898_0068409 3300037466 Bacteria 3436
1016 Ga0395898_0094451 3300037466 Bacteria 2874
1017 Ga0395898_0097124 3300037466 Bacteria 2830
1018 Ga0395898_0112020 3300037466 Bacteria 2615
1019 Ga0395898_0135657 3300037466 Bacteria 2356
1020 Ga0395898_0162219 3300037466 Bacteria 2138
1021 Ga0395898_0217380 3300037466 Bacteria 1823
1022 Ga0395898_0220985 3300037466 Bacteria 1807
1023 Ga0395898_0475805 3300037466 Bacteria 1188
1024 Ga0395905_0000187 3300037471 Bacteria 98895
1025 Ga0395905_0000215 3300037471 Bacteria 89274
1026 Ga0395905_0001453 3300037471 Bacteria 28424
1027 Ga0395905_0005494 3300037471 Bacteria 12929
1028 Ga0395905_0006652 3300037471 Bacteria 11591
1029 Ga0395905_0006924 3300037471 Bacteria 11333
1030 Ga0395905_0015044 3300037471 Bacteria 7371
1031 Ga0395905_0015414 3300037471 Bacteria 7265
1032 Ga0395905_0017626 3300037471 Bacteria 6778
1033 Ga0395905_0034610 3300037471 Bacteria 4744
1034 Ga0395905_0052594 3300037471 Bacteria 3812
1035 Ga0395905_0058839 3300037471 Bacteria 3593
1036 Ga0395905_0060318 3300037471 Bacteria 3547
1037 Ga0395905_0084961 3300037471 Bacteria 2966
1038 Ga0395905_0087545 3300037471 Bacteria 2920
1039 Ga0395905_0090194 3300037471 Bacteria 2873
1040 Ga0395905_0106283 3300037471 Bacteria 2636
1041 Ga0395905_0108263 3300037471 Bacteria 2609
1042 Ga0395905_0110738 3300037471 Bacteria 2578
1043 Ga0395905_0120964 3300037471 Bacteria 2461
1044 Ga0395905_0122208 3300037471 Bacteria 2448
1045 Ga0395905_0129926 3300037471 Bacteria 2369
1046 Ga0395905_0157619 3300037471 Unclassified 2134
1047 Ga0395905_0165079 3300037471 Bacteria 2081
1048 Ga0395905_0184763 3300037471 Bacteria 1957
1049 Ga0395905_0225240 3300037471 Bacteria 1754
1050 Ga0395905_0303723 3300037471 Bacteria 1484
1051 Ga0395905_0317405 3300037471 Unclassified 1447
1052 Ga0395905_0340762 3300037471 Bacteria 1390
1053 Ga0395905_0347146 3300037471 Bacteria 1376
1054 Ga0395905_0599897 3300037471 Bacteria 1003
1055 Ga0395905_0654459 3300037471 Bacteria 953
1056 Ga0395905_0671727 3300037471 Bacteria 938
1057 Ga0395905_0671733 3300037471 Bacteria 938
1058 Ga0395901_0000206 3300038443 Bacteria 73997
1059 Ga0395901_0000876 3300038443 Bacteria 33203
1060 Ga0395901_0003575 3300038443 Bacteria 15679
1061 Ga0395901_0003851 3300038443 Bacteria 15105
1062 Ga0395901_0010662 3300038443 Bacteria 9315
1063 Ga0395901_0045368 3300038443 Bacteria 4561
1064 Ga0395901_0046767 3300038443 Bacteria 4495
1065 Ga0395901_0046768 3300038443 Bacteria 4495
1066 Ga0395901_0053503 3300038443 Bacteria 4194
1067 Ga0395901_0069737 3300038443 Bacteria 3661
1068 Ga0395901_0085375 3300038443 Bacteria 3300
1069 Ga0395901_0086568 3300038443 Bacteria 3276
1070 Ga0395901_0105230 3300038443 Bacteria 2961
1071 Ga0395901_0106461 3300038443 Bacteria 2943
1072 Ga0395901_0113070 3300038443 Bacteria 2851
1073 Ga0395901_0148718 3300038443 Bacteria 2461
1074 Ga0395901_0191937 3300038443 Bacteria 2142
1075 Ga0395901_0285742 3300038443 Bacteria 1713
1076 Ga0395901_0324547 3300038443 Bacteria 1592
1077 Ga0395901_0330008 3300038443 Bacteria 1577
1078 Ga0395901_0407939 3300038443 Bacteria 1395
1079 Ga0395901_0415494 3300038443 Bacteria 1380
1080 Ga0395901_0605667 3300038443 Unclassified 1104
1081 Ga0395901_0700984 3300038443 Unclassified 1010
1082 Ga0395901_0703094 3300038443 Unclassified 1008
1083 Ga0395901_0778506 3300038443 Bacteria 947
1084 Ga0395901_0937238 3300038443 Unclassified 845
1085 Ga0436365_0119604 3300039437 Bacteria 861
1086 Ga0439448_0011180 3300042005 Bacteria 2672
1087 Ga0439455_0012112 3300042012 Unclassified 1931
1088 Ga0439455_0056582 3300042012 Bacteria 1033
1089 Ga0439458_0000009 3300042157 Bacteria 29761
1090 Ga0439458_0000057 3300042157 Bacteria 19314
1091 Ga0439458_0001032 3300042157 Bacteria 7119
1092 Ga0439458_0002027 3300042157 Bacteria 5030
1093 Ga0439458_0068607 3300042157 Bacteria 893
1094 Ga0450893_0067784 3300042532 Unclassified 690
1095 Ga0466969_0016805 3300044656 Bacteria 3826
1096 Ga0466969_0045410 3300044656 Bacteria 2181
1097 Ga0466972_0131196 3300044658 Bacteria 1180
1098 Ga0466965_0206547 3300044683 Bacteria 1043
1099 Ga0466966_0000041 3300044684 Bacteria 97092
1100 Ga0466966_0020392 3300044684 Bacteria 4359
1101 Ga0466966_0027442 3300044684 Bacteria 3713
1102 Ga0466966_0051888 3300044684 Bacteria 2606
1103 Ga0466966_0090017 3300044684 Bacteria 1906
1104 Ga0466966_0159665 3300044684 Bacteria 1373
1105 Ga0466961_0013089 3300044693 Bacteria 5308
1106 Ga0466961_0037729 3300044693 Bacteria 3100
1107 Ga0466961_0073863 3300044693 Bacteria 2162
1108 Ga0466961_0131038 3300044693 Bacteria 1571
1109 Ga0466961_0179657 3300044693 Bacteria 1314
1110 Ga0466961_0389707 3300044693 Bacteria 846
1111 Ga0466963_0017531 3300044694 Bacteria 4465
1112 Ga0466963_0024695 3300044694 Bacteria 3826
1113 Ga0466963_0035239 3300044694 Bacteria 3259
1114 Ga0466963_0039293 3300044694 Bacteria 3098
1115 Ga0466963_0055246 3300044694 Bacteria 2640
1116 Ga0466963_0057356 3300044694 Bacteria 2594
1117 Ga0466963_0422897 3300044694 Bacteria 940
1118 Ga0466963_0665148 3300044694 Bacteria 735
1119 Ga0466964_0002211 3300044706 Bacteria 6881
1120 Ga0466971_0003394 3300044719 Bacteria 6804
1121 Ga0466971_0015256 3300044719 Bacteria 3381
1122 Ga0466970_0009032 3300044765 Bacteria 5028
1123 Ga0466970_0013517 3300044765 Bacteria 4186
1124 Ga0466970_0152024 3300044765 Bacteria 1278
1125 Ga0466957_0000822 3300044842 Bacteria 15824
1126 Ga0466957_0002661 3300044842 Bacteria 9646
1127 Ga0466957_0110469 3300044842 Bacteria 1743
1128 Ga0466957_0126507 3300044842 Bacteria 1633
1129 Ga0466957_0140792 3300044842 Bacteria 1554
1130 Ga0466957_0164764 3300044842 Bacteria 1441
1131 Ga0466957_0297838 3300044842 Bacteria 1083
1132 Ga0466957_0390114 3300044842 Bacteria 951
1133 Ga0466960_0009083 3300044901 Bacteria 4088
1134 Ga0466959_0004349 3300045049 Bacteria 9474
1135 Ga0466959_0152957 3300045049 Bacteria 1625
1136 Ga0466959_0164308 3300045049 Bacteria 1559
1137 Ga0466959_0232815 3300045049 Bacteria 1274
1138 Ga0466958_0000529 3300045836 Bacteria 16171
1139 Ga0466958_0005915 3300045836 Bacteria 6612
1140 Ga0466958_0017913 3300045836 Bacteria 4103
1141 Ga0466958_0101839 3300045836 Bacteria 1786
1142 Ga0466967_0001609 3300045976 Bacteria 13321
1143 Ga0466967_0019982 3300045976 Bacteria 5400
1144 Ga0466967_0025868 3300045976 Bacteria 4847
1145 Ga0466967_0070496 3300045976 Bacteria 3127
1146 Ga0466967_0116317 3300045976 Bacteria 2463
1147 Ga0466967_0126356 3300045976 Bacteria 2369
1148 Ga0466967_0149694 3300045976 Bacteria 2180
1149 Ga0466967_0211086 3300045976 Bacteria 1841
1150 Ga0466967_0216204 3300045976 Bacteria 1819
1151 Ga0466967_0546085 3300045976 Bacteria 1140
1152 Ga0466967_0640860 3300045976 Bacteria 1050
1153 Ga0466967_0668998 3300045976 Unclassified 1027
1154 Ga0495610_0092347 3300046512 Bacteria 1370
1155 Ga0495663_0010542 3300046525 Bacteria 2572
1156 Ga0495663_0011327 3300046525 Bacteria 2483
1157 Ga0495663_0020096 3300046525 Bacteria 1915
1158 Ga0495663_0037512 3300046525 Bacteria 1462
1159 Ga0495642_0057828 3300046528 Bacteria 1604
1160 Ga0495598_0002192 3300046537 Bacteria 4006
1161 Ga0495621_0028955 3300046539 Bacteria 1885
1162 Ga0495621_0057592 3300046539 Bacteria 1404
1163 Ga0495633_0013628 3300046558 Bacteria 4277
1164 Ga0495633_0015973 3300046558 Bacteria 3884
1165 Ga0495668_0010619 3300046616 Bacteria 5565
1166 Ga0495659_0002607 3300046664 Bacteria 5814
1167 Ga0495659_0018146 3300046664 Bacteria 2341
1168 Ga0495659_0096821 3300046664 Bacteria 1139
1169 Ga0495659_0108571 3300046664 Bacteria 1081
1170 Ga0495669_0000691 3300046684 Bacteria 14739
1171 Ga0495669_0002084 3300046684 Bacteria 8190
1172 Ga0495669_0022138 3300046684 Bacteria 2761
1173 Ga0495669_0034689 3300046684 Bacteria 2224
1174 Ga0495669_0040989 3300046684 Bacteria 2055
1175 Ga0495669_0062769 3300046684 Bacteria 1684
1176 Ga0495669_0092939 3300046684 Bacteria 1395
1177 Ga0495669_0116414 3300046684 Bacteria 1251
1178 Ga0495670_0036168 3300046691 Bacteria 2460
1179 Ga0495670_0057745 3300046691 Bacteria 1948
1180 Ga0495670_0180183 3300046691 Bacteria 1115
1181 Ga0495677_0043457 3300047445 Bacteria 1647
1182 Ga0495677_0175218 3300047445 Unclassified 830
1183 Ga0495685_039743 3300047447 Bacteria 1610
1184 Ga0496100_0203122 3300048903 Bacteria 1445
1185 Ga0496100_0272368 3300048903 Bacteria 1259
1186 Ga0496101_0078250 3300048904 Bacteria 2438
1187 Ga0496102_0180683 3300048905 Bacteria 1988
1188 Ga0496106_0617667 3300048909 Bacteria 868
1189 Ga0496107_0028874 3300048910 Bacteria 3944
1190 Ga0496107_0041173 3300048910 Bacteria 3317
1191 Ga0496107_0058900 3300048910 Bacteria 2778
1192 Ga0496107_0078224 3300048910 Bacteria 2410
1193 Ga0496107_0174707 3300048910 Bacteria 1595
1194 Ga0496107_0310313 3300048910 Bacteria 1174
1195 Ga0496108_0054953 3300048911 Bacteria 3342
1196 Ga0496108_0189288 3300048911 Bacteria 1783
1197 Ga0496108_0332163 3300048911 Bacteria 1326
1198 Ga0496109_0186942 3300048912 Bacteria 1946
1199 Ga0496109_0248344 3300048912 Bacteria 1675
1200 Ga0496109_0324959 3300048912 Bacteria 1452
1201 Ga0496111_0030922 3300048914 Bacteria 3810
1202 Ga0496111_0467169 3300048914 Bacteria 930
1203 Ga0496111_0498197 3300048914 Bacteria 897
1204 Ga0496112_0052965 3300048915 Bacteria 3984
1205 Ga0496112_0118784 3300048915 Bacteria 2614
1206 Ga0496112_0704937 3300048915 Bacteria 937
1207 Ga0496113_0022406 3300048916 Bacteria 4467
1208 Ga0496113_0201441 3300048916 Bacteria 1582
1209 Ga0496114_0000029 3300048917 Bacteria 175132
1210 Ga0496114_0018596 3300048917 Bacteria 5622
1211 Ga0496115_0125702 3300048918 Bacteria 2112
1212 Ga0496118_0161942 3300048921 Bacteria 1382
1213 Ga0496121_0002260 3300048924 Bacteria 30007
1214 Ga0496125_0026168 3300048928 Bacteria 5326
1215 Ga0501067_0042744 3300049583 Bacteria 2516
1216 Ga0501067_0338909 3300049583 Bacteria 838
1217 Ga0501068_0157889 3300049584 Bacteria 1429
1218 Ga0501069_0043094 3300049585 Bacteria 2497
1219 Ga0501074_0033402 3300049590 Bacteria 3728
1220 Ga0501080_0038193 3300049742 Bacteria 4484
1221 nmdc:mga00v17_472218_c1 3300050491 Bacteria 814
1222 nmdc:mga0k408_208652_c1 3300050493 Unclassified 1166
1223 nmdc:mga0k408_254100_c1 3300050493 Bacteria 1049
1224 nmdc:mga06r32_503864_c1 3300050510 Bacteria 1187
1225 nmdc:mga08y16_500365_c1 3300050511 Bacteria 1235
1226 nmdc:mga0n895_772535_c1 3300050512 Bacteria 953
1227 nmdc:mga0a205_23681_c1 3300050515 Bacteria 5824
1228 Ga0500658_0000164 3300053134 Bacteria 31944
1229 Ga0587070_006619 3300059491 Bacteria 1573
1230 Ga0587073_0029067 3300059492 Bacteria 1127
1231 Ga0587073_0062251 3300059492 Bacteria 879
1232 Ga0587077_035007 3300059493 Bacteria 979
1233 Ga0587083_0061867 3300059505 Bacteria 846
1234 Ga0587088_012621 3300059508 Bacteria 1281
1235 Ga0587128_005061 3300059630 Bacteria 1559
1236 Ga0587128_017355 3300059630 Bacteria 1065
1237 Ga0587069_027983 3300059642 Bacteria 893
1238 Ga0587075_000690 3300059644 Bacteria 2883
1239 Ga0587075_010514 3300059644 Bacteria 1226
1240 Ga0587079_016526 3300059647 Bacteria 1268
1241 Ga0587107_023864 3300059652 Bacteria 877
1242 Ga0587114_025003 3300059655 Bacteria 873
1243 Ga0587114_030157 3300059655 Bacteria 824
1244 Ga0587071_034007 3300060344 Unclassified 995
1245 Ga0466962_0012721 3300061719 Bacteria 4048
1246 Ga0466962_0016329 3300061719 Bacteria 3579
1247 Ga0466962_0155991 3300061719 Bacteria 1108

