F492040
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1236 | 465 | 1036 | 108 |
Family's Representative Sequence
| Representative Sequence | 3300046463|Ga0495653_0001863|Ga0495653_0001863_5233_5616 |
| Length | 127 |
| Sequence | MSTTTPRQAIALSYDRQNAPTLTAKGDDELAEAILAVAREYEVPIYENAELVKMLARLELGDSIPEELYRTIAVIIAFAWRLQGKRPADFVEPQPGPEKDVTPVGGLLGSAKGQGQARPRSTTPGDH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 4 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 5 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 6 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 7 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 8 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 9 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 10 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 11 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 12 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 13 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 14 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 15 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 16 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 17 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 18 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 19 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 20 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 21 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 22 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 23 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 24 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 25 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 26 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 27 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 28 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 29 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 30 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 31 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 32 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 33 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 34 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 35 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 36 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 37 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 38 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 39 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 40 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 41 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 42 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 43 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 44 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 45 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 46 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 47 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 48 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 49 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 50 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 51 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 52 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 53 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 54 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 55 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 56 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 57 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 58 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 59 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 60 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 61 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 62 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 63 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 64 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 65 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 66 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 67 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 68 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 69 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 70 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 71 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 72 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 73 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 74 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 75 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 76 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 77 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 78 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 79 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 80 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 81 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 82 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 83 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 84 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 85 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 86 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 87 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 88 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 89 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 90 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 91 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 92 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 93 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 94 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 95 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 96 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 97 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 98 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 99 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 100 