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0591251 Ga0395900_0591251_34_624 193
2 3300059508 Ga0587088_012621 Ga0587088_012621_77_763 195
3 3300059642 Ga0587069_027983 Ga0587069_027983_124_810 195
4 3300028379 Ga0268266_10002361 Ga0268266_1000236117 196
5 3300044658 Ga0466972_0131196 Ga0466972_0131196_387_1070 199
6 3300044683 Ga0466965_0206547 Ga0466965_0206547_264_947 199
7 3300044901 Ga0466960_0009083 Ga0466960_0009083_198_881 199
8 3300046684 Ga0495669_0092939 Ga0495669_0092939_39_644 200
9 3300037466 Ga0395898_0220985 Ga0395898_0220985_1182_1796 201
10 3300013100 Ga0157373_10181960 Ga0157373_101819602 202
11 3300037312 Ga0395899_0424628 Ga0395899_0424628_33_719 205
12 3300037471 Ga0395905_0000215 Ga0395905_0000215_45788_46474 205
13 3300038443 Ga0395901_0324547 Ga0395901_0324547_352_1038 205
14 3300005843 Ga0068860_100114012 Ga0068860_1001140123 206
15 3300037312 Ga0395899_0268178 Ga0395899_0268178_231_917 206
16 3300037471 Ga0395905_0340762 Ga0395905_0340762_358_1044 206
17 3300047445 Ga0495677_0175218 Ga0495677_0175218_18_647 207
18 3300005293 Ga0065715_10037615 Ga0065715_100376152 208
19 3300005345 Ga0070692_10002258 Ga0070692_100022586 208
20 3300005366 Ga0070659_100005431 Ga0070659_1000054311 208
21 3300005539 Ga0068853_100244513 Ga0068853_1002445132 208
22 3300005543 Ga0070672_100004161 Ga0070672_10000416112 208
23 3300005563 Ga0068855_100333767 Ga0068855_1003337672 208
24 3300005616 Ga0068852_100541898 Ga0068852_1005418982 208
25 3300005617 Ga0068859_100099240 Ga0068859_1000992403 208
26 3300005842 Ga0068858_100201025 Ga0068858_1002010253 208
27 3300005843 Ga0068860_100120832 Ga0068860_1001208324 208
28 3300005844 Ga0068862_100372124 Ga0068862_1003721242 208
29 3300006931 Ga0097620_100099230 Ga0097620_1000992303 208
30 3300009093 Ga0105240_10078808 Ga0105240_100788083 208
31 3300009148 Ga0105243_10321729 Ga0105243_103217292 208
32 3300009553 Ga0105249_10020722 Ga0105249_100207221 208
33 3300010375 Ga0105239_10062778 Ga0105239_100627783 208
34 3300013308 Ga0157375_11269592 Ga0157375_112695921 208
35 3300025904 Ga0207647_10004309 Ga0207647_100043096 208
36 3300025919 Ga0207657_10004252 Ga0207657_1000425213 208
37 3300025933 Ga0207706_10010695 Ga0207706_100106951 208
38 3300025936 Ga0207670_10338816 Ga0207670_103388162 208
39 3300025949 Ga0207667_10514986 Ga0207667_105149862 208
40 3300026035 Ga0207703_10007219 Ga0207703_100072196 208
41 3300026041 Ga0207639_10204580 Ga0207639_102045802 208
42 3300026116 Ga0207674_10102426 Ga0207674_101024262 208
43 3300026142 Ga0207698_10284834 Ga0207698_102848342 208
44 3300028381 Ga0268264_10001852 Ga0268264_1000185210 208
45 3300035112 Ga0373932_0072863 Ga0373932_0072863_425_1054 208
46 3300050510 nmdc:mga06r32_503864_c1 nmdc:mga06r32_503864_c1_460_1149 208
47 3300005334 Ga0068869_100027192 Ga0068869_1000271923 209
48 3300005547 Ga0070693_100288494 Ga0070693_1002884941 209
49 3300005718 Ga0068866_10191120 Ga0068866_101911202 209
50 3300009098 Ga0105245_10608557 Ga0105245_106085572 209
51 3300009176 Ga0105242_10026706 Ga0105242_100267064 209
52 3300025899 Ga0207642_10061375 Ga0207642_100613753 209
53 3300025934 Ga0207686_10060083 Ga0207686_100600832 209
54 3300025942 Ga0207689_10013150 Ga0207689_100131509 209
55 3300005841 Ga0068863_100185377 Ga0068863_1001853773 210
56 3300026088 Ga0207641_10832189 Ga0207641_108321892 210
57 3300026121 Ga0207683_10033588 Ga0207683_100335884 210
58 3300037471 Ga0395905_0671727 Ga0395905_0671727_236_925 210
59 3300050512 nmdc:mga0n895_772535_c1 nmdc:mga0n895_772535_c1_11_661 210
60 3300044694 Ga0466963_0665148 Ga0466963_0665148_48_722 211
61 3300044842 Ga0466957_0126507 Ga0466957_0126507_246_920 211
62 3300045976 Ga0466967_0149694 Ga0466967_0149694_732_1406 211
63 3300032004 Ga0307414_10152153 Ga0307414_101521532 212
64 3300005339 Ga0070660_100249188 Ga0070660_1002491882 214
65 3300005547 Ga0070693_100103777 Ga0070693_1001037772 214
66 3300005564 Ga0070664_100249387 Ga0070664_1002493872 214
67 3300005834 Ga0068851_10057767 Ga0068851_100577672 214
68 3300005842 Ga0068858_100184461 Ga0068858_1001844613 214
69 3300005843 Ga0068860_100119685 Ga0068860_1001196853 214
70 3300006358 Ga0068871_100017620 Ga0068871_1000176202 214
71 3300009545 Ga0105237_10139744 Ga0105237_101397444 214
72 3300010375 Ga0105239_11004794 Ga0105239_110047942 214
73 3300011119 Ga0105246_10485421 Ga0105246_104854212 214
74 3300013100 Ga0157373_10673910 Ga0157373_106739101 214
75 3300014325 Ga0163163_10267522 Ga0163163_102675221 214
76 3300014968 Ga0157379_10281246 Ga0157379_102812462 214
77 3300025321 Ga0207656_10039230 Ga0207656_100392302 214
78 3300025919 Ga0207657_10420524 Ga0207657_104205242 214
79 3300025931 Ga0207644_10402163 Ga0207644_104021632 214
80 3300025945 Ga0207679_10136845 Ga0207679_101368452 214
81 3300025986 Ga0207658_10265974 Ga0207658_102659742 214
82 3300026078 Ga0207702_10293748 Ga0207702_102937482 214
83 3300026116 Ga0207674_10000859 Ga0207674_1000085917 214
84 3300028381 Ga0268264_10098861 Ga0268264_100988613 214
85 3300037471 Ga0395905_0129926 Ga0395905_0129926_1590_2279 214
86 3300048910 Ga0496107_0058900 Ga0496107_0058900_351_1046 214
87 3300048912 Ga0496109_0248344 Ga0496109_0248344_822_1517 214
88 3300048915 Ga0496112_0052965 Ga0496112_0052965_902_1597 214
89 3300059505 Ga0587083_0061867 Ga0587083_0061867_21_716 214
90 3300001990 JGI24737J22298_10113929 JGI24737J22298_101139291 215
91 3300005327 Ga0070658_10139029 Ga0070658_101390291 215
92 3300005343 Ga0070687_100124531 Ga0070687_1001245311 215
93 3300046684 Ga0495669_0116414 Ga0495669_0116414_127_807 215
94 3300059630 Ga0587128_017355 Ga0587128_017355_316_1005 215
95 3300042532 Ga0450893_0067784 Ga0450893_0067784_16_669 216
96 iso_pu_bacteria 8045864390 8045868831 219
97 3300001989 JGI24739J22299_10022013 JGI24739J22299_100220131 220
98 3300026121 Ga0207683_10041230 Ga0207683_100412302 220
99 3300042157 Ga0439458_0001032 Ga0439458_0001032_2220_2909 220
100 3300042157 Ga0439458_0002027 Ga0439458_0002027_2616_3305 220
101 3300005327 Ga0070658_10157244 Ga0070658_101572443 221
102 3300005546 Ga0070696_100629415 Ga0070696_1006294152 221
103 3300005844 Ga0068862_100498063 Ga0068862_1004980632 221
104 3300028380 Ga0268265_10941754 Ga0268265_109417541 221
105 3300038443 Ga0395901_0191937 Ga0395901_0191937_62_748 221
106 3300005355 Ga0070671_100063120 Ga0070671_1000631205 222
107 3300009177 Ga0105248_10052947 Ga0105248_100529472 222
108 3300014326 Ga0157380_10062506 Ga0157380_100625064 222
109 3300026095 Ga0207676_10415713 Ga0207676_104157131 222
110 3300028380 Ga0268265_10855762 Ga0268265_108557622 222
111 3300031911 Ga0307412_10176387 Ga0307412_101763872 222
112 3300005327 Ga0070658_10146442 Ga0070658_101464422 223
113 3300005331 Ga0070670_100747909 Ga0070670_1007479091 223
114 3300005338 Ga0068868_100293111 Ga0068868_1002931111 223
115 3300005339 Ga0070660_100513327 Ga0070660_1005133272 223
116 3300005345 Ga0070692_10051245 Ga0070692_100512452 223
117 3300005366 Ga0070659_100050660 Ga0070659_1000506604 223
118 3300005367 Ga0070667_100122307 Ga0070667_1001223072 223
119 3300005455 Ga0070663_100059755 Ga0070663_1000597552 223
120 3300005457 Ga0070662_100012424 Ga0070662_1000124243 223
121 3300005530 Ga0070679_100593542 Ga0070679_1005935422 223
122 3300005539 Ga0068853_100014861 Ga0068853_1000148617 223
123 3300005547 Ga0070693_100053714 Ga0070693_1000537144 223
124 3300005548 Ga0070665_100130561 Ga0070665_1001305613 223
125 3300005564 Ga0070664_100032977 Ga0070664_1000329773 223
126 3300005577 Ga0068857_100417181 Ga0068857_1004171812 223
127 3300005578 Ga0068854_100007395 Ga0068854_1000073952 223
128 3300005616 Ga0068852_100135484 Ga0068852_1001354842 223
129 3300005617 Ga0068859_101196941 Ga0068859_1011969411 223
130 3300005834 Ga0068851_10016921 Ga0068851_100169212 223
131 3300006177 Ga0075362_10040443 Ga0075362_100404432 223
132 3300006931 Ga0097620_101196736 Ga0097620_1011967361 223
133 3300013100 Ga0157373_10015980 Ga0157373_100159803 223
134 3300025907 Ga0207645_10472685 Ga0207645_104726851 223
135 3300025909 Ga0207705_10020659 Ga0207705_100206595 223
136 3300025919 Ga0207657_10027012 Ga0207657_100270122 223
137 3300025920 Ga0207649_10008878 Ga0207649_100088785 223
138 3300025921 Ga0207652_10391741 Ga0207652_103917412 223
139 3300025925 Ga0207650_10427472 Ga0207650_104274722 223
140 3300025932 Ga0207690_10060991 Ga0207690_100609913 223
141 3300025932 Ga0207690_10471912 Ga0207690_104719122 223
142 3300025933 Ga0207706_10014378 Ga0207706_100143782 223
143 3300025933 Ga0207706_10176351 Ga0207706_101763511 223
144 3300025945 Ga0207679_10010663 Ga0207679_100106636 223
145 3300025945 Ga0207679_10125170 Ga0207679_101251703 223
146 3300025981 Ga0207640_10005399 Ga0207640_1000539911 223
147 3300025986 Ga0207658_10044959 Ga0207658_100449592 223
148 3300026023 Ga0207677_10083985 Ga0207677_100839851 223
149 3300026041 Ga0207639_10060888 Ga0207639_100608883 223
150 3300026067 Ga0207678_10016129 Ga0207678_100161292 223
151 3300026088 Ga0207641_10121646 Ga0207641_101216463 223
152 3300026116 Ga0207674_10157626 Ga0207674_101576262 223
153 3300026118 Ga0207675_100803994 Ga0207675_1008039942 223
154 3300026142 Ga0207698_10024898 Ga0207698_100248983 223
155 3300028379 Ga0268266_10380452 Ga0268266_103804522 223
156 3300031548 Ga0307408_100539758 Ga0307408_1005397582 223
157 3300031548 Ga0307408_100635466 Ga0307408_1006354661 223
158 3300031731 Ga0307405_10008760 Ga0307405_100087602 223
159 3300031824 Ga0307413_10067357 Ga0307413_100673572 223
160 3300031852 Ga0307410_10114263 Ga0307410_101142633 223
161 3300031901 Ga0307406_10008918 Ga0307406_100089182 223
162 3300031901 Ga0307406_10050197 Ga0307406_100501973 223
163 3300031903 Ga0307407_10010320 Ga0307407_100103206 223
164 3300031903 Ga0307407_10727695 Ga0307407_107276951 223
165 3300031995 Ga0307409_100010349 Ga0307409_1000103492 223
166 3300031995 Ga0307409_100147932 Ga0307409_1001479322 223
167 3300031995 Ga0307409_100513195 Ga0307409_1005131952 223
168 3300032002 Ga0307416_100764813 Ga0307416_1007648131 223
169 3300032002 Ga0307416_101522727 Ga0307416_1015227272 223
170 3300032004 Ga0307414_10009642 Ga0307414_100096422 223
171 3300032005 Ga0307411_10175601 Ga0307411_101756012 223
172 3300032005 Ga0307411_10276379 Ga0307411_102763792 223
173 3300032126 Ga0307415_100646360 Ga0307415_1006463602 223
174 3300037312 Ga0395899_0109634 Ga0395899_0109634_669_1358 223
175 3300037418 Ga0395900_0370464 Ga0395900_0370464_381_1070 223
176 3300037471 Ga0395905_0106283 Ga0395905_0106283_1366_2043 223
177 3300037471 Ga0395905_0303723 Ga0395905_0303723_392_1114 223
178 3300044694 Ga0466963_0422897 Ga0466963_0422897_173_853 223
179 3300044706 Ga0466964_0002211 Ga0466964_0002211_3986_4666 223
180 3300044765 Ga0466970_0013517 Ga0466970_0013517_1627_2307 223
181 3300044842 Ga0466957_0110469 Ga0466957_0110469_790_1470 223
182 3300045976 Ga0466967_0216204 Ga0466967_0216204_882_1562 223
183 3300046512 Ga0495610_0092347 Ga0495610_0092347_276_953 223
184 3300046525 Ga0495663_0011327 Ga0495663_0011327_565_1242 223
185 3300046684 Ga0495669_0000691 Ga0495669_0000691_11883_12560 223
186 3300046684 Ga0495669_0002084 Ga0495669_0002084_233_910 223
187 3300046684 Ga0495669_0022138 Ga0495669_0022138_978_1658 223
188 3300046684 Ga0495669_0062769 Ga0495669_0062769_97_786 223
189 3300047447 Ga0495685_039743 Ga0495685_039743_482_1159 223
190 3300049583 Ga0501067_0042744 Ga0501067_0042744_1238_1915 223
191 3300049584 Ga0501068_0157889 Ga0501068_0157889_381_1061 223
192 3300049585 Ga0501069_0043094 Ga0501069_0043094_1549_2229 223
193 3300050491 nmdc:mga00v17_472218_c1 nmdc:mga00v17_472218_c1_14_691 223
194 3300001977 JGI24746J21847_1003684 JGI24746J21847_10036843 224
195 3300001979 JGI24740J21852_10002180 JGI24740J21852_100021807 224
196 3300001979 JGI24740J21852_10012385 JGI24740J21852_100123853 224
197 3300001989 JGI24739J22299_10001236 JGI24739J22299_100012365 224
198 3300001990 JGI24737J22298_10001280 JGI24737J22298_1000128011 224
199 3300002067 JGI24735J21928_10001228 JGI24735J21928_100012287 224
200 3300002075 JGI24738J21930_10004676 JGI24738J21930_100046762 224
201 3300002244 JGI24742J22300_10004292 JGI24742J22300_100042923 224
202 3300005290 Ga0065712_10092194 Ga0065712_100921942 224
203 3300005290 Ga0065712_10339754 Ga0065712_103397541 224
204 3300005293 Ga0065715_10000390 Ga0065715_100003903 224
205 3300005327 Ga0070658_10001186 Ga0070658_1000118628 224
206 3300005327 Ga0070658_10079865 Ga0070658_100798652 224
207 3300005327 Ga0070658_10345722 Ga0070658_103457221 224
208 3300005329 Ga0070683_100004557 Ga0070683_10000455710 224
209 3300005329 Ga0070683_100035204 Ga0070683_1000352045 224