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 101 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 102 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 103 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 104 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 105 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 106 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 107 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 108 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 109 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 110 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 111 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 112 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 113 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 114 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 115 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 116 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 117 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 118 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 119 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 120 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 121 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 122 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 123 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 124 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 125 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 126 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 127 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 128 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 129 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 130 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 131 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 132 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 133 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 134 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 135 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 136 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 137 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 138 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 139 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 140 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 141 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 142 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 143 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 144 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 145 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 146 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 147 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 148 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 149 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 150 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 151 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 152 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 153 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 154 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 155 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 156 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 157 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 158 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 159 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 160 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 161 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 162 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 163 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 164 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 165 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 166 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 167 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 168 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 169 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 170 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 171 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 172 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 173 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 174 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 175 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 176 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 177 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 178 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 179 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 180 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 181 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 182 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 183 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 184 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 185 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 186 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 187 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 188 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 189 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 190 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 191 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 192 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 193 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 194 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 195 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 196 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 197 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 198 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 203 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 205 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 206 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 207 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 208 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 209 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 210 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 211 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 212 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 213 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 214 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 215 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 216 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 217 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 218 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 219 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 220 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 221 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 222 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 223 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 224 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 225 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 226 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 227 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 228 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 229 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 230 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 231 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 232 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 233 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 234 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 235 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 236 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 237 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 238 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 241 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 242 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 243 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 244 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 245 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 246 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 247 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 248 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 250 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 251 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 253 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 254 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 255 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 256 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 273 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 281 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 283 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 284 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 285 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 286 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 287 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 288 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 289 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 290 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 291 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 292 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 293 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 294 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 295 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 296 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 297 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 298 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 299 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 300 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 301 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 302 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 303 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 304 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 305 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 306 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 307 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 308 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 309 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 310 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 311 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 312 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 313 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 314 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 315 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 316 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 317 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 318 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 319 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 320 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 321 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 322 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 323 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 324 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 325 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 326 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 327 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 328 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 329 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 330 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 331 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 332 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 333 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 334 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 335 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 336 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 