210 3300005329 Ga0070683_100084143 Ga0070683_1000841434 224
211 3300005331 Ga0070670_100000612 Ga0070670_10000061220 224
212 3300005331 Ga0070670_100000872 Ga0070670_10000087214 224
213 3300005333 Ga0070677_10000095 Ga0070677_100000955 224
214 3300005334 Ga0068869_100376774 Ga0068869_1003767742 224
215 3300005335 Ga0070666_10011522 Ga0070666_100115225 224
216 3300005336 Ga0070680_100020621 Ga0070680_1000206214 224
217 3300005339 Ga0070660_100000707 Ga0070660_10000070718 224
218 3300005339 Ga0070660_100006342 Ga0070660_10000634210 224
219 3300005339 Ga0070660_100064001 Ga0070660_1000640012 224
220 3300005339 Ga0070660_100149511 Ga0070660_1001495112 224
221 3300005344 Ga0070661_100000101 Ga0070661_10000010164 224
222 3300005344 Ga0070661_100114642 Ga0070661_1001146422 224
223 3300005344 Ga0070661_100193276 Ga0070661_1001932762 224
224 3300005344 Ga0070661_100255138 Ga0070661_1002551382 224
225 3300005344 Ga0070661_100311906 Ga0070661_1003119062 224
226 3300005344 Ga0070661_100744118 Ga0070661_1007441181 224
227 3300005345 Ga0070692_10030763 Ga0070692_100307632 224
228 3300005347 Ga0070668_100103566 Ga0070668_1001035662 224
229 3300005347 Ga0070668_100231156 Ga0070668_1002311562 224
230 3300005353 Ga0070669_100000194 Ga0070669_10000019456 224
231 3300005354 Ga0070675_100128886 Ga0070675_1001288863 224
232 3300005355 Ga0070671_100086364 Ga0070671_1000863641 224
233 3300005356 Ga0070674_100005167 Ga0070674_1000051677 224
234 3300005364 Ga0070673_100023973 Ga0070673_1000239733 224
235 3300005366 Ga0070659_100000045 Ga0070659_100000045103 224
236 3300005366 Ga0070659_100102284 Ga0070659_1001022843 224
237 3300005367 Ga0070667_100004283 Ga0070667_10000428312 224
238 3300005367 Ga0070667_100018626 Ga0070667_1000186266 224
239 3300005367 Ga0070667_100044366 Ga0070667_1000443665 224
240 3300005434 Ga0070709_10153277 Ga0070709_101532772 224
241 3300005435 Ga0070714_100122385 Ga0070714_1001223852 224
242 3300005435 Ga0070714_100132511 Ga0070714_1001325112 224
243 3300005436 Ga0070713_100048427 Ga0070713_1000484274 224
244 3300005438 Ga0070701_10358789 Ga0070701_103587891 224
245 3300005441 Ga0070700_100251784 Ga0070700_1002517842 224
246 3300005455 Ga0070663_100001602 Ga0070663_1000016028 224
247 3300005455 Ga0070663_100020747 Ga0070663_1000207473 224
248 3300005455 Ga0070663_100052244 Ga0070663_1000522444 224
249 3300005455 Ga0070663_100124192 Ga0070663_1001241922 224
250 3300005456 Ga0070678_100041245 Ga0070678_1000412453 224
251 3300005457 Ga0070662_100000036 Ga0070662_10000003618 224
252 3300005457 Ga0070662_100001074 Ga0070662_10000107420 224
253 3300005457 Ga0070662_100005622 Ga0070662_1000056222 224
254 3300005457 Ga0070662_100085631 Ga0070662_1000856314 224
255 3300005458 Ga0070681_10079481 Ga0070681_100794812 224
256 3300005458 Ga0070681_10181935 Ga0070681_101819352 224
257 3300005458 Ga0070681_10311433 Ga0070681_103114331 224
258 3300005458 Ga0070681_10548513 Ga0070681_105485131 224
259 3300005459 Ga0068867_100023821 Ga0068867_1000238213 224
260 3300005459 Ga0068867_100087922 Ga0068867_1000879223 224
261 3300005530 Ga0070679_100069555 Ga0070679_1000695553 224
262 3300005530 Ga0070679_100117772 Ga0070679_1001177724 224
263 3300005530 Ga0070679_100481303 Ga0070679_1004813032 224
264 3300005535 Ga0070684_100044777 Ga0070684_1000447775 224
265 3300005535 Ga0070684_100507802 Ga0070684_1005078022 224
266 3300005539 Ga0068853_100000059 Ga0068853_10000005974 224
267 3300005539 Ga0068853_100034173 Ga0068853_1000341734 224
268 3300005539 Ga0068853_100077506 Ga0068853_1000775064 224
269 3300005539 Ga0068853_100143262 Ga0068853_1001432623 224
270 3300005539 Ga0068853_100250539 Ga0068853_1002505392 224
271 3300005539 Ga0068853_100882479 Ga0068853_1008824791 224
272 3300005543 Ga0070672_100022654 Ga0070672_1000226544 224
273 3300005546 Ga0070696_100170459 Ga0070696_1001704592 224
274 3300005547 Ga0070693_100002442 Ga0070693_1000024426 224
275 3300005548 Ga0070665_100092908 Ga0070665_1000929083 224
276 3300005548 Ga0070665_100634122 Ga0070665_1006341222 224
277 3300005563 Ga0068855_100003816 Ga0068855_10000381621 224
278 3300005563 Ga0068855_100031364 Ga0068855_1000313645 224
279 3300005563 Ga0068855_100070143 Ga0068855_1000701435 224
280 3300005564 Ga0070664_100000027 Ga0070664_10000002718 224
281 3300005564 Ga0070664_100017935 Ga0070664_1000179355 224
282 3300005564 Ga0070664_100282006 Ga0070664_1002820062 224
283 3300005577 Ga0068857_100029228 Ga0068857_1000292282 224
284 3300005577 Ga0068857_100142447 Ga0068857_1001424471 224
285 3300005578 Ga0068854_100010386 Ga0068854_1000103862 224
286 3300005578 Ga0068854_100015348 Ga0068854_1000153483 224
287 3300005614 Ga0068856_100000699 Ga0068856_10000069918 224
288 3300005614 Ga0068856_100010727 Ga0068856_1000107275 224
289 3300005614 Ga0068856_100122416 Ga0068856_1001224162 224
290 3300005614 Ga0068856_100177675 Ga0068856_1001776753 224
291 3300005616 Ga0068852_100000647 Ga0068852_10000064718 224
292 3300005616 Ga0068852_100009371 Ga0068852_1000093716 224
293 3300005616 Ga0068852_100030978 Ga0068852_1000309781 224
294 3300005616 Ga0068852_100102296 Ga0068852_1001022964 224
295 3300005617 Ga0068859_100002854 Ga0068859_1000028543 224
296 3300005617 Ga0068859_100105668 Ga0068859_1001056684 224
297 3300005618 Ga0068864_100013694 Ga0068864_1000136948 224
298 3300005719 Ga0068861_100045633 Ga0068861_1000456334 224
299 3300005840 Ga0068870_10148625 Ga0068870_101486252 224
300 3300005841 Ga0068863_100224623 Ga0068863_1002246233 224
301 3300005841 Ga0068863_100616648 Ga0068863_1006166482 224
302 3300005842 Ga0068858_100105083 Ga0068858_1001050831 224
303 3300005843 Ga0068860_100252527 Ga0068860_1002525272 224
304 3300005844 Ga0068862_100011808 Ga0068862_1000118086 224
305 3300006028 Ga0070717_10170285 Ga0070717_101702852 224
306 3300006175 Ga0070712_100116958 Ga0070712_1001169583 224
307 3300006237 Ga0097621_100083859 Ga0097621_1000838594 224
308 3300006358 Ga0068871_100095707 Ga0068871_1000957072 224
309 3300006881 Ga0068865_100126922 Ga0068865_1001269222 224
310 3300006931 Ga0097620_100002854 Ga0097620_1000028543 224
311 3300006931 Ga0097620_100105674 Ga0097620_1001056744 224
312 3300009093 Ga0105240_10049777 Ga0105240_100497774 224
313 3300009094 Ga0111539_10676664 Ga0111539_106766642 224
314 3300009148 Ga0105243_10066967 Ga0105243_100669674 224
315 3300009148 Ga0105243_10079565 Ga0105243_100795652 224
316 3300009174 Ga0105241_10786727 Ga0105241_107867272 224
317 3300009176 Ga0105242_10561846 Ga0105242_105618462 224
318 3300009177 Ga0105248_10001529 Ga0105248_1000152915 224
319 3300009177 Ga0105248_10129693 Ga0105248_101296934 224
320 3300009551 Ga0105238_10047673 Ga0105238_100476733 224
321 3300009551 Ga0105238_10055078 Ga0105238_100550784 224
322 3300009551 Ga0105238_11017068 Ga0105238_110170682 224
323 3300009553 Ga0105249_10217999 Ga0105249_102179993 224
324 3300009553 Ga0105249_10556965 Ga0105249_105569653 224
325 3300013100 Ga0157373_10018969 Ga0157373_100189695 224
326 3300013100 Ga0157373_10021132 Ga0157373_100211323 224
327 3300013100 Ga0157373_10021311 Ga0157373_100213113 224
328 3300013100 Ga0157373_10083156 Ga0157373_100831564 224
329 3300013102 Ga0157371_10004543 Ga0157371_1000454315 224
330 3300013102 Ga0157371_10009105 Ga0157371_100091055 224
331 3300013102 Ga0157371_10037370 Ga0157371_100373704 224
332 3300013102 Ga0157371_10050896 Ga0157371_100508964 224
333 3300013104 Ga0157370_10079692 Ga0157370_100796925 224
334 3300013104 Ga0157370_10090878 Ga0157370_100908784 224
335 3300013105 Ga0157369_10009511 Ga0157369_100095112 224
336 3300013105 Ga0157369_10052357 Ga0157369_100523575 224
337 3300013105 Ga0157369_10064033 Ga0157369_100640334 224
338 3300013105 Ga0157369_10120570 Ga0157369_101205702 224
339 3300013296 Ga0157374_10003921 Ga0157374_1000392111 224
340 3300013296 Ga0157374_10086562 Ga0157374_100865623 224
341 3300013307 Ga0157372_10119986 Ga0157372_101199861 224
342 3300013307 Ga0157372_10326296 Ga0157372_103262962 224
343 3300013307 Ga0157372_11048991 Ga0157372_110489912 224
344 3300014325 Ga0163163_10000187 Ga0163163_1000018760 224
345 3300014326 Ga0157380_10008229 Ga0157380_100082293 224
346 3300014326 Ga0157380_10091989 Ga0157380_100919893 224
347 3300014968 Ga0157379_10122647 Ga0157379_101226473 224
348 3300017792 Ga0163161_10239404 Ga0163161_102394042 224
349 3300025271 Ga0207666_1008321 Ga0207666_10083212 224
350 3300025893 Ga0207682_10001963 Ga0207682_100019637 224
351 3300025901 Ga0207688_10145492 Ga0207688_101454922 224
352 3300025903 Ga0207680_10001103 Ga0207680_100011035 224
353 3300025904 Ga0207647_10016088 Ga0207647_100160885 224
354 3300025904 Ga0207647_10036981 Ga0207647_100369814 224
355 3300025904 Ga0207647_10243279 Ga0207647_102432791 224
356 3300025907 Ga0207645_10016242 Ga0207645_100162425 224
357 3300025908 Ga0207643_10031639 Ga0207643_100316394 224
358 3300025909 Ga0207705_10000912 Ga0207705_1000091232 224
359 3300025909 Ga0207705_10011932 Ga0207705_100119328 224
360 3300025909 Ga0207705_10016493 Ga0207705_100164934 224
361 3300025909 Ga0207705_10019346 Ga0207705_100193462 224
362 3300025909 Ga0207705_10059604 Ga0207705_100596042 224
363 3300025909 Ga0207705_10539331 Ga0207705_105393312 224
364 3300025911 Ga0207654_10616957 Ga0207654_106169571 224
365 3300025912 Ga0207707_10003841 Ga0207707_1000384116 224
366 3300025912 Ga0207707_10235422 Ga0207707_102354223 224
367 3300025913 Ga0207695_10022897 Ga0207695_100228975 224
368 3300025915 Ga0207693_10059469 Ga0207693_100594693 224
369 3300025915 Ga0207693_10211540 Ga0207693_102115403 224
370 3300025917 Ga0207660_10007790 Ga0207660_100077906 224
371 3300025917 Ga0207660_10007977 Ga0207660_100079771 224
372 3300025919 Ga0207657_10000133 Ga0207657_1000013385 224
373 3300025919 Ga0207657_10003883 Ga0207657_1000388315 224
374 3300025919 Ga0207657_10021889 Ga0207657_100218898 224
375 3300025919 Ga0207657_10038898 Ga0207657_100388984 224
376 3300025920 Ga0207649_10000680 Ga0207649_1000068014 224
377 3300025920 Ga0207649_10001548 Ga0207649_1000154813 224
378 3300025920 Ga0207649_10051590 Ga0207649_100515902 224
379 3300025920 Ga0207649_10506143 Ga0207649_105061431 224
380 3300025921 Ga0207652_10004117 Ga0207652_1000411712 224
381 3300025921 Ga0207652_10024944 Ga0207652_100249446 224
382 3300025921 Ga0207652_10738166 Ga0207652_107381662 224
383 3300025923 Ga0207681_10036883 Ga0207681_100368833 224
384 3300025923 Ga0207681_10236142 Ga0207681_102361422 224
385 3300025923 Ga0207681_10330980 Ga0207681_103309802 224
386 3300025924 Ga0207694_10023343 Ga0207694_100233437 224
387 3300025925 Ga0207650_10001992 Ga0207650_1000199217 224
388 3300025925 Ga0207650_10008596 Ga0207650_100085965 224
389 3300025926 Ga0207659_10027635 Ga0207659_100276354 224
390 3300025928 Ga0207700_10044512 Ga0207700_100445123 224
391 3300025928 Ga0207700_10949673 Ga0207700_109496731 224
392 3300025931 Ga0207644_10039094 Ga0207644_100390945 224
393 3300025932 Ga0207690_10000080 Ga0207690_1000008074 224
394 3300025932 Ga0207690_10006257 Ga0207690_100062574 224
395 3300025932 Ga0207690_10032177 Ga0207690_100321774 224
396 3300025932 Ga0207690_10174674 Ga0207690_101746741 224
397 3300025933 Ga0207706_10000159 Ga0207706_1000015985 224
398 3300025933 Ga0207706_10001809 Ga0207706_100018099 224
399 3300025933 Ga0207706_10003286 Ga0207706_100032867 224
400 3300025935 Ga0207709_10042267 Ga0207709_100422673 224
401 3300025935 Ga0207709_10054543 Ga0207709_100545433 224
402 3300025937 Ga0207669_10028716 Ga0207669_100287165 224
403 3300025940 Ga0207691_10002211 Ga0207691_1000221120 224
404 3300025942 Ga0207689_10268837 Ga0207689_102688372 224
405 3300025944 Ga0207661_10013062 Ga0207661_100130623 224
406 3300025944 Ga0207661_10071222 Ga0207661_100712223 224
407 3300025944 Ga0207661_10434749 Ga0207661_104347492 224
408 3300025945 Ga0207679_10001226 Ga0207679_100012265 224
409 3300025945 Ga0207679_10013084 Ga0207679_100130845 224
410 3300025945 Ga0207679_10172457 Ga0207679_101724573 224
411 3300025949 Ga0207667_10005833 Ga0207667_1000583315 224
412 3300025949 Ga0207667_10007031 Ga0207667_100070315 224
413 3300025949 Ga0207667_10012556 Ga0207667_100125569 224
414 3300025949 Ga0207667_10032837 Ga0207667_100328375 224
415 3300025949 Ga0207667_10238971 Ga0207667_102389712 224
416 3300025949 Ga0207667_10690273 Ga0207667_106902732 224
417 3300025960 Ga0207651_10025465 Ga0207651_100254653 224
418 3300025972 Ga0207668_10024934 Ga0207668_100249344 224
419 3300025981 Ga0207640_10021744 Ga0207640_100217446 224
420 3300025981 Ga0207640_10081355 Ga0207640_100813553 224
421 3300025981 Ga0207640_10223440 Ga0207640_102234402 224
422 3300025986 Ga0207658_10090244 Ga0207658_100902443 224
423 3300026035 Ga0207703_10012033 Ga0207703_1001203311 224
424 3300026041 Ga0207639_10001590 Ga0207639_1000159015 224
425 3300026041 Ga0207639_10008347 Ga0207639_1000834710 224
426 3300026041 Ga0207639_10053731 Ga0207639_100537314 224
427 3300026041 Ga0207639_10396807 Ga0207639_103968072 224
428 3300026041 Ga0207639_10469780 Ga0207639_104697802 224
429 3300026067 Ga0207678_10002822 Ga0207678_1000282218 224
430 3300026067 Ga0207678_10003713 Ga0207678_1000371315 224
431 3300026067 Ga0207678_10006907 Ga0207678_100069078 224
432 3300026067 Ga0207678_10008361 Ga0207678_100083617 224
433 3300026067 Ga0207678_10020896 Ga0207678_100208964 224
434 3300026075 Ga0207708_10368731 Ga0207708_103687311 224
435 3300026078 Ga0207702_10000246 Ga0207702_100002466 224
436 3300026078 Ga0207702_10015039 Ga0207702_100150393 224
437 3300026078 Ga0207702_10054472 Ga0207702_100544724 224
438 3300026078 Ga0207702_10075460 Ga0207702_100754603 224
439 3300026078 Ga0207702_10124149 Ga0207702_101241492 224
440 3300026088 Ga0207641_10390123 Ga0207641_103901232 224
441 3300026089 Ga0207648_10010366 Ga0207648_100103665 224
442 3300026095 Ga0207676_10093523 Ga0207676_100935231 224
443 3300026116 Ga0207674_10008100 Ga0207674_1000810014 224
444 3300026116 Ga0207674_10044796 Ga0207674_100447965 224
445 3300026118 Ga0207675_100294306 Ga0207675_1002943063 224
446 3300026121 Ga0207683_10061059 Ga0207683_100610593 224
447 3300026142 Ga0207698_10000759 Ga0207698_1000075915 224
448 3300026142 Ga0207698_10001817 Ga0207698_1000181714 224
449 3300026142 Ga0207698_10007246 Ga0207698_100072468 224
450 3300026142 Ga0207698_10025969 Ga0207698_100259693 224
451 3300026142 Ga0207698_11014198 Ga0207698_110141982 224
452 3300028380 Ga0268265_10002704 Ga0268265_100027043 224
453 3300028380 Ga0268265_10146331 Ga0268265_101463312 224
454 3300028381 Ga0268264_10039723 Ga0268264_100397236 224
455 3300028381 Ga0268264_10209216 Ga0268264_102092163 224
456 3300028381 Ga0268264_10523466 Ga0268264_105234662 224
457 3300030731 Ga0316177_1076192 Ga0316177_10761923 224
458 3300031548 Ga0307408_100033219 Ga0307408_1000332192 224
459 3300031731 Ga0307405_10016190 Ga0307405_100161902 224
460 3300031731 Ga0307405_10179162 Ga0307405_101791622 224
461 3300031824 Ga0307413_10012283 Ga0307413_100122835 224
462 3300031824 Ga0307413_10055408 Ga0307413_100554082 224
463 3300031852 Ga0307410_10448463 Ga0307410_104484632 224
464 3300031901 Ga0307406_10166874 Ga0307406_101668742 224
465 3300031901 Ga0307406_10561320 Ga0307406_105613202 224
466 3300031903 Ga0307407_10035237 Ga0307407_100352374 224
467 3300031903 Ga0307407_10072381 Ga0307407_100723813 224
468 3300031995 Ga0307409_100014101 Ga0307409_1000141013 224
469 3300031995 Ga0307409_100077430 Ga0307409_1000774302 224
470 3300031995 Ga0307409_100228268 Ga0307409_1002282682 224
471 3300031995 Ga0307409_100291194 Ga0307409_1002911941 224
472 3300032002 Ga0307416_100021460 Ga0307416_1000214605 224
473 3300032002 Ga0307416_101020838 Ga0307416_1010208382 224
474 3300032004 Ga0307414_10030411 Ga0307414_100304115 224
475 3300032004 Ga0307414_10073960 Ga0307414_100739603 224
476 3300032004 Ga0307414_10143711 Ga0307414_101437113 224
477 3300032004 Ga0307414_10190899 Ga0307414_101908992 224
478 3300032004 Ga0307414_10285803 Ga0307414_102858031 224
479 3300032005 Ga0307411_10030849 Ga0307411_100308492 224
480 3300032005 Ga0307411_10184294 Ga0307411_101842942 224
481 3300032005 Ga0307411_10260471 Ga0307411_102604712 224
482 3300032005 Ga0307411_10263880 Ga0307411_102638801 224
483 3300032005 Ga0307411_10378221 Ga0307411_103782212 224
484 3300032126 Ga0307415_100011203 Ga0307415_1000112035 224
485 3300032126 Ga0307415_100134897 Ga0307415_1001348972 224
486 3300032126 Ga0307415_100733465 Ga0307415_1007334651 224
487 3300035207 Ga0373942_0011502 Ga0373942_0011502_705_1382 224
488 3300037312 Ga0395899_0005996 Ga0395899_0005996_3114_3791 224
489 3300037312 Ga0395899_0010088 Ga0395899_0010088_2748_3425 224
490 3300037312 Ga0395899_0031251 Ga0395899_0031251_2508_3194 224
491 3300037312 Ga0395899_0032112 Ga0395899_0032112_1116_1799 224
492 3300037312 Ga0395899_0326573 Ga0395899_0326573_185_862 224
493 3300037312 Ga0395899_0392086 Ga0395899_0392086_80_760 224
494 3300037312 Ga0395899_0453241 Ga0395899_0453241_119_793 224
495 3300037312 Ga0395899_0538872 Ga0395899_0538872_57_734 224
496 3300037418 Ga0395900_0009530 Ga0395900_0009530_9088_9828 224
497 3300037418 Ga0395900_0011561 Ga0395900_0011561_3090_3767 224
498 3300037418 Ga0395900_0024204 Ga0395900_0024204_5257_5943 224
499 3300037418 Ga0395900_0037001 Ga0395900_0037001_1348_2034 224
500 3300037418 Ga0395900_0056710 Ga0395900_0056710_841_1524 224
501 3300037418 Ga0395900_0093648 Ga0395900_0093648_2159_2836 224
502 3300037418 Ga0395900_0167869 Ga0395900_0167869_14_697 224
503 3300037418 Ga0395900_0192160 Ga0395900_0192160_895_1578 224
504 3300037418 Ga0395900_0262896 Ga0395900_0262896_1005_1679 224
505 3300037418 Ga0395900_0621537 Ga0395900_0621537_94_771 224
506 3300037466 Ga0395898_0008628 Ga0395898_0008628_5188_5865 224
507 3300037466 Ga0395898_0064763 Ga0395898_0064763_2508_3194 224
508 3300037466 Ga0395898_0068409 Ga0395898_0068409_177_860 224
509 3300037466 Ga0395898_0162219 Ga0395898_0162219_761_1447 224
510 3300037466 Ga0395898_0475805 Ga0395898_0475805_472_1146 224
511 3300037471 Ga0395905_0005494 Ga0395905_0005494_6986_7663 224
512 3300037471 Ga0395905_0006924 Ga0395905_0006924_2428_3114 224
513 3300037471 Ga0395905_0034610 Ga0395905_0034610_2172_2855 224
514 3300037471 Ga0395905_0058839 Ga0395905_0058839_2770_3453 224
515 3300037471 Ga0395905_0110738 Ga0395905_0110738_1202_1888 224
516 3300037471 Ga0395905_0157619 Ga0395905_0157619_47_721 224
517 3300037471 Ga0395905_0184763 Ga0395905_0184763_1189_1863 224
518 3300038443 Ga0395901_0000876 Ga0395901_0000876_25627_26313 224
519 3300038443 Ga0395901_0003575 Ga0395901_0003575_8145_8822 224
520 3300038443 Ga0395901_0010662 Ga0395901_0010662_3984_4667 224
521 3300038443 Ga0395901_0045368 Ga0395901_0045368_1689_2375 224
522 3300038443 Ga0395901_0046767 Ga0395901_0046767_857_1540 224
523 3300038443 Ga0395901_0086568 Ga0395901_0086568_20_700 224
524 3300038443 Ga0395901_0285742 Ga0395901_0285742_208_885 224
525 3300038443 Ga0395901_0703094 Ga0395901_0703094_36_713 224
526 3300038443 Ga0395901_0778506 Ga0395901_0778506_178_861 224
527 3300038443 Ga0395901_0937238 Ga0395901_0937238_44_718 224
528 3300039437 Ga0436365_0119604 Ga0436365_0119604_103_783 224
529 3300044656 Ga0466969_0016805 Ga0466969_0016805_412_1092 224
530 3300044684 Ga0466966_0000041 Ga0466966_0000041_57077_57754 224
531 3300044684 Ga0466966_0027442 Ga0466966_0027442_895_1575 224
532 3300044684 Ga0466966_0051888 Ga0466966_0051888_1202_1879 224
533 3300044684 Ga0466966_0090017 Ga0466966_0090017_833_1510 224
534 3300044684 Ga0466966_0159665 Ga0466966_0159665_129_803 224
535 3300044693 Ga0466961_0037729 Ga0466961_0037729_2133_2828 224
536 3300044693 Ga0466961_0073863 Ga0466961_0073863_429_1106 224
537 3300044693 Ga0466961_0131038 Ga0466961_0131038_199_876 224
538 3300044693 Ga0466961_0389707 Ga0466961_0389707_130_804 224
539 3300044694 Ga0466963_0017531 Ga0466963_0017531_1660_2334 224
540 3300044694 Ga0466963_0024695 Ga0466963_0024695_293_970 224
541 3300044694 Ga0466963_0035239 Ga0466963_0035239_1639_2316 224
542 3300044694 Ga0466963_0039293 Ga0466963_0039293_77_754 224
543 3300044694 Ga0466963_0055246 Ga0466963_0055246_301_978 224
544 3300044719 Ga0466971_0015256 Ga0466971_0015256_610_1287 224
545 3300044765 Ga0466970_0152024 Ga0466970_0152024_327_1004 224
546 3300044842 Ga0466957_0000822 Ga0466957_0000822_11078_11755 224
547 3300044842 Ga0466957_0164764 Ga0466957_0164764_542_1219 224
548 3300044842 Ga0466957_0297838 Ga0466957_0297838_340_1017 224
549 3300044842 Ga0466957_0390114 Ga0466957_0390114_144_818 224
550 3300045049 Ga0466959_0152957 Ga0466959_0152957_193_873 224
551 3300045049 Ga0466959_0164308 Ga0466959_0164308_438_1115 224
552 3300045049 Ga0466959_0232815 Ga0466959_0232815_566_1243 224
553 3300045836 Ga0466958_0005915 Ga0466958_0005915_4161_4838 224
554 3300045836 Ga0466958_0017913 Ga0466958_0017913_1302_1979 224
555 3300045836 Ga0466958_0101839 Ga0466958_0101839_325_999 224
556 3300045976 Ga0466967_0019982 Ga0466967_0019982_3845_4522 224
557 3300045976 Ga0466967_0070496 Ga0466967_0070496_938_1612 224
558 3300045976 Ga0466967_0126356 Ga0466967_0126356_1412_2089 224
559 3300045976 Ga0466967_0546085 Ga0466967_0546085_444_1118 224
560 3300045976 Ga0466967_0640860 Ga0466967_0640860_161_838 224
561 3300045976 Ga0466967_0668998 Ga0466967_0668998_57_734 224
562 3300046525 Ga0495663_0010542 Ga0495663_0010542_1419_2096 224
563 3300046525 Ga0495663_0020096 Ga0495663_0020096_1216_1893 224
564 3300046537 Ga0495598_0002192 Ga0495598_0002192_301_978 224
565 3300046539 Ga0495621_0028955 Ga0495621_0028955_201_878 224
566 3300046539 Ga0495621_0057592 Ga0495621_0057592_580_1257 224
567 3300046558 Ga0495633_0013628 Ga0495633_0013628_1254_1931 224
568 3300046558 Ga0495633_0015973 Ga0495633_0015973_2618_3295 224
569 3300046664 Ga0495659_0018146 Ga0495659_0018146_1026_1703 224
570 3300046664 Ga0495659_0108571 Ga0495659_0108571_262_939 224
571 3300046691 Ga0495670_0036168 Ga0495670_0036168_513_1190 224
572 3300046691 Ga0495670_0057745 Ga0495670_0057745_493_1170 224
573 3300046691 Ga0495670_0180183 Ga0495670_0180183_238_915 224
574 3300047445 Ga0495677_0043457 Ga0495677_0043457_803_1480 224
575 3300048914 Ga0496111_0498197 Ga0496111_0498197_79_756 224
576 3300049590 Ga0501074_0033402 Ga0501074_0033402_2421_3101 224
577 3300049742 Ga0501080_0038193 Ga0501080_0038193_2296_2976 224
578 3300050493 nmdc:mga0k408_208652_c1 nmdc:mga0k408_208652_c1_360_1037 224
579 3300050511 nmdc:mga08y16_500365_c1 nmdc:mga08y16_500365_c1_425_1102 224
580 3300059492 Ga0587073_0029067 Ga0587073_0029067_237_914 224
581 3300059630 Ga0587128_005061 Ga0587128_005061_17_694 224
582 3300059644 Ga0587075_000690 Ga0587075_000690_1731_2408 224
583 3300059644 Ga0587075_010514 Ga0587075_010514_395_1075 224
584 3300059647 Ga0587079_016526 Ga0587079_016526_136_816 224
585 3300059655 Ga0587114_025003 Ga0587114_025003_64_741 224
586 3300060344 Ga0587071_034007 Ga0587071_034007_279_956 224
587 3300061719 Ga0466962_0012721 Ga0466962_0012721_3345_4022 224
588 3300061719 Ga0466962_0155991 Ga0466962_0155991_422_1096 224
589 3300001990 JGI24737J22298_10016756 JGI24737J22298_100167563 225
590 3300002239 JGI24034J26672_10020429 JGI24034J26672_100204292 225
591 3300005331 Ga0070670_100011316 Ga0070670_10001131610 225
592 3300005331 Ga0070670_100140534 Ga0070670_1001405343 225
593 3300005335 Ga0070666_10036945 Ga0070666_100369454 225
594 3300005335 Ga0070666_10052705 Ga0070666_100527053 225
595 3300005338 Ga0068868_100396756 Ga0068868_1003967562 225
596 3300005339 Ga0070660_100165526 Ga0070660_1001655263 225
597 3300005347 Ga0070668_100600029 Ga0070668_1006000292 225
598 3300005355 Ga0070671_100085184 Ga0070671_1000851842 225
599 3300005355 Ga0070671_100608654 Ga0070671_1006086542 225
600 3300005356 Ga0070674_100121187 Ga0070674_1001211872 225
601 3300005364 Ga0070673_100004896 Ga0070673_1000048962 225
602 3300005366 Ga0070659_100004168 Ga0070659_10000416815 225
603 3300005366 Ga0070659_100382188 Ga0070659_1003821882 225
604 3300005367 Ga0070667_100060754 Ga0070667_1000607542 225
605 3300005367 Ga0070667_100453931 Ga0070667_1004539312 225
606 3300005455 Ga0070663_100246880 Ga0070663_1002468802 225
607 3300005456 Ga0070678_100001956 Ga0070678_10000195612 225
608 3300005457 Ga0070662_100005153 Ga0070662_1000051533 225
609 3300005457 Ga0070662_100009695 Ga0070662_1000096957 225
610 3300005466 Ga0070685_10058613 Ga0070685_100586133 225
611 3300005530 Ga0070679_100277920 Ga0070679_1002779203 225
612 3300005543 Ga0070672_100014258 Ga0070672_1000142582 225
613 3300005548 Ga0070665_100626036 Ga0070665_1006260362 225
614 3300005564 Ga0070664_100006979 Ga0070664_1000069795 225
615 3300005564 Ga0070664_100411659 Ga0070664_1004116592 225
616 3300005577 Ga0068857_100153291 Ga0068857_1001532911 225
617 3300005616 Ga0068852_100164721 Ga0068852_1001647213 225
618 3300005617 Ga0068859_100297521 Ga0068859_1002975213 225
619 3300005617 Ga0068859_101040042 Ga0068859_1010400422 225
620 3300005618 Ga0068864_100379330 Ga0068864_1003793302 225
621 3300005841 Ga0068863_100194306 Ga0068863_1001943062 225
622 3300005842 Ga0068858_100002849 Ga0068858_10000284917 225
623 3300006237 Ga0097621_100100013 Ga0097621_1001000132 225
624 3300006358 Ga0068871_100122214 Ga0068871_1001222143 225
625 3300006358 Ga0068871_100426595 Ga0068871_1004265952 225
626 3300006931 Ga0097620_100033638 Ga0097620_1000336382 225
627 3300006931 Ga0097620_100297501 Ga0097620_1002975013 225