337 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 338 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 339 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 340 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 341 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 413 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 414 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 415 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 416 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 417 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 418 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 419 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 420 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 421 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 422 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 423 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 424 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 425 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 426 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 427 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 428 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 429 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 437 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 438 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 440 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 441 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 442 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 443 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 444 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 445 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 446 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 447 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 448 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 449 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 450 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 451 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 452 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 453 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 454 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 455 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 456 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 457 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 458 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 459 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 460 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 461 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 462 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 463 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 464 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 465 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.06 |
| Metatranscriptomes | 0 |
| Isolates | 15.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.5 |
| Nodule | 1.13 |
| Rhizoplane | 6.15 |
| Rhizosphere | 77.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_746 | 2124908027 | Bacteria | 35830 |
| 2 | SwRhRL2b_contig_936219 | 2162886007 | Bacteria | 5778 |
| 3 | JGI25156J39149_1025463 | 3300002705 | Bacteria | 951 |
| 4 | JGI25162J39368_1000037 | 3300002737 | Bacteria | 179339 |
| 5 | JGI25162J39368_1000212 | 3300002737 | Bacteria | 61036 |
| 6 | JGI25163J39215_1000442 | 3300002771 | Bacteria | 12724 |
| 7 | JGI25163J39215_1000503 | 3300002771 | Bacteria | 11630 |
| 8 | JGI25164J39214_1000020 | 3300002772 | Bacteria | 179339 |
| 9 | JGI25164J39214_1000051 | 3300002772 | Bacteria | 122377 |
| 10 | JGI25165J46597_1000077 | 3300003214 | Bacteria | 179339 |
| 11 | JGI25165J46597_1000091 | 3300003214 | Bacteria | 167941 |
| 12 | rootH1_10334418 | 3300003323 | Bacteria | 1558 |
| 13 | Ga0055538_1000090 | 3300003751 | Bacteria | 78300 |
| 14 | Ga0055539_1000134 | 3300003752 | Bacteria | 78300 |
| 15 | Ga0055533_1000138 | 3300003756 | Bacteria | 78275 |
| 16 | Ga0055532_1000142 | 3300003758 | Bacteria | 69999 |
| 17 | Ga0055525_1000183 | 3300003759 | Bacteria | 78300 |
| 18 | Ga0055536_1000165 | 3300003781 | Bacteria | 56046 |
| 19 | Ga0055536_1000886 | 3300003781 | Bacteria | 19484 |
| 20 | Ga0055534_1047226 | 3300003784 | Bacteria | 619 |
| 21 | Ga0055530_10000158 | 3300003791 | Bacteria | 61440 |
| 22 | Ga0055530_10001115 | 3300003791 | Bacteria | 20999 |
| 23 | Ga0055540_1000182 | 3300003792 | Bacteria | 61440 |
| 24 | Ga0055540_1001167 | 3300003792 | Bacteria | 16310 |
| 25 | Ga0055541_1000089 | 3300003841 | Bacteria | 78275 |
| 26 | Ga0065714_10002255 | 3300005288 | Bacteria | 42568 |
| 27 | Ga0065714_10002585 | 3300005288 | Bacteria | 18890 |
| 28 | Ga0065714_10009355 | 3300005288 | Bacteria | 3078 |
| 29 | Ga0065714_10040982 | 3300005288 | Bacteria | 835 |
| 30 | Ga0065714_10080800 | 3300005288 | Bacteria | 2385 |
| 31 | Ga0065714_10090909 | 3300005288 | Bacteria | 1928 |
| 32 | Ga0065714_10347257 | 3300005288 | Bacteria | 631 |
| 33 | Ga0065704_10070596 | 3300005289 | Bacteria | 19482 |
| 34 | Ga0065704_10114457 | 3300005289 | Bacteria | 1886 |
| 35 | Ga0065704_10520469 | 3300005289 | Bacteria | 654 |
| 36 | Ga0065704_10576452 | 3300005289 | Bacteria | 620 |
| 37 | Ga0065712_10068150 | 3300005290 | Bacteria | 13828 |
| 38 | Ga0065715_10755421 | 3300005293 | Bacteria | 628 |
| 39 | Ga0070670_100001221 | 3300005331 | Bacteria | 20451 |
| 40 | Ga0070670_100053848 | 3300005331 | Bacteria | 3455 |
| 41 | Ga0070661_100000029 | 3300005344 | Bacteria | 117682 |
| 42 | Ga0070669_100000316 | 3300005353 | Bacteria | 37853 |
| 43 | Ga0070662_100016721 | 3300005457 | Bacteria | 4931 |
| 44 | Ga0068853_100008519 | 3300005539 | Bacteria | 8242 |
| 45 | Ga0070664_100000046 | 3300005564 | Bacteria | 74475 |
| 46 | Ga0068851_10000050 | 3300005834 | Bacteria | 72913 |