628 3300006931 Ga0097620_101040086 Ga0097620_1010400862 225
629 3300009101 Ga0105247_10093455 Ga0105247_100934553 225
630 3300009174 Ga0105241_10324439 Ga0105241_103244392 225
631 3300009177 Ga0105248_10009667 Ga0105248_100096671 225
632 3300009177 Ga0105248_10031888 Ga0105248_100318881 225
633 3300009177 Ga0105248_10425957 Ga0105248_104259572 225
634 3300013100 Ga0157373_10103748 Ga0157373_101037482 225
635 3300013102 Ga0157371_10422825 Ga0157371_104228252 225
636 3300013296 Ga0157374_10029635 Ga0157374_100296355 225
637 3300013297 Ga0157378_10532718 Ga0157378_105327182 225
638 3300013306 Ga0163162_10013878 Ga0163162_100138782 225
639 3300013307 Ga0157372_10156390 Ga0157372_101563902 225
640 3300013308 Ga0157375_10007359 Ga0157375_1000735914 225
641 3300014325 Ga0163163_10182752 Ga0163163_101827523 225
642 3300014968 Ga0157379_10313593 Ga0157379_103135932 225
643 3300025321 Ga0207656_10351362 Ga0207656_103513621 225
644 3300025903 Ga0207680_10149288 Ga0207680_101492882 225
645 3300025904 Ga0207647_10034774 Ga0207647_100347742 225
646 3300025912 Ga0207707_10412298 Ga0207707_104122981 225
647 3300025919 Ga0207657_10287818 Ga0207657_102878182 225
648 3300025925 Ga0207650_10017397 Ga0207650_100173975 225
649 3300025925 Ga0207650_10414317 Ga0207650_104143172 225
650 3300025926 Ga0207659_10328156 Ga0207659_103281562 225
651 3300025931 Ga0207644_10124196 Ga0207644_101241963 225
652 3300025931 Ga0207644_10458763 Ga0207644_104587631 225
653 3300025932 Ga0207690_10007933 Ga0207690_100079337 225
654 3300025933 Ga0207706_10004902 Ga0207706_100049028 225
655 3300025933 Ga0207706_10019749 Ga0207706_100197494 225
656 3300025933 Ga0207706_10022333 Ga0207706_100223334 225
657 3300025937 Ga0207669_10102521 Ga0207669_101025211 225
658 3300025940 Ga0207691_10009742 Ga0207691_100097423 225
659 3300025941 Ga0207711_10130294 Ga0207711_101302942 225
660 3300025945 Ga0207679_10001563 Ga0207679_100015635 225
661 3300025960 Ga0207651_10074093 Ga0207651_100740934 225
662 3300025986 Ga0207658_10254934 Ga0207658_102549342 225
663 3300025986 Ga0207658_10308030 Ga0207658_103080301 225
664 3300026035 Ga0207703_10046478 Ga0207703_100464784 225
665 3300026067 Ga0207678_10042518 Ga0207678_100425184 225
666 3300026088 Ga0207641_10097521 Ga0207641_100975212 225
667 3300026088 Ga0207641_10226094 Ga0207641_102260942 225
668 3300026116 Ga0207674_10809119 Ga0207674_108091191 225
669 3300026121 Ga0207683_10002206 Ga0207683_1000220617 225
670 3300028379 Ga0268266_10245440 Ga0268266_102454401 225
671 3300031824 Ga0307413_10054579 Ga0307413_100545794 225
672 3300031852 Ga0307410_10187555 Ga0307410_101875553 225
673 3300031901 Ga0307406_10589015 Ga0307406_105890151 225
674 3300031903 Ga0307407_10073482 Ga0307407_100734824 225
675 3300031903 Ga0307407_10291291 Ga0307407_102912912 225
676 3300031911 Ga0307412_10446498 Ga0307412_104464982 225
677 3300032004 Ga0307414_10055986 Ga0307414_100559863 225
678 3300032005 Ga0307411_10155256 Ga0307411_101552562 225
679 3300035170 Ga0373943_0100735 Ga0373943_0100735_583_1269 225
680 3300035692 Ga0373935_0058992 Ga0373935_0058992_1083_1769 225
681 3300035695 Ga0373927_0049184 Ga0373927_0049184_164_850 225
682 3300037068 Ga0373925_0019664 Ga0373925_0019664_3539_4225 225
683 3300037418 Ga0395900_0056366 Ga0395900_0056366_3044_3727 225
684 3300037418 Ga0395900_0342714 Ga0395900_0342714_15_698 225
685 3300037466 Ga0395898_0097124 Ga0395898_0097124_1055_1738 225
686 3300037471 Ga0395905_0015044 Ga0395905_0015044_2214_2897 225
687 3300037471 Ga0395905_0015414 Ga0395905_0015414_950_1633 225
688 3300037471 Ga0395905_0090194 Ga0395905_0090194_835_1518 225
689 3300037471 Ga0395905_0225240 Ga0395905_0225240_528_1229 225
690 3300038443 Ga0395901_0046768 Ga0395901_0046768_1895_2578 225
691 3300038443 Ga0395901_0069737 Ga0395901_0069737_1428_2111 225
692 3300038443 Ga0395901_0148718 Ga0395901_0148718_732_1415 225
693 3300042012 Ga0439455_0056582 Ga0439455_0056582_196_879 225
694 3300042157 Ga0439458_0000009 Ga0439458_0000009_17832_18515 225
695 3300044693 Ga0466961_0179657 Ga0466961_0179657_461_1144 225
696 3300044694 Ga0466963_0057356 Ga0466963_0057356_1467_2150 225
697 3300044842 Ga0466957_0140792 Ga0466957_0140792_725_1408 225
698 3300045976 Ga0466967_0211086 Ga0466967_0211086_687_1373 225
699 3300046525 Ga0495663_0037512 Ga0495663_0037512_297_977 225
700 3300046528 Ga0495642_0057828 Ga0495642_0057828_366_1046 225
701 3300046664 Ga0495659_0002607 Ga0495659_0002607_3817_4497 225
702 3300048903 Ga0496100_0272368 Ga0496100_0272368_289_969 225
703 3300048904 Ga0496101_0078250 Ga0496101_0078250_1009_1689 225
704 3300048905 Ga0496102_0180683 Ga0496102_0180683_319_999 225
705 3300048910 Ga0496107_0028874 Ga0496107_0028874_1841_2521 225
706 3300048910 Ga0496107_0041173 Ga0496107_0041173_887_1570 225
707 3300048911 Ga0496108_0332163 Ga0496108_0332163_324_1007 225
708 3300048912 Ga0496109_0186942 Ga0496109_0186942_1177_1857 225
709 3300048914 Ga0496111_0030922 Ga0496111_0030922_1558_2238 225
710 3300048916 Ga0496113_0201441 Ga0496113_0201441_131_811 225
711 3300048917 Ga0496114_0018596 Ga0496114_0018596_349_1029 225
712 3300048918 Ga0496115_0125702 Ga0496115_0125702_765_1445 225
713 3300001904 JGI24736J21556_1018735 JGI24736J21556_10187351 226
714 3300001976 JGI24752J21851_1024427 JGI24752J21851_10244271 226
715 3300001989 JGI24739J22299_10000785 JGI24739J22299_1000078510 226
716 3300001989 JGI24739J22299_10003474 JGI24739J22299_100034743 226
717 3300001990 JGI24737J22298_10000076 JGI24737J22298_1000007628 226
718 3300002067 JGI24735J21928_10017104 JGI24735J21928_100171042 226
719 3300002075 JGI24738J21930_10000015 JGI24738J21930_1000001531 226
720 3300002075 JGI24738J21930_10008744 JGI24738J21930_100087442 226
721 3300002077 JGI24744J21845_10020875 JGI24744J21845_100208752 226
722 3300002244 JGI24742J22300_10019384 JGI24742J22300_100193841 226
723 3300005293 Ga0065715_10194445 Ga0065715_101944451 226
724 3300005327 Ga0070658_10003103 Ga0070658_100031035 226
725 3300005327 Ga0070658_10039854 Ga0070658_100398545 226
726 3300005327 Ga0070658_10041084 Ga0070658_100410844 226
727 3300005327 Ga0070658_10110552 Ga0070658_101105521 226
728 3300005327 Ga0070658_10368886 Ga0070658_103688862 226
729 3300005328 Ga0070676_10006688 Ga0070676_100066885 226
730 3300005328 Ga0070676_10086238 Ga0070676_100862382 226
731 3300005328 Ga0070676_10110149 Ga0070676_101101493 226
732 3300005329 Ga0070683_100209754 Ga0070683_1002097543 226
733 3300005330 Ga0070690_100046104 Ga0070690_1000461042 226
734 3300005330 Ga0070690_100393950 Ga0070690_1003939502 226
735 3300005331 Ga0070670_100021727 Ga0070670_1000217274 226
736 3300005331 Ga0070670_100076057 Ga0070670_1000760573 226
737 3300005331 Ga0070670_100173263 Ga0070670_1001732633 226
738 3300005333 Ga0070677_10037735 Ga0070677_100377353 226
739 3300005334 Ga0068869_100001204 Ga0068869_10000120418 226
740 3300005334 Ga0068869_100030426 Ga0068869_1000304263 226
741 3300005334 Ga0068869_100043617 Ga0068869_1000436172 226
742 3300005334 Ga0068869_100089257 Ga0068869_1000892572 226
743 3300005335 Ga0070666_10024213 Ga0070666_100242132 226
744 3300005337 Ga0070682_100213874 Ga0070682_1002138742 226
745 3300005338 Ga0068868_100001432 Ga0068868_10000143217 226
746 3300005338 Ga0068868_100006091 Ga0068868_10000609110 226
747 3300005338 Ga0068868_100070790 Ga0068868_1000707903 226
748 3300005339 Ga0070660_100001378 Ga0070660_10000137815 226
749 3300005339 Ga0070660_100001678 Ga0070660_10000167815 226
750 3300005339 Ga0070660_100021590 Ga0070660_1000215905 226
751 3300005339 Ga0070660_100031855 Ga0070660_1000318555 226
752 3300005339 Ga0070660_100208754 Ga0070660_1002087542 226
753 3300005343 Ga0070687_100065059 Ga0070687_1000650593 226
754 3300005343 Ga0070687_100076494 Ga0070687_1000764942 226
755 3300005344 Ga0070661_100062884 Ga0070661_1000628842 226
756 3300005344 Ga0070661_100158146 Ga0070661_1001581462 226
757 3300005345 Ga0070692_10027237 Ga0070692_100272373 226
758 3300005345 Ga0070692_10088609 Ga0070692_100886092 226
759 3300005347 Ga0070668_100031616 Ga0070668_1000316162 226
760 3300005347 Ga0070668_100161290 Ga0070668_1001612902 226
761 3300005347 Ga0070668_100171623 Ga0070668_1001716232 226
762 3300005347 Ga0070668_100297356 Ga0070668_1002973562 226
763 3300005353 Ga0070669_100000586 Ga0070669_10000058615 226
764 3300005353 Ga0070669_100018539 Ga0070669_1000185399 226
765 3300005353 Ga0070669_100029256 Ga0070669_1000292564 226
766 3300005353 Ga0070669_100127263 Ga0070669_1001272633 226
767 3300005354 Ga0070675_100140553 Ga0070675_1001405533 226
768 3300005354 Ga0070675_100597215 Ga0070675_1005972151 226
769 3300005355 Ga0070671_100000357 Ga0070671_10000035718 226
770 3300005355 Ga0070671_100003627 Ga0070671_10000362710 226
771 3300005355 Ga0070671_100010793 Ga0070671_1000107933 226
772 3300005355 Ga0070671_100017343 Ga0070671_1000173433 226
773 3300005355 Ga0070671_100072230 Ga0070671_1000722304 226
774 3300005355 Ga0070671_100217453 Ga0070671_1002174533 226
775 3300005356 Ga0070674_100092802 Ga0070674_1000928023 226
776 3300005356 Ga0070674_100139437 Ga0070674_1001394373 226
777 3300005356 Ga0070674_100236308 Ga0070674_1002363082 226
778 3300005356 Ga0070674_100280836 Ga0070674_1002808362 226
779 3300005364 Ga0070673_100017031 Ga0070673_1000170315 226
780 3300005364 Ga0070673_100026517 Ga0070673_1000265173 226
781 3300005364 Ga0070673_100111719 Ga0070673_1001117192 226
782 3300005364 Ga0070673_100629007 Ga0070673_1006290071 226
783 3300005366 Ga0070659_100029813 Ga0070659_1000298136 226
784 3300005366 Ga0070659_100052844 Ga0070659_1000528442 226
785 3300005366 Ga0070659_100109734 Ga0070659_1001097343 226
786 3300005366 Ga0070659_100216017 Ga0070659_1002160173 226
787 3300005366 Ga0070659_100228102 Ga0070659_1002281021 226
788 3300005366 Ga0070659_100451141 Ga0070659_1004511412 226
789 3300005366 Ga0070659_100565218 Ga0070659_1005652181 226
790 3300005366 Ga0070659_100847373 Ga0070659_1008473731 226
791 3300005367 Ga0070667_100003196 Ga0070667_10000319610 226
792 3300005367 Ga0070667_100003945 Ga0070667_10000394512 226
793 3300005367 Ga0070667_100006778 Ga0070667_10000677810 226
794 3300005367 Ga0070667_100021775 Ga0070667_1000217753 226
795 3300005367 Ga0070667_100052504 Ga0070667_1000525043 226
796 3300005367 Ga0070667_100088488 Ga0070667_1000884882 226
797 3300005367 Ga0070667_100251938 Ga0070667_1002519383 226
798 3300005367 Ga0070667_100791600 Ga0070667_1007916002 226
799 3300005434 Ga0070709_10061609 Ga0070709_100616092 226
800 3300005436 Ga0070713_100043907 Ga0070713_1000439073 226
801 3300005455 Ga0070663_100012120 Ga0070663_1000121205 226
802 3300005455 Ga0070663_100088603 Ga0070663_1000886034 226
803 3300005455 Ga0070663_100115407 Ga0070663_1001154073 226
804 3300005455 Ga0070663_100142225 Ga0070663_1001422253 226
805 3300005455 Ga0070663_100178955 Ga0070663_1001789552 226
806 3300005455 Ga0070663_100242293 Ga0070663_1002422933 226
807 3300005455 Ga0070663_100522071 Ga0070663_1005220712 226
808 3300005456 Ga0070678_100083384 Ga0070678_1000833842 226
809 3300005456 Ga0070678_100182167 Ga0070678_1001821672 226
810 3300005457 Ga0070662_100003645 Ga0070662_10000364510 226
811 3300005457 Ga0070662_100090707 Ga0070662_1000907073 226
812 3300005457 Ga0070662_100279028 Ga0070662_1002790282 226
813 3300005459 Ga0068867_100001734 Ga0068867_1000017342 226
814 3300005459 Ga0068867_100006111 Ga0068867_1000061116 226
815 3300005459 Ga0068867_100014205 Ga0068867_1000142056 226
816 3300005459 Ga0068867_100230728 Ga0068867_1002307281 226
817 3300005530 Ga0070679_100500734 Ga0070679_1005007342 226
818 3300005539 Ga0068853_100002189 Ga0068853_1000021893 226
819 3300005539 Ga0068853_100570719 Ga0068853_1005707192 226
820 3300005543 Ga0070672_100001067 Ga0070672_1000010676 226
821 3300005543 Ga0070672_100033110 Ga0070672_1000331103 226
822 3300005543 Ga0070672_100130101 Ga0070672_1001301013 226
823 3300005543 Ga0070672_100188320 Ga0070672_1001883202 226
824 3300005547 Ga0070693_100049169 Ga0070693_1000491693 226
825 3300005547 Ga0070693_100476089 Ga0070693_1004760892 226
826 3300005548 Ga0070665_100014501 Ga0070665_1000145019 226
827 3300005548 Ga0070665_100034809 Ga0070665_1000348094 226
828 3300005548 Ga0070665_100117141 Ga0070665_1001171413 226
829 3300005548 Ga0070665_100574224 Ga0070665_1005742242 226
830 3300005563 Ga0068855_100000036 Ga0068855_10000003666 226
831 3300005563 Ga0068855_100002788 Ga0068855_10000278816 226
832 3300005563 Ga0068855_100011032 Ga0068855_1000110323 226
833 3300005563 Ga0068855_100578810 Ga0068855_1005788102 226
834 3300005564 Ga0070664_100015371 Ga0070664_1000153714 226
835 3300005564 Ga0070664_100069792 Ga0070664_1000697923 226
836 3300005564 Ga0070664_100082285 Ga0070664_1000822853 226
837 3300005564 Ga0070664_100087670 Ga0070664_1000876703 226
838 3300005577 Ga0068857_100000338 Ga0068857_10000033816 226
839 3300005577 Ga0068857_100015563 Ga0068857_1000155638 226
840 3300005577 Ga0068857_100044585 Ga0068857_1000445855 226
841 3300005577 Ga0068857_100115113 Ga0068857_1001151134 226
842 3300005577 Ga0068857_100200796 Ga0068857_1002007962 226
843 3300005578 Ga0068854_100001900 Ga0068854_10000190011 226
844 3300005578 Ga0068854_100054569 Ga0068854_1000545693 226
845 3300005578 Ga0068854_100419215 Ga0068854_1004192151 226
846 3300005614 Ga0068856_100107488 Ga0068856_1001074881 226
847 3300005614 Ga0068856_100168998 Ga0068856_1001689982 226
848 3300005616 Ga0068852_100001883 Ga0068852_1000018837 226
849 3300005616 Ga0068852_100092570 Ga0068852_1000925704 226
850 3300005616 Ga0068852_100108724 Ga0068852_1001087243 226
851 3300005616 Ga0068852_100109938 Ga0068852_1001099383 226
852 3300005616 Ga0068852_100137698 Ga0068852_1001376982 226
853 3300005616 Ga0068852_100163309 Ga0068852_1001633092 226
854 3300005616 Ga0068852_100571504 Ga0068852_1005715042 226
855 3300005617 Ga0068859_100000464 Ga0068859_1000004643 226
856 3300005617 Ga0068859_100000676 Ga0068859_1000006767 226
857 3300005617 Ga0068859_100006502 Ga0068859_1000065026 226
858 3300005617 Ga0068859_100021966 Ga0068859_1000219667 226
859 3300005617 Ga0068859_100038532 Ga0068859_1000385328 226
860 3300005617 Ga0068859_100145064 Ga0068859_1001450643 226
861 3300005618 Ga0068864_100000247 Ga0068864_1000002472 226
862 3300005618 Ga0068864_100001691 Ga0068864_1000016914 226
863 3300005618 Ga0068864_100069820 Ga0068864_1000698203 226
864 3300005718 Ga0068866_10038108 Ga0068866_100381083 226
865 3300005718 Ga0068866_10075551 Ga0068866_100755511 226
866 3300005718 Ga0068866_10420916 Ga0068866_104209162 226
867 3300005719 Ga0068861_100000174 Ga0068861_10000017430 226
868 3300005719 Ga0068861_100093585 Ga0068861_1000935853 226
869 3300005719 Ga0068861_100146639 Ga0068861_1001466393 226
870 3300005719 Ga0068861_101055135 Ga0068861_1010551351 226
871 3300005834 Ga0068851_10035164 Ga0068851_100351643 226
872 3300005834 Ga0068851_10107312 Ga0068851_101073122 226
873 3300005840 Ga0068870_10052764 Ga0068870_100527642 226
874 3300005841 Ga0068863_100008572 Ga0068863_10000857211 226
875 3300005841 Ga0068863_100009619 Ga0068863_1000096197 226
876 3300005841 Ga0068863_100018768 Ga0068863_1000187684 226
877 3300005841 Ga0068863_100032857 Ga0068863_1000328575 226
878 3300005841 Ga0068863_100038901 Ga0068863_1000389012 226
879 3300005841 Ga0068863_100472417 Ga0068863_1004724172 226
880 3300005842 Ga0068858_100001175 Ga0068858_10000117519 226
881 3300005842 Ga0068858_100001436 Ga0068858_1000014369 226
882 3300005842 Ga0068858_100020686 Ga0068858_1000206867 226
883 3300005842 Ga0068858_100020943 Ga0068858_1000209431 226
884 3300005842 Ga0068858_100062472 Ga0068858_1000624724 226
885 3300005843 Ga0068860_100003357 Ga0068860_1000033574 226
886 3300005843 Ga0068860_100007229 Ga0068860_1000072298 226
887 3300005843 Ga0068860_100008755 Ga0068860_10000875510 226
888 3300005843 Ga0068860_100016409 Ga0068860_1000164094 226
889 3300005843 Ga0068860_100089325 Ga0068860_1000893252 226
890 3300005843 Ga0068860_100116750 Ga0068860_1001167503 226
891 3300005844 Ga0068862_100001250 Ga0068862_10000125016 226
892 3300005844 Ga0068862_100010033 Ga0068862_1000100338 226
893 3300005844 Ga0068862_100011431 Ga0068862_1000114313 226
894 3300005844 Ga0068862_100059052 Ga0068862_1000590525 226
895 3300005844 Ga0068862_100135387 Ga0068862_1001353871 226
896 3300005985 Ga0081539_10045417 Ga0081539_100454173 226
897 3300006028 Ga0070717_10003812 Ga0070717_1000381212 226
898 3300006237 Ga0097621_100070742 Ga0097621_1000707423 226
899 3300006358 Ga0068871_100007119 Ga0068871_1000071194 226
900 3300006852 Ga0075433_10023458 Ga0075433_100234585 226
901 3300006871 Ga0075434_100850865 Ga0075434_1008508651 226
902 3300006881 Ga0068865_100008988 Ga0068865_1000089887 226
903 3300006881 Ga0068865_100071820 Ga0068865_1000718202 226
904 3300006931 Ga0097620_100000464 Ga0097620_1000004643 226
905 3300006931 Ga0097620_100000676 Ga0097620_10000067629 226
906 3300006931 Ga0097620_100006502 Ga0097620_1000065026 226
907 3300006931 Ga0097620_100021966 Ga0097620_1000219664 226
908 3300006931 Ga0097620_100038532 Ga0097620_1000385322 226
909 3300006931 Ga0097620_100145055 Ga0097620_1001450553 226
910 3300009092 Ga0105250_10044635 Ga0105250_100446353 226
911 3300009092 Ga0105250_10224127 Ga0105250_102241271 226
912 3300009093 Ga0105240_10137598 Ga0105240_101375984 226
913 3300009098 Ga0105245_10000128 Ga0105245_1000012857 226
914 3300009101 Ga0105247_10000055 Ga0105247_1000005530 226
915 3300009148 Ga0105243_10271306 Ga0105243_102713062 226
916 3300009148 Ga0105243_10383270 Ga0105243_103832702 226
917 3300009174 Ga0105241_10043824 Ga0105241_100438244 226
918 3300009174 Ga0105241_10101340 Ga0105241_101013402 226
919 3300009177 Ga0105248_10000308 Ga0105248_1000030840 226
920 3300009177 Ga0105248_10000787 Ga0105248_1000078710 226
921 3300009177 Ga0105248_10001839 Ga0105248_1000183924 226
922 3300009177 Ga0105248_10034069 Ga0105248_100340694 226
923 3300009177 Ga0105248_10538745 Ga0105248_105387452 226
924 3300009177 Ga0105248_10569546 Ga0105248_105695463 226
925 3300009551 Ga0105238_10012788 Ga0105238_100127889 226
926 3300009551 Ga0105238_10043173 Ga0105238_100431733 226
927 3300009551 Ga0105238_10080147 Ga0105238_100801474 226
928 3300009551 Ga0105238_10087741 Ga0105238_100877413 226
929 3300009553 Ga0105249_10009746 Ga0105249_100097463 226
930 3300009553 Ga0105249_10025831 Ga0105249_100258317 226
931 3300009553 Ga0105249_10079425 Ga0105249_100794254 226
932 3300009553 Ga0105249_10120229 Ga0105249_101202294 226
933 3300010375 Ga0105239_10646034 Ga0105239_106460342 226
934 3300011119 Ga0105246_10023623 Ga0105246_100236234 226
935 3300013100 Ga0157373_10001744 Ga0157373_100017445 226
936 3300013100 Ga0157373_10080132 Ga0157373_100801322 226
937 3300013100 Ga0157373_10203535 Ga0157373_102035352 226
938 3300013100 Ga0157373_10257693 Ga0157373_102576932 226
939 3300013102 Ga0157371_10000850 Ga0157371_100008503 226
940 3300013102 Ga0157371_10002283 Ga0157371_1000228321 226
941 3300013102 Ga0157371_10100881 Ga0157371_101008812 226
942 3300013102 Ga0157371_10144554 Ga0157371_101445543 226
943 3300013104 Ga0157370_10028289 Ga0157370_100282895 226
944 3300013104 Ga0157370_10253095 Ga0157370_102530952 226
945 3300013104 Ga0157370_10408614 Ga0157370_104086142 226
946 3300013105 Ga0157369_10002894 Ga0157369_100028946 226
947 3300013105 Ga0157369_10052864 Ga0157369_100528645 226
948 3300013105 Ga0157369_10055618 Ga0157369_100556186 226
949 3300013296 Ga0157374_10356950 Ga0157374_103569502 226
950 3300013297 Ga0157378_10000396 Ga0157378_1000039644 226
951 3300013297 Ga0157378_10125238 Ga0157378_101252382 226
952 3300013306 Ga0163162_10018653 Ga0163162_100186538 226
953 3300013306 Ga0163162_10462220 Ga0163162_104622202 226
954 3300013307 Ga0157372_10009481 Ga0157372_1000948110 226
955 3300013307 Ga0157372_10101395 Ga0157372_101013955 226
956 3300013307 Ga0157372_11163686 Ga0157372_111636862 226
957 3300013308 Ga0157375_10108703 Ga0157375_101087035 226
958 3300013308 Ga0157375_10186967 Ga0157375_101869672 226
959 3300014325 Ga0163163_10000139 Ga0163163_1000013949 226
960 3300014325 Ga0163163_10040890 Ga0163163_100408904 226
961 3300014325 Ga0163163_10397400 Ga0163163_103974002 226
962 3300014745 Ga0157377_10011952 Ga0157377_100119524 226
963 3300014968 Ga0157379_10030794 Ga0157379_100307943 226
964 3300014968 Ga0157379_10048511 Ga0157379_100485113 226
965 3300014968 Ga0157379_10075203 Ga0157379_100752034 226
966 3300025315 Ga0207697_10000461 Ga0207697_1000046113 226
967 3300025315 Ga0207697_10221490 Ga0207697_102214902 226
968 3300025321 Ga0207656_10021230 Ga0207656_100212304 226
969 3300025321 Ga0207656_10034371 Ga0207656_100343712 226
970 3300025321 Ga0207656_10093132 Ga0207656_100931322 226
971 3300025899 Ga0207642_10013751 Ga0207642_100137515 226
972 3300025899 Ga0207642_10021942 Ga0207642_100219425 226
973 3300025900 Ga0207710_10000398 Ga0207710_100003985 226
974 3300025901 Ga0207688_10000063 Ga0207688_1000006329 226
975 3300025901 Ga0207688_10022773 Ga0207688_100227734 226
976 3300025903 Ga0207680_10000896 Ga0207680_100008966 226
977 3300025904 Ga0207647_10000227 Ga0207647_1000022717 226
978 3300025904 Ga0207647_10009693 Ga0207647_100096938 226
979 3300025904 Ga0207647_10015314 Ga0207647_100153143 226
980 3300025904 Ga0207647_10026559 Ga0207647_100265592 226
981 3300025904 Ga0207647_10028513 Ga0207647_100285132 226
982 3300025907 Ga0207645_10034882 Ga0207645_100348823 226
983 3300025907 Ga0207645_10051985 Ga0207645_100519853 226
984 3300025907 Ga0207645_10304067 Ga0207645_103040672 226
985 3300025908 Ga0207643_10060979 Ga0207643_100609792 226
986 3300025909 Ga0207705_10003269 Ga0207705_1000326913 226
987 3300025909 Ga0207705_10012840 Ga0207705_100128407 226
988 3300025909 Ga0207705_10024261 Ga0207705_100242613 226
989 3300025909 Ga0207705_10066043 Ga0207705_100660432 226
990 3300025909 Ga0207705_10268916 Ga0207705_102689162 226
991 3300025909 Ga0207705_10300388 Ga0207705_103003881 226
992 3300025911 Ga0207654_10036098 Ga0207654_100360983 226
993 3300025911 Ga0207654_10050615 Ga0207654_100506153 226
994 3300025917 Ga0207660_10112479 Ga0207660_101124793 226
995 3300025918 Ga0207662_10097497 Ga0207662_100974973 226
996 3300025918 Ga0207662_10103494 Ga0207662_101034943 226
997 3300025919 Ga0207657_10002137 Ga0207657_1000213710 226
998 3300025919 Ga0207657_10002530 Ga0207657_1000253016 226
999 3300025919 Ga0207657_10004049 Ga0207657_1000404920 226
1000 3300025919 Ga0207657_10004324 Ga0207657_100043246 226
1001 3300025919 Ga0207657_10032620 Ga0207657_100326203 226
1002 3300025919 Ga0207657_10084970 Ga0207657_100849702 226
1003 3300025919 Ga0207657_10174856 Ga0207657_101748562 226
1004 3300025919 Ga0207657_10221221 Ga0207657_102212213 226
1005 3300025919 Ga0207657_10421477 Ga0207657_104214771 226
1006 3300025920 Ga0207649_10040348 Ga0207649_100403482 226
1007 3300025920 Ga0207649_10104019 Ga0207649_101040192 226
1008 3300025920 Ga0207649_10134951 Ga0207649_101349513 226
1009 3300025920 Ga0207649_10375036 Ga0207649_103750362 226
1010 3300025921 Ga0207652_10405789 Ga0207652_104057892 226
1011 3300025923 Ga0207681_10012950 Ga0207681_100129503 226
1012 3300025923 Ga0207681_10171787 Ga0207681_101717872 226
1013 3300025924 Ga0207694_10049653 Ga0207694_100496533 226
1014 3300025924 Ga0207694_10099061 Ga0207694_100990613 226
1015 3300025925 Ga0207650_10105537 Ga0207650_101055373 226
1016 3300025925 Ga0207650_10112317 Ga0207650_101123171 226
1017 3300025926 Ga0207659_10279827 Ga0207659_102798273 226
1018 3300025927 Ga0207687_10003689 Ga0207687_100036892 226
1019 3300025928 Ga0207700_10030459 Ga0207700_100304595 226
1020 3300025931 Ga0207644_10003590 Ga0207644_100035903 226
1021 3300025931 Ga0207644_10004269 Ga0207644_100042697 226
1022 3300025931 Ga0207644_10011336 Ga0207644_100113363 226
1023 3300025931 Ga0207644_10013462 Ga0207644_100134626 226
1024 3300025931 Ga0207644_10023258 Ga0207644_100232586 226
1025 3300025931 Ga0207644_10041305 Ga0207644_100413053 226
1026 3300025932 Ga0207690_10007462 Ga0207690_100074628 226
1027 3300025932 Ga0207690_10147159 Ga0207690_101471592 226
1028 3300025932 Ga0207690_10252156 Ga0207690_102521561 226
1029 3300025932 Ga0207690_10728161 Ga0207690_107281612 226
1030 3300025933 Ga0207706_10000648 Ga0207706_1000064835 226
1031 3300025933 Ga0207706_10023147 Ga0207706_100231475 226
1032 3300025933 Ga0207706_10237305 Ga0207706_102373053 226
1033 3300025933 Ga0207706_10282701 Ga0207706_102827012 226
1034 3300025933 Ga0207706_10658674 Ga0207706_106586741 226
1035 3300025935 Ga0207709_10181886 Ga0207709_101818862 226
1036 3300025935 Ga0207709_10560229 Ga0207709_105602291 226
1037 3300025936 Ga0207670_10021925 Ga0207670_100219255 226
1038 3300025937 Ga0207669_10030429 Ga0207669_100304292 226
1039 3300025937 Ga0207669_10109044 Ga0207669_101090441 226
1040 3300025940 Ga0207691_10000447 Ga0207691_1000044717 226
1041 3300025940 Ga0207691_10057936 Ga0207691_100579363 226
1042 3300025940 Ga0207691_10096495 Ga0207691_100964954 226
1043 3300025940 Ga0207691_10096645 Ga0207691_100966453 226
1044 3300025940 Ga0207691_10214503 Ga0207691_102145032 226
1045 3300025941 Ga0207711_10000258 Ga0207711_1000025849 226
1046 3300025941 Ga0207711_10001621 Ga0207711_100016219 226
1047 3300025941 Ga0207711_10040709 Ga0207711_100407094 226
1048 3300025941 Ga0207711_10049612 Ga0207711_100496123 226