| 47 | Ga0075364_10231658 | 3300006051 | Bacteria | 1254 |
| 48 | Ga0075364_10324408 | 3300006051 | Bacteria | 1049 |
| 49 | Ga0075364_10514232 | 3300006051 | Bacteria | 818 |
| 50 | Ga0075432_10017532 | 3300006058 | Bacteria | 2442 |
| 51 | Ga0075432_10086986 | 3300006058 | Bacteria | 1140 |
| 52 | Ga0075432_10108892 | 3300006058 | Bacteria | 1031 |
| 53 | Ga0075432_10344045 | 3300006058 | Bacteria | 630 |
| 54 | Ga0075432_10419162 | 3300006058 | Bacteria | 581 |
| 55 | Ga0075362_10098343 | 3300006177 | Bacteria | 1365 |
| 56 | Ga0075362_10397381 | 3300006177 | Bacteria | 695 |
| 57 | Ga0075369_10478098 | 3300006186 | Bacteria | 591 |
| 58 | Ga0075369_10578558 | 3300006186 | Bacteria | 537 |
| 59 | Ga0075370_10932662 | 3300006353 | Bacteria | 531 |
| 60 | Ga0075436_100043124 | 3300006914 | Bacteria | 3110 |
| 61 | Ga0075436_100593592 | 3300006914 | Bacteria | 815 |
| 62 | Ga0075436_101107710 | 3300006914 | Bacteria | 596 |
| 63 | Ga0079104_1000545 | 3300006946 | Bacteria | 39305 |
| 64 | Ga0079104_1000574 | 3300006946 | Bacteria | 37165 |
| 65 | Ga0099826_10002700 | 3300006948 | Bacteria | 11593 |
| 66 | Ga0105251_10000060 | 3300009011 | Bacteria | 102799 |
| 67 | Ga0105251_10000093 | 3300009011 | Bacteria | 86755 |
| 68 | Ga0105251_10002821 | 3300009011 | Bacteria | 13145 |
| 69 | Ga0105251_10009019 | 3300009011 | Bacteria | 5944 |
| 70 | Ga0105251_10011769 | 3300009011 | Bacteria | 4982 |
| 71 | Ga0105251_10045755 | 3300009011 | Bacteria | 2108 |
| 72 | Ga0105251_10142509 | 3300009011 | Bacteria | 1084 |
| 73 | Ga0105251_10175261 | 3300009011 | Bacteria | 966 |
| 74 | Ga0105251_10356462 | 3300009011 | Bacteria | 668 |
| 75 | Ga0105251_10652946 | 3300009011 | Bacteria | 503 |
| 76 | Ga0105244_10000425 | 3300009036 | Bacteria | 39065 |
| 77 | Ga0105244_10006180 | 3300009036 | Bacteria | 7811 |
| 78 | Ga0105244_10009403 | 3300009036 | Bacteria | 6012 |
| 79 | Ga0105244_10013620 | 3300009036 | Bacteria | 4741 |
| 80 | Ga0105244_10014015 | 3300009036 | Bacteria | 4653 |
| 81 | Ga0105244_10022723 | 3300009036 | Bacteria | 3448 |
| 82 | Ga0105244_10024831 | 3300009036 | Bacteria | 3266 |
| 83 | Ga0105244_10041755 | 3300009036 | Bacteria | 2376 |
| 84 | Ga0105244_10044688 | 3300009036 | Bacteria | 2281 |
| 85 | Ga0105244_10204121 | 3300009036 | Bacteria | 931 |
| 86 | Ga0105244_10226688 | 3300009036 | Bacteria | 875 |
| 87 | Ga0105244_10226689 | 3300009036 | Bacteria | 875 |
| 88 | Ga0105250_10000074 | 3300009092 | Bacteria | 91652 |
| 89 | Ga0105250_10000443 | 3300009092 | Bacteria | 29996 |
| 90 | Ga0105250_10006271 | 3300009092 | Bacteria | 5215 |
| 91 | Ga0105250_10006633 | 3300009092 | Bacteria | 5039 |
| 92 | Ga0105250_10050006 | 3300009092 | Bacteria | 1677 |
| 93 | Ga0105250_10093600 | 3300009092 | Bacteria | 1224 |
| 94 | Ga0105243_10000158 | 3300009148 | Bacteria | 77305 |
| 95 | Ga0105243_10000686 | 3300009148 | Bacteria | 33024 |
| 96 | Ga0105243_10074167 | 3300009148 | Bacteria | 2759 |
| 97 | Ga0105243_10343313 | 3300009148 | Bacteria | 1368 |
| 98 | Ga0105242_10000360 | 3300009176 | Bacteria | 36330 |
| 99 | Ga0105242_10517950 | 3300009176 | Bacteria | 1137 |
| 100 | Ga0105248_10321002 | 3300009177 | Bacteria | 1744 |
| 101 | Ga0105237_10001262 | 3300009545 | Bacteria | 33775 |
| 102 | Ga0105237_10189228 | 3300009545 | Bacteria | 2058 |
| 103 | Ga0105238_11390581 | 3300009551 | Bacteria | 729 |
| 104 | Ga0105249_11200704 | 3300009553 | Bacteria | 830 |
| 105 | Ga0105246_10000222 | 3300011119 | Bacteria | 28940 |
| 106 | Ga0105246_10000876 | 3300011119 | Bacteria | 17243 |
| 107 | Ga0105246_10008949 | 3300011119 | Bacteria | 6163 |
| 108 | Ga0105246_10011023 | 3300011119 | Bacteria | 5602 |
| 109 | Ga0157345_1000204 | 3300012498 | Bacteria | 9058 |
| 110 | Ga0157347_1021565 | 3300012502 | Bacteria | 757 |
| 111 | Ga0157373_10005441 | 3300013100 | Bacteria | 9564 |
| 112 | Ga0157373_10012648 | 3300013100 | Bacteria | 6206 |
| 113 | Ga0157373_10018039 | 3300013100 | Bacteria | 5139 |
| 114 | Ga0157373_10018658 | 3300013100 | Bacteria | 5049 |
| 115 | Ga0157373_10020190 | 3300013100 | Bacteria | 4845 |
| 116 | Ga0157373_10022401 | 3300013100 | Bacteria | 4584 |
| 117 | Ga0157371_10000513 | 3300013102 | Bacteria | 46606 |
| 118 | Ga0157371_10000546 | 3300013102 | Bacteria | 44800 |
| 119 | Ga0157371_10006014 | 3300013102 | Bacteria | 10111 |
| 120 | Ga0157371_10010699 | 3300013102 | Bacteria | 7124 |
| 121 | Ga0157371_11452969 | 3300013102 | Bacteria | 534 |
| 122 | Ga0157370_10006411 | 3300013104 | Bacteria | 12978 |
| 123 | Ga0157370_10098872 | 3300013104 | Bacteria | 2735 |
| 124 | Ga0157370_10214040 | 3300013104 | Bacteria | 1785 |
| 125 | Ga0157370_10253639 | 3300013104 | Bacteria | 1627 |
| 126 | Ga0157370_10257479 | 3300013104 | Bacteria | 1613 |
| 127 | Ga0157370_10539341 | 3300013104 | Bacteria | 1070 |
| 128 | Ga0157370_10861112 | 3300013104 | Bacteria | 823 |
| 129 | Ga0157369_10003927 | 3300013105 | Bacteria | 17636 |
| 130 | Ga0157369_10027328 | 3300013105 | Bacteria | 6326 |
| 131 | Ga0157369_10063255 | 3300013105 | Bacteria | 3987 |
| 132 | Ga0157369_10104912 | 3300013105 | Bacteria | 3009 |
| 133 | Ga0157369_10620541 | 3300013105 | Bacteria | 1116 |
| 134 | Ga0157369_10955212 | 3300013105 | Bacteria | 878 |
| 135 | Ga0157369_11069945 | 3300013105 | Bacteria | 825 |
| 136 | Ga0157369_11503589 | 3300013105 | Bacteria | 685 |
| 137 | Ga0157369_11765104 | 3300013105 | Bacteria | 628 |
| 138 | Ga0157369_12427419 | 3300013105 | Bacteria | 531 |
| 139 | Ga0163162_10009243 | 3300013306 | Bacteria | 9589 |
| 140 | Ga0163162_10064941 | 3300013306 | Bacteria | 3696 |
| 141 | Ga0163162_10472413 | 3300013306 | Bacteria | 1385 |
| 142 | Ga0157372_10024791 | 3300013307 | Bacteria | 6518 |
| 143 | Ga0157375_10034168 | 3300013308 | Bacteria | 4841 |
| 144 | Ga0157375_10064541 | 3300013308 | Bacteria | 3646 |
| 145 | Ga0157375_10090283 | 3300013308 | Bacteria | 3122 |
| 146 | Ga0157375_10176459 | 3300013308 | Bacteria | 2286 |
| 147 | Ga0157375_11404586 | 3300013308 | Bacteria | 822 |
| 148 | Ga0182008_10000040 | 3300014497 | Bacteria | 120886 |
| 149 | Ga0182008_10005526 | 3300014497 | Bacteria | 7188 |
| 150 | Ga0182008_10007769 | 3300014497 | Bacteria | 5901 |
| 151 | Ga0182008_10037856 | 3300014497 | Bacteria | 2413 |
| 152 | Ga0182006_1000780 | 3300015261 | Bacteria | 21588 |
| 153 | Ga0182006_1006561 | 3300015261 | Bacteria | 5394 |
| 154 | Ga0182006_1009115 | 3300015261 | Bacteria | 4462 |
| 155 | Ga0182006_1009778 | 3300015261 | Bacteria | 4288 |
| 156 | Ga0182006_1010411 | 3300015261 | Bacteria | 4137 |
| 157 | Ga0182006_1100196 | 3300015261 | Bacteria | 1029 |
| 158 | Ga0182006_1165468 | 3300015261 | Bacteria | 743 |
| 159 | Ga0182006_1192034 | 3300015261 | Bacteria | 678 |
| 160 | Ga0182007_10010626 | 3300015262 | Bacteria | 3626 |
| 161 | Ga0182005_1006110 | 3300015265 | Bacteria | 3710 |
| 162 | Ga0182005_1007572 | 3300015265 | Bacteria | 3250 |
| 163 | Ga0182005_1040982 | 3300015265 | Bacteria | 1259 |
| 164 | Ga0163161_10016933 | 3300017792 | Bacteria | 5096 |
| 165 | Ga0163161_10024761 | 3300017792 | Bacteria | 4243 |
| 166 | Ga0163161_10048839 | 3300017792 | Bacteria | 3056 |
| 167 | Ga0163161_10061578 | 3300017792 | Bacteria | 2732 |
| 168 | Ga0163161_10070786 | 3300017792 | Bacteria | 2551 |
| 169 | Ga0163161_10173224 | 3300017792 | Bacteria | 1651 |
| 170 | Ga0163161_10305602 | 3300017792 | Bacteria | 1254 |
| 171 | Ga0163161_10438064 | 3300017792 | Bacteria | 1054 |
| 172 | Ga0163161_10609746 | 3300017792 | Bacteria | 901 |
| 173 | Ga0163161_10821983 | 3300017792 | Bacteria | 782 |
| 174 | Ga0163161_10951329 | 3300017792 | Bacteria | 731 |
| 175 | Ga0209435_101205 | 3300025206 | Bacteria | 3482 |
| 176 | Ga0209760_100022 | 3300025207 | Bacteria | 159218 |
| 177 | Ga0209760_100053 | 3300025207 | Bacteria | 103438 |
| 178 | Ga0209784_100040 | 3300025224 | Bacteria | 231812 |
| 179 | Ga0209566_100051 | 3300025225 | Bacteria | 231920 |
| 180 | Ga0209674_100072 | 3300025226 | Bacteria | 231812 |
| 181 | Ga0209147_100067 | 3300025229 | Bacteria | 231812 |
| 182 | Ga0209563_100073 | 3300025230 | Bacteria | 231920 |
| 183 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 184 | Ga0207427_100047 | 3300025231 | Bacteria | 240409 |
| 185 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 186 | Ga0209437_100009 | 3300025233 | Bacteria | 915954 |
| 187 | Ga0209258_100490 | 3300025242 | Bacteria | 40292 |
| 188 | Ga0209646_1000383 | 3300025246 | Bacteria | 28428 |
| 189 | Ga0209677_100121 | 3300025253 | Bacteria | 80378 |
| 190 | Ga0209759_1004999 | 3300025256 | Bacteria | 4773 |
| 191 | Ga0209759_1038855 | 3300025256 | Bacteria | 842 |
| 192 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 193 | Ga0209233_1000032 | 3300025261 | Bacteria | 623596 |
| 194 | Ga0209130_1022427 | 3300025284 | Bacteria | 1409 |
| 195 | Ga0209675_1002532 | 3300025291 | Bacteria | 9297 |
| 196 | Ga0209676_1000016 | 3300025292 | Bacteria | 655561 |
| 197 | Ga0209676_1000021 | 3300025292 | Bacteria | 609534 |
| 198 | Ga0209676_1000033 | 3300025292 | Bacteria | 463236 |
| 199 | Ga0209676_1022616 | 3300025292 | Bacteria | 2078 |
| 200 | Ga0209050_1000009 | 3300025298 | Bacteria | 1047265 |
| 201 | Ga0209050_1000036 | 3300025298 | Bacteria | 423070 |
| 202 | Ga0209050_1000595 | 3300025298 | Bacteria | 57712 |
| 203 | Ga0209051_1000008 | 3300025303 | Bacteria | 706935 |
| 204 | Ga0209051_1000043 | 3300025303 | Bacteria | 305473 |
| 205 | Ga0209051_1000407 | 3300025303 | Bacteria | 59487 |
| 206 | Ga0209257_1000098 | 3300025304 | Bacteria | 256390 |
| 207 | Ga0209257_1014823 | 3300025304 | Bacteria | 3308 |
| 208 | Ga0209257_1031961 | 3300025304 | Bacteria | 1675 |
| 209 | Ga0207656_10000293 | 3300025321 | Bacteria | 17271 |
| 210 | Ga0207696_1000045 | 3300025711 | Bacteria | 296484 |
| 211 | Ga0207696_1000101 | 3300025711 | Bacteria | 170899 |
| 212 | Ga0207696_1004427 | 3300025711 | Bacteria | 6057 |
| 213 | Ga0207696_1021804 | 3300025711 | Bacteria | 2046 |
| 214 | Ga0207696_1023426 | 3300025711 | Bacteria | 1947 |
| 215 | Ga0207696_1029694 | 3300025711 | Bacteria | 1667 |
| 216 | Ga0207696_1076456 | 3300025711 | Bacteria | 927 |
| 217 | Ga0207655_1000019 | 3300025728 | Bacteria | 536324 |
| 218 | Ga0207655_1000337 | 3300025728 | Bacteria | 68266 |
| 219 | Ga0207655_1001070 | 3300025728 | Bacteria | 27170 |
| 220 | Ga0207655_1004518 | 3300025728 | Bacteria | 9838 |
| 221 | Ga0207655_1008174 | 3300025728 | Bacteria | 6681 |
| 222 | Ga0207655_1009296 | 3300025728 | Bacteria | 6120 |
| 223 | Ga0207655_1010611 | 3300025728 | Bacteria | 5570 |
| 224 | Ga0207655_1014895 | 3300025728 | Bacteria | 4358 |
| 225 | Ga0207655_1020507 | 3300025728 | Bacteria | 3394 |
| 226 | Ga0207655_1021617 | 3300025728 | Bacteria | 3258 |
| 227 | Ga0207655_1024802 | 3300025728 | Bacteria | 2929 |
| 228 | Ga0207655_1028229 | 3300025728 | Bacteria | 2651 |
| 229 | Ga0207655_1155576 | 3300025728 | Bacteria | 719 |
| 230 | Ga0207713_1000030 | 3300025735 | Bacteria | 284027 |
| 231 | Ga0207713_1000150 | 3300025735 | Bacteria | 105170 |
| 232 | Ga0207713_1001217 | 3300025735 | Bacteria | 21481 |
| 233 | Ga0207713_1002539 | 3300025735 | Bacteria | 13202 |
| 234 | Ga0207713_1003187 | 3300025735 | Bacteria | 11340 |
| 235 | Ga0207713_1009720 | 3300025735 | Bacteria | 5389 |
| 236 | Ga0207713_1010908 | 3300025735 | Bacteria | 4989 |
| 237 | Ga0207713_1015010 | 3300025735 | Bacteria | 3994 |
| 238 | Ga0207713_1103409 | 3300025735 | Bacteria | 979 |
| 239 | Ga0207713_1155567 | 3300025735 | Bacteria | 734 |
| 240 | Ga0207671_10000287 | 3300025914 | Bacteria | 74587 |
| 241 | Ga0207649_10000068 | 3300025920 | Bacteria | 91623 |
| 242 | Ga0207681_10012718 | 3300025923 | Bacteria | 5198 |
| 243 | Ga0207650_10000174 | 3300025925 | Bacteria | 75634 |
| 244 | Ga0207650_10000405 | 3300025925 | Bacteria | 38683 |
| 245 | Ga0207706_10027125 | 3300025933 | Bacteria | 5123 |