1049 3300025941 Ga0207711_10365827 Ga0207711_103658272 226
1050 3300025942 Ga0207689_10001047 Ga0207689_1000104716 226
1051 3300025942 Ga0207689_10246172 Ga0207689_102461722 226
1052 3300025945 Ga0207679_10106878 Ga0207679_101068782 226
1053 3300025945 Ga0207679_10366182 Ga0207679_103661822 226
1054 3300025949 Ga0207667_10000007 Ga0207667_10000007310 226
1055 3300025949 Ga0207667_10018013 Ga0207667_100180135 226
1056 3300025949 Ga0207667_10058979 Ga0207667_100589795 226
1057 3300025949 Ga0207667_10064850 Ga0207667_100648503 226
1058 3300025960 Ga0207651_10000629 Ga0207651_1000062917 226
1059 3300025960 Ga0207651_10013037 Ga0207651_100130375 226
1060 3300025960 Ga0207651_10030204 Ga0207651_100302044 226
1061 3300025961 Ga0207712_10021608 Ga0207712_100216083 226
1062 3300025961 Ga0207712_10082985 Ga0207712_100829851 226
1063 3300025961 Ga0207712_10142101 Ga0207712_101421012 226
1064 3300025972 Ga0207668_10001078 Ga0207668_100010783 226
1065 3300025972 Ga0207668_10184993 Ga0207668_101849932 226
1066 3300025972 Ga0207668_10278130 Ga0207668_102781302 226
1067 3300025981 Ga0207640_10031952 Ga0207640_100319524 226
1068 3300025981 Ga0207640_10113439 Ga0207640_101134392 226
1069 3300025981 Ga0207640_10196162 Ga0207640_101961622 226
1070 3300025981 Ga0207640_10204441 Ga0207640_102044412 226
1071 3300025986 Ga0207658_10001325 Ga0207658_1000132519 226
1072 3300025986 Ga0207658_10003447 Ga0207658_100034474 226
1073 3300025986 Ga0207658_10005642 Ga0207658_100056426 226
1074 3300025986 Ga0207658_10019684 Ga0207658_100196846 226
1075 3300025986 Ga0207658_10032573 Ga0207658_100325734 226
1076 3300025986 Ga0207658_10036949 Ga0207658_100369494 226
1077 3300025986 Ga0207658_10125618 Ga0207658_101256183 226
1078 3300026023 Ga0207677_10016567 Ga0207677_100165675 226
1079 3300026023 Ga0207677_10054950 Ga0207677_100549504 226
1080 3300026023 Ga0207677_10287758 Ga0207677_102877582 226
1081 3300026035 Ga0207703_10003448 Ga0207703_100034484 226
1082 3300026035 Ga0207703_10003807 Ga0207703_100038078 226
1083 3300026035 Ga0207703_10004976 Ga0207703_100049768 226
1084 3300026035 Ga0207703_10010957 Ga0207703_100109574 226
1085 3300026035 Ga0207703_10038709 Ga0207703_100387094 226
1086 3300026041 Ga0207639_10059445 Ga0207639_100594454 226
1087 3300026041 Ga0207639_10249297 Ga0207639_102492972 226
1088 3300026067 Ga0207678_10018775 Ga0207678_100187756 226
1089 3300026067 Ga0207678_10018808 Ga0207678_100188084 226
1090 3300026067 Ga0207678_10072753 Ga0207678_100727532 226
1091 3300026067 Ga0207678_10116168 Ga0207678_101161683 226
1092 3300026067 Ga0207678_10165968 Ga0207678_101659683 226
1093 3300026067 Ga0207678_10625393 Ga0207678_106253932 226
1094 3300026078 Ga0207702_10077157 Ga0207702_100771574 226
1095 3300026078 Ga0207702_10078359 Ga0207702_100783591 226
1096 3300026088 Ga0207641_10000621 Ga0207641_1000062123 226
1097 3300026088 Ga0207641_10002559 Ga0207641_100025594 226
1098 3300026088 Ga0207641_10007838 Ga0207641_100078387 226
1099 3300026088 Ga0207641_10012445 Ga0207641_100124453 226
1100 3300026088 Ga0207641_10039969 Ga0207641_100399695 226
1101 3300026088 Ga0207641_10050897 Ga0207641_100508974 226
1102 3300026088 Ga0207641_10469539 Ga0207641_104695392 226
1103 3300026089 Ga0207648_10000876 Ga0207648_100008766 226
1104 3300026089 Ga0207648_10001177 Ga0207648_1000117712 226
1105 3300026089 Ga0207648_10056432 Ga0207648_100564324 226
1106 3300026089 Ga0207648_10347111 Ga0207648_103471112 226
1107 3300026095 Ga0207676_10000220 Ga0207676_1000022052 226
1108 3300026095 Ga0207676_10003623 Ga0207676_100036234 226
1109 3300026095 Ga0207676_10006555 Ga0207676_100065555 226
1110 3300026116 Ga0207674_10001201 Ga0207674_1000120117 226
1111 3300026116 Ga0207674_10009817 Ga0207674_100098177 226
1112 3300026116 Ga0207674_10010441 Ga0207674_100104414 226
1113 3300026116 Ga0207674_10018416 Ga0207674_100184163 226
1114 3300026116 Ga0207674_10274287 Ga0207674_102742873 226
1115 3300026118 Ga0207675_100000459 Ga0207675_10000045929 226
1116 3300026118 Ga0207675_100058275 Ga0207675_1000582753 226
1117 3300026118 Ga0207675_100171169 Ga0207675_1001711691 226
1118 3300026118 Ga0207675_100211920 Ga0207675_1002119202 226
1119 3300026121 Ga0207683_10073117 Ga0207683_100731172 226
1120 3300026121 Ga0207683_10110020 Ga0207683_101100203 226
1121 3300026142 Ga0207698_10083853 Ga0207698_100838532 226
1122 3300026142 Ga0207698_10102932 Ga0207698_101029323 226
1123 3300026142 Ga0207698_10113805 Ga0207698_101138052 226
1124 3300028379 Ga0268266_10081081 Ga0268266_100810813 226
1125 3300028379 Ga0268266_10391809 Ga0268266_103918092 226
1126 3300028379 Ga0268266_10520336 Ga0268266_105203362 226
1127 3300028379 Ga0268266_10537731 Ga0268266_105377311 226
1128 3300028380 Ga0268265_10002320 Ga0268265_100023204 226
1129 3300028380 Ga0268265_10007997 Ga0268265_100079973 226
1130 3300028380 Ga0268265_10008738 Ga0268265_100087387 226
1131 3300028380 Ga0268265_10121031 Ga0268265_101210313 226
1132 3300028380 Ga0268265_10157964 Ga0268265_101579642 226
1133 3300028380 Ga0268265_10446049 Ga0268265_104460492 226
1134 3300028380 Ga0268265_10496211 Ga0268265_104962111 226
1135 3300028381 Ga0268264_10003780 Ga0268264_100037804 226
1136 3300028381 Ga0268264_10007833 Ga0268264_100078337 226
1137 3300028381 Ga0268264_10032074 Ga0268264_100320743 226
1138 3300028381 Ga0268264_10036795 Ga0268264_100367955 226
1139 3300028381 Ga0268264_10105546 Ga0268264_101055463 226
1140 3300028794 Ga0307515_10513784 Ga0307515_105137841 226
1141 3300031548 Ga0307408_100029127 Ga0307408_1000291273 226
1142 3300031901 Ga0307406_10033256 Ga0307406_100332564 226
1143 3300035691 Ga0373931_0068977 Ga0373931_0068977_733_1413 226
1144 3300037312 Ga0395899_0000244 Ga0395899_0000244_10363_11064 226
1145 3300037312 Ga0395899_0000795 Ga0395899_0000795_10086_10775 226
1146 3300037312 Ga0395899_0015242 Ga0395899_0015242_433_1116 226
1147 3300037312 Ga0395899_0064874 Ga0395899_0064874_36_725 226
1148 3300037312 Ga0395899_0095627 Ga0395899_0095627_1045_1734 226
1149 3300037312 Ga0395899_0122289 Ga0395899_0122289_895_1578 226
1150 3300037312 Ga0395899_0164360 Ga0395899_0164360_754_1443 226
1151 3300037312 Ga0395899_0268041 Ga0395899_0268041_168_857 226
1152 3300037312 Ga0395899_0548212 Ga0395899_0548212_44_727 226
1153 3300037418 Ga0395900_0001277 Ga0395900_0001277_22448_23131 226
1154 3300037418 Ga0395900_0004242 Ga0395900_0004242_3114_3815 226
1155 3300037418 Ga0395900_0010411 Ga0395900_0010411_7900_8589 226
1156 3300037418 Ga0395900_0013700 Ga0395900_0013700_5270_5953 226
1157 3300037418 Ga0395900_0015280 Ga0395900_0015280_5741_6427 226
1158 3300037418 Ga0395900_0030421 Ga0395900_0030421_2068_2757 226
1159 3300037418 Ga0395900_0063753 Ga0395900_0063753_2062_2745 226
1160 3300037418 Ga0395900_0067684 Ga0395900_0067684_353_1042 226
1161 3300037418 Ga0395900_0080725 Ga0395900_0080725_1917_2600 226
1162 3300037418 Ga0395900_0126255 Ga0395900_0126255_276_965 226
1163 3300037418 Ga0395900_0154897 Ga0395900_0154897_1641_2324 226
1164 3300037418 Ga0395900_0170559 Ga0395900_0170559_938_1627 226
1165 3300037418 Ga0395900_0185334 Ga0395900_0185334_1401_2084 226
1166 3300037418 Ga0395900_0274796 Ga0395900_0274796_979_1662 226
1167 3300037418 Ga0395900_0287704 Ga0395900_0287704_725_1411 226
1168 3300037466 Ga0395898_0007414 Ga0395898_0007414_5573_6262 226
1169 3300037466 Ga0395898_0012270 Ga0395898_0012270_4307_4990 226
1170 3300037466 Ga0395898_0047882 Ga0395898_0047882_523_1224 226
1171 3300037466 Ga0395898_0094451 Ga0395898_0094451_1496_2179 226
1172 3300037466 Ga0395898_0112020 Ga0395898_0112020_209_892 226
1173 3300037466 Ga0395898_0135657 Ga0395898_0135657_210_893 226
1174 3300037466 Ga0395898_0217380 Ga0395898_0217380_1115_1798 226
1175 3300037471 Ga0395905_0000187 Ga0395905_0000187_32672_33352 226
1176 3300037471 Ga0395905_0001453 Ga0395905_0001453_20438_21121 226
1177 3300037471 Ga0395905_0006652 Ga0395905_0006652_5681_6370 226
1178 3300037471 Ga0395905_0017626 Ga0395905_0017626_1252_1941 226
1179 3300037471 Ga0395905_0052594 Ga0395905_0052594_471_1154 226
1180 3300037471 Ga0395905_0060318 Ga0395905_0060318_1786_2475 226
1181 3300037471 Ga0395905_0084961 Ga0395905_0084961_2109_2792 226
1182 3300037471 Ga0395905_0087545 Ga0395905_0087545_1395_2078 226
1183 3300037471 Ga0395905_0108263 Ga0395905_0108263_788_1477 226
1184 3300037471 Ga0395905_0120964 Ga0395905_0120964_1381_2070 226
1185 3300037471 Ga0395905_0122208 Ga0395905_0122208_668_1351 226
1186 3300037471 Ga0395905_0165079 Ga0395905_0165079_277_978 226
1187 3300037471 Ga0395905_0317405 Ga0395905_0317405_17_700 226
1188 3300037471 Ga0395905_0347146 Ga0395905_0347146_77_760 226
1189 3300037471 Ga0395905_0599897 Ga0395905_0599897_186_869 226
1190 3300037471 Ga0395905_0654459 Ga0395905_0654459_191_880 226
1191 3300037471 Ga0395905_0671733 Ga0395905_0671733_203_892 226
1192 3300038443 Ga0395901_0000206 Ga0395901_0000206_11399_12100 226
1193 3300038443 Ga0395901_0003851 Ga0395901_0003851_2330_3019 226
1194 3300038443 Ga0395901_0053503 Ga0395901_0053503_2963_3646 226
1195 3300038443 Ga0395901_0085375 Ga0395901_0085375_331_1020 226
1196 3300038443 Ga0395901_0105230 Ga0395901_0105230_1000_1683 226
1197 3300038443 Ga0395901_0106461 Ga0395901_0106461_1720_2403 226
1198 3300038443 Ga0395901_0113070 Ga0395901_0113070_351_1037 226
1199 3300038443 Ga0395901_0330008 Ga0395901_0330008_205_894 226
1200 3300038443 Ga0395901_0407939 Ga0395901_0407939_488_1171 226
1201 3300038443 Ga0395901_0415494 Ga0395901_0415494_662_1348 226
1202 3300038443 Ga0395901_0605667 Ga0395901_0605667_198_887 226
1203 3300038443 Ga0395901_0700984 Ga0395901_0700984_47_727 226
1204 3300042005 Ga0439448_0011180 Ga0439448_0011180_1441_2130 226
1205 3300042012 Ga0439455_0012112 Ga0439455_0012112_340_1029 226
1206 3300042157 Ga0439458_0000057 Ga0439458_0000057_16452_17135 226
1207 3300042157 Ga0439458_0068607 Ga0439458_0068607_195_878 226
1208 3300044656 Ga0466969_0045410 Ga0466969_0045410_805_1494 226
1209 3300044684 Ga0466966_0020392 Ga0466966_0020392_1787_2476 226
1210 3300044693 Ga0466961_0013089 Ga0466961_0013089_657_1346 226
1211 3300044719 Ga0466971_0003394 Ga0466971_0003394_4150_4839 226
1212 3300044765 Ga0466970_0009032 Ga0466970_0009032_1621_2310 226
1213 3300044842 Ga0466957_0002661 Ga0466957_0002661_8682_9371 226
1214 3300045049 Ga0466959_0004349 Ga0466959_0004349_8099_8788 226
1215 3300045836 Ga0466958_0000529 Ga0466958_0000529_3135_3824 226
1216 3300045976 Ga0466967_0001609 Ga0466967_0001609_10091_10780 226
1217 3300045976 Ga0466967_0025868 Ga0466967_0025868_1556_2239 226
1218 3300045976 Ga0466967_0116317 Ga0466967_0116317_877_1560 226
1219 3300046616 Ga0495668_0010619 Ga0495668_0010619_2315_3004 226
1220 3300046664 Ga0495659_0096821 Ga0495659_0096821_234_923 226
1221 3300046684 Ga0495669_0034689 Ga0495669_0034689_478_1167 226
1222 3300046684 Ga0495669_0040989 Ga0495669_0040989_384_1073 226
1223 3300048903 Ga0496100_0203122 Ga0496100_0203122_415_1104 226
1224 3300048909 Ga0496106_0617667 Ga0496106_0617667_148_837 226
1225 3300048910 Ga0496107_0078224 Ga0496107_0078224_477_1166 226
1226 3300048910 Ga0496107_0174707 Ga0496107_0174707_26_715 226
1227 3300048910 Ga0496107_0310313 Ga0496107_0310313_173_862 226
1228 3300048911 Ga0496108_0054953 Ga0496108_0054953_2258_2953 226
1229 3300048911 Ga0496108_0189288 Ga0496108_0189288_1021_1710 226
1230 3300048912 Ga0496109_0324959 Ga0496109_0324959_637_1317 226
1231 3300048914 Ga0496111_0467169 Ga0496111_0467169_199_879 226
1232 3300048915 Ga0496112_0118784 Ga0496112_0118784_16_696 226
1233 3300048915 Ga0496112_0704937 Ga0496112_0704937_187_876 226
1234 3300048916 Ga0496113_0022406 Ga0496113_0022406_497_1192 226
1235 3300048917 Ga0496114_0000029 Ga0496114_0000029_127252_127932 226
1236 3300048921 Ga0496118_0161942 Ga0496118_0161942_565_1254 226
1237 3300048924 Ga0496121_0002260 Ga0496121_0002260_25072_25761 226
1238 3300048928 Ga0496125_0026168 Ga0496125_0026168_4225_4914 226
1239 3300049583 Ga0501067_0338909 Ga0501067_0338909_109_798 226
1240 3300050493 nmdc:mga0k408_254100_c1 nmdc:mga0k408_254100_c1_46_729 226
1241 3300050515 nmdc:mga0a205_23681_c1 nmdc:mga0a205_23681_c1_3242_3931 226
1242 3300053134 Ga0500658_0000164 Ga0500658_0000164_5191_5880 226
1243 3300059491 Ga0587070_006619 Ga0587070_006619_825_1508 226
1244 3300059492 Ga0587073_0062251 Ga0587073_0062251_132_815 226
1245 3300059493 Ga0587077_035007 Ga0587077_035007_71_754 226
1246 3300059652 Ga0587107_023864 Ga0587107_023864_130_813 226
1247 3300059655 Ga0587114_030157 Ga0587114_030157_64_747 226
1248 3300061719 Ga0466962_0016329 Ga0466962_0016329_873_1562 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