| 246 | Ga0207686_10279286 | 3300025934 | Bacteria | 1232 |
| 247 | Ga0207686_10662983 | 3300025934 | Bacteria | 826 |
| 248 | Ga0207709_10000053 | 3300025935 | Bacteria | 225514 |
| 249 | Ga0207709_10001997 | 3300025935 | Bacteria | 13245 |
| 250 | Ga0207709_10259055 | 3300025935 | Bacteria | 1274 |
| 251 | Ga0207679_10000018 | 3300025945 | Bacteria | 238375 |
| 252 | Ga0207712_11179674 | 3300025961 | Bacteria | 683 |
| 253 | Ga0207640_10436920 | 3300025981 | Bacteria | 1075 |
| 254 | Ga0207639_10005291 | 3300026041 | Bacteria | 8709 |
| 255 | Ga0209281_1000018 | 3300027111 | Bacteria | 579091 |
| 256 | Ga0209281_1000174 | 3300027111 | Bacteria | 151659 |
| 257 | Ga0209281_1007040 | 3300027111 | Bacteria | 2851 |
| 258 | Ga0209973_1009174 | 3300027252 | Bacteria | 1145 |
| 259 | Ga0209996_1001433 | 3300027395 | Bacteria | 2877 |
| 260 | Ga0209984_1002443 | 3300027424 | Bacteria | 2076 |
| 261 | Ga0209968_1011170 | 3300027526 | Bacteria | 1388 |
| 262 | Ga0209999_1041556 | 3300027543 | Bacteria | 862 |
| 263 | Ga0210002_1042986 | 3300027617 | Bacteria | 769 |
| 264 | Ga0209983_1001930 | 3300027665 | Bacteria | 4596 |
| 265 | Ga0209282_1020576 | 3300027666 | Bacteria | 4179 |
| 266 | Ga0209971_1004024 | 3300027682 | Bacteria | 3474 |
| 267 | Ga0207428_10016748 | 3300027907 | Bacteria | 6303 |
| 268 | Ga0207428_10034107 | 3300027907 | Bacteria | 4174 |
| 269 | Ga0207428_10049806 | 3300027907 | Bacteria | 3354 |
| 270 | Ga0207428_10313871 | 3300027907 | Bacteria | 1159 |
| 271 | Ga0307511_10122554 | 3300030521 | Bacteria | 1601 |
| 272 | Ga0307511_10223593 | 3300030521 | Bacteria | 942 |
| 273 | Ga0316177_1130413 | 3300030731 | Bacteria | 992 |
| 274 | Ga0314311_1092402 | 3300030733 | Bacteria | 6451 |
| 275 | Ga0316183_1023970 | 3300030742 | Bacteria | 3795 |
| 276 | Ga0316181_1134508 | 3300030744 | Bacteria | 2112 |
| 277 | Ga0316182_1273877 | 3300030745 | Bacteria | 1064 |
| 278 | Ga0307408_100035752 | 3300031548 | Bacteria | 3488 |
| 279 | Ga0307408_100770846 | 3300031548 | Bacteria | 870 |
| 280 | Ga0307405_10002888 | 3300031731 | Bacteria | 7734 |
| 281 | Ga0307405_10075341 | 3300031731 | Bacteria | 2185 |
| 282 | Ga0307413_10034240 | 3300031824 | Bacteria | 2901 |
| 283 | Ga0307413_10537800 | 3300031824 | Bacteria | 945 |
| 284 | Ga0307410_11658515 | 3300031852 | Bacteria | 566 |
| 285 | Ga0307406_10005725 | 3300031901 | Bacteria | 6804 |
| 286 | Ga0307412_10015329 | 3300031911 | Bacteria | 4541 |
| 287 | Ga0307409_100042016 | 3300031995 | Bacteria | 3420 |
| 288 | Ga0307416_100553357 | 3300032002 | Bacteria | 1224 |
| 289 | Ga0307414_10005562 | 3300032004 | Bacteria | 6951 |
| 290 | Ga0307414_10317162 | 3300032004 | Bacteria | 1325 |
| 291 | Ga0307414_10405551 | 3300032004 | Bacteria | 1185 |
| 292 | Ga0307414_10667585 | 3300032004 | Bacteria | 938 |
| 293 | Ga0307414_11948460 | 3300032004 | Bacteria | 548 |
| 294 | Ga0307411_10026265 | 3300032005 | Bacteria | 3504 |
| 295 | Ga0307411_10113942 | 3300032005 | Bacteria | 1941 |
| 296 | Ga0307510_10042593 | 3300033180 | Bacteria | 4946 |
| 297 | Ga0237819_01731 | 3300038705 | Bacteria | 5188 |
| 298 | Ga0439436_0002308 | 3300041404 | Bacteria | 5724 |
| 299 | Ga0439438_001957 | 3300041405 | Bacteria | 8998 |
| 300 | Ga0439438_002727 | 3300041405 | Bacteria | 7416 |
| 301 | Ga0439438_003107 | 3300041405 | Bacteria | 6829 |
| 302 | Ga0439438_006132 | 3300041405 | Bacteria | 4293 |
| 303 | Ga0439438_009657 | 3300041405 | Bacteria | 3108 |
| 304 | Ga0439438_010066 | 3300041405 | Bacteria | 3019 |
| 305 | Ga0439438_012149 | 3300041405 | Bacteria | 2652 |
| 306 | Ga0439438_025751 | 3300041405 | Bacteria | 1599 |
| 307 | Ga0439447_001168 | 3300041407 | Bacteria | 9567 |
| 308 | Ga0439447_001200 | 3300041407 | Bacteria | 9444 |
| 309 | Ga0439447_002577 | 3300041407 | Bacteria | 6586 |
| 310 | Ga0439447_004106 | 3300041407 | Bacteria | 5072 |
| 311 | Ga0439447_007315 | 3300041407 | Bacteria | 3517 |
| 312 | Ga0439447_007389 | 3300041407 | Bacteria | 3494 |
| 313 | Ga0439447_024940 | 3300041407 | Bacteria | 1544 |
| 314 | Ga0439447_066057 | 3300041407 | Bacteria | 845 |
| 315 | Ga0439453_0118321 | 3300041408 | Bacteria | 605 |
| 316 | Ga0439466_0003521 | 3300041411 | Bacteria | 6058 |
| 317 | Ga0439466_0003625 | 3300041411 | Bacteria | 5959 |
| 318 | Ga0439466_0007541 | 3300041411 | Bacteria | 4115 |
| 319 | Ga0439466_0012205 | 3300041411 | Bacteria | 3170 |
| 320 | Ga0439466_0013506 | 3300041411 | Bacteria | 2988 |
| 321 | Ga0439466_0014044 | 3300041411 | Bacteria | 2922 |
| 322 | Ga0439466_0031227 | 3300041411 | Bacteria | 1823 |
| 323 | Ga0439466_0046387 | 3300041411 | Bacteria | 1435 |
| 324 | Ga0439466_0082304 | 3300041411 | Bacteria | 1014 |
| 325 | Ga0439466_0158325 | 3300041411 | Bacteria | 693 |
| 326 | Ga0439465_0016937 | 3300041413 | Bacteria | 2274 |
| 327 | Ga0451841_1129590 | 3300041498 | Bacteria | 580 |
| 328 | Ga0439431_0027336 | 3300041997 | Bacteria | 1401 |
| 329 | Ga0439431_0031989 | 3300041997 | Bacteria | 1310 |
| 330 | Ga0439437_001530 | 3300042000 | Bacteria | 2433 |
| 331 | Ga0439432_000221 | 3300042006 | Bacteria | 20475 |
| 332 | Ga0439432_002029 | 3300042006 | Bacteria | 7662 |
| 333 | Ga0439432_002162 | 3300042006 | Bacteria | 7418 |
| 334 | Ga0439432_004560 | 3300042006 | Bacteria | 5056 |
| 335 | Ga0439432_008649 | 3300042006 | Bacteria | 3571 |
| 336 | Ga0439432_021318 | 3300042006 | Bacteria | 2149 |
| 337 | Ga0439432_042238 | 3300042006 | Bacteria | 1441 |
| 338 | Ga0439432_212400 | 3300042006 | Bacteria | 559 |
| 339 | Ga0439451_002269 | 3300042009 | Bacteria | 3873 |
| 340 | Ga0439451_003957 | 3300042009 | Bacteria | 3011 |
| 341 | Ga0439451_014900 | 3300042009 | Bacteria | 1568 |
| 342 | Ga0439451_043076 | 3300042009 | Bacteria | 905 |
| 343 | Ga0439451_052473 | 3300042009 | Bacteria | 816 |
| 344 | Ga0439452_001336 | 3300042010 | Bacteria | 10293 |
| 345 | Ga0439452_001645 | 3300042010 | Bacteria | 8822 |