47

113

0.95

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

158

221

0.93

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

40

104

0.93

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

47

105

0.92

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

143

230

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lq7-assembly1.cif.gz_B crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9772 9 216
3lq7-assembly1.cif.gz_A crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9689 9 216
2ycd-assembly1.cif.gz_A-2 structure of a novel glutathione transferase from agrobacterium tumefaciens. 0.9618 6 215
3lq7-assembly1.cif.gz_B crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.953 9 216
3lq7-assembly1.cif.gz_A crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9502 9 216
ID Description Score Start End Superfamily
3lq7B02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9731 92 206 1.20.1050.10
2ycdA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9701 92 206 1.20.1050.10
3lq7C02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9593 92 206 1.20.1050.10
3lq7B02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9489 92 206 1.20.1050.10
2ycdA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.946 92 206 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A346N4Z6-F1-model_v4 Glutathione S-transferase family protein 0.9916 1 213 GO:0016740
AF-A0A418WA53-F1-model_v4 Glutathione S-transferase family protein 0.9908 9 214 GO:0016740
AF-S4XUW6-F1-model_v4 Glutathione S-transferase 0.9892 25 216
AF-A0A519KRG8-F1-model_v4 Glutathione S-transferase family protein 0.989 9 206 GO:0016740
AF-A0A4Q3SVI5-F1-model_v4 Glutathione S-transferase family protein 0.9864 9 194 GO:0016740

Feature Viewer

pLDDT pTM Quality
95.66 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map