| 346 | Ga0439452_001829 | 3300042010 | Bacteria | 8255 |
| 347 | Ga0439452_002038 | 3300042010 | Bacteria | 7698 |
| 348 | Ga0439452_009381 | 3300042010 | Bacteria | 2884 |
| 349 | Ga0439452_012733 | 3300042010 | Bacteria | 2380 |
| 350 | Ga0439452_019054 | 3300042010 | Bacteria | 1819 |
| 351 | Ga0439452_031519 | 3300042010 | Bacteria | 1300 |
| 352 | Ga0439452_038804 | 3300042010 | Bacteria | 1129 |
| 353 | Ga0439452_111834 | 3300042010 | Bacteria | 583 |
| 354 | Ga0439455_0009878 | 3300042012 | Bacteria | 2083 |
| 355 | Ga0439456_014477 | 3300042013 | Bacteria | 1645 |
| 356 | Ga0439456_026414 | 3300042013 | Bacteria | 1235 |
| 357 | Ga0439456_041021 | 3300042013 | Bacteria | 1003 |
| 358 | Ga0439456_041604 | 3300042013 | Bacteria | 996 |
| 359 | Ga0439456_067960 | 3300042013 | Bacteria | 788 |
| 360 | Ga0439456_115794 | 3300042013 | Bacteria | 612 |
| 361 | Ga0439463_000685 | 3300042016 | Bacteria | 9419 |
| 362 | Ga0439463_002704 | 3300042016 | Bacteria | 4487 |
| 363 | Ga0439463_042225 | 3300042016 | Bacteria | 1159 |
| 364 | Ga0439463_194838 | 3300042016 | Bacteria | 526 |
| 365 | Ga0450911_000001 | 3300042115 | Bacteria | 311012 |
| 366 | Ga0450911_002493 | 3300042115 | Bacteria | 3595 |
| 367 | Ga0450911_027641 | 3300042115 | Bacteria | 735 |
| 368 | Ga0450917_001875 | 3300042120 | Bacteria | 1493 |
| 369 | Ga0450919_027712 | 3300042121 | Bacteria | 645 |
| 370 | Ga0450920_000665 | 3300042122 | Bacteria | 5487 |
| 371 | Ga0450922_000171 | 3300042124 | Bacteria | 6681 |
| 372 | Ga0450922_004241 | 3300042124 | Bacteria | 1318 |
| 373 | Ga0450922_018578 | 3300042124 | Bacteria | 706 |
| 374 | Ga0450923_042746 | 3300042125 | Bacteria | 957 |
| 375 | Ga0450891_001832 | 3300042129 | Bacteria | 2185 |
| 376 | Ga0450902_002811 | 3300042137 | Bacteria | 2493 |
| 377 | Ga0450902_003679 | 3300042137 | Bacteria | 2253 |
| 378 | Ga0450902_006763 | 3300042137 | Bacteria | 1761 |
| 379 | Ga0450902_017166 | 3300042137 | Bacteria | 1181 |
| 380 | Ga0450903_001475 | 3300042138 | Bacteria | 4382 |
| 381 | Ga0450903_007378 | 3300042138 | Bacteria | 1811 |
| 382 | Ga0450903_009656 | 3300042138 | Bacteria | 1570 |
| 383 | Ga0450903_037582 | 3300042138 | Bacteria | 720 |
| 384 | Ga0450904_000013 | 3300042139 | Bacteria | 41827 |
| 385 | Ga0450904_001580 | 3300042139 | Bacteria | 3099 |
| 386 | Ga0450905_001551 | 3300042142 | Bacteria | 2934 |
| 387 | Ga0450905_012348 | 3300042142 | Bacteria | 1202 |
| 388 | Ga0450906_001615 | 3300042145 | Bacteria | 4942 |
| 389 | Ga0450906_003073 | 3300042145 | Bacteria | 3616 |
| 390 | Ga0450907_000141 | 3300042146 | Bacteria | 27526 |
| 391 | Ga0450907_015898 | 3300042146 | Bacteria | 1255 |
| 392 | Ga0450907_046959 | 3300042146 | Bacteria | 742 |
| 393 | Ga0450910_005462 | 3300042147 | Bacteria | 1734 |
| 394 | Ga0450910_028114 | 3300042147 | Bacteria | 874 |
| 395 | Ga0439446_0002949 | 3300042156 | Bacteria | 4160 |
| 396 | Ga0439446_0020995 | 3300042156 | Bacteria | 1843 |
| 397 | Ga0450908_002630 | 3300042184 | Bacteria | 3522 |
| 398 | Ga0450908_015523 | 3300042184 | Bacteria | 1364 |
| 399 | Ga0450909_013668 | 3300042185 | Bacteria | 1194 |
| 400 | Ga0450909_017845 | 3300042185 | Bacteria | 1052 |
| 401 | Ga0450909_065048 | 3300042185 | Bacteria | 579 |
| 402 | Ga0439434_0009926 | 3300042435 | Bacteria | 2802 |
| 403 | Ga0439459_0073899 | 3300042438 | Bacteria | 793 |
| 404 | Ga0439464_0000553 | 3300042439 | Bacteria | 7773 |
| 405 | Ga0439464_0001317 | 3300042439 | Bacteria | 5790 |
| 406 | Ga0439464_0010620 | 3300042439 | Bacteria | 2431 |
| 407 | Ga0439464_0067337 | 3300042439 | Bacteria | 1055 |
| 408 | Ga0439460_0012892 | 3300042461 | Bacteria | 2177 |
| 409 | Ga0450916_044058 | 3300042530 | Bacteria | 686 |
| 410 | Ga0450893_0000927 | 3300042532 | Bacteria | 4398 |
| 411 | Ga0450901_004466 | 3300042533 | Bacteria | 1449 |
| 412 | Ga0450901_010845 | 3300042533 | Bacteria | 945 |
| 413 | Ga0439440_0002059 | 3300042993 | Bacteria | 3751 |
| 414 | Ga0495617_000345 | 3300046452 | Bacteria | 25597 |
| 415 | Ga0495617_005322 | 3300046452 | Bacteria | 4579 |
| 416 | Ga0495617_025647 | 3300046452 | Bacteria | 1986 |
| 417 | Ga0495617_043372 | 3300046452 | Bacteria | 1501 |
| 418 | Ga0495617_056964 | 3300046452 | Bacteria | 1295 |
| 419 | Ga0495617_136067 | 3300046452 | Bacteria | 786 |
| 420 | Ga0495617_144765 | 3300046452 | Bacteria | 757 |
| 421 | Ga0495617_240028 | 3300046452 | Bacteria | 560 |
| 422 | Ga0495627_000013 | 3300046453 | Bacteria | 332765 |
| 423 | Ga0495627_000515 | 3300046453 | Bacteria | 32034 |
| 424 | Ga0495627_002477 | 3300046453 | Bacteria | 8850 |
| 425 | Ga0495627_011679 | 3300046453 | Bacteria | 3143 |
| 426 | Ga0495627_016219 | 3300046453 | Bacteria | 2555 |
| 427 | Ga0495627_016690 | 3300046453 | Bacteria | 2508 |
| 428 | Ga0495627_019374 | 3300046453 | Bacteria | 2282 |
| 429 | Ga0495627_022975 | 3300046453 | Bacteria | 2047 |
| 430 | Ga0495627_129405 | 3300046453 | Bacteria | 710 |
| 431 | Ga0495627_219590 | 3300046453 | Bacteria | 522 |
| 432 | Ga0495603_0014388 | 3300046455 | Bacteria | 4785 |
| 433 | Ga0495603_0043524 | 3300046455 | Bacteria | 2680 |
| 434 | Ga0495603_0075049 | 3300046455 | Bacteria | 1985 |
| 435 | Ga0495590_0000407 | 3300046457 | Bacteria | 21710 |
| 436 | Ga0495590_0001249 | 3300046457 | Bacteria | 11083 |
| 437 | Ga0495590_0021035 | 3300046457 | Bacteria | 2314 |
| 438 | Ga0495590_0189453 | 3300046457 | Bacteria | 753 |
| 439 | Ga0495590_0284124 | 3300046457 | Bacteria | 620 |
| 440 | Ga0495591_000020 | 3300046458 | Bacteria | 217845 |
| 441 | Ga0495591_001051 | 3300046458 | Bacteria | 18560 |
| 442 | Ga0495591_001253 | 3300046458 | Bacteria | 16253 |
| 443 | Ga0495591_001297 | 3300046458 | Bacteria | 15823 |
| 444 | Ga0495591_002664 | 3300046458 | Bacteria | 9722 |
| 445 | Ga0495591_002875 | 3300046458 | Bacteria | 9244 |
| 446 | Ga0495591_008226 | 3300046458 | Bacteria | 4298 |
| 447 | Ga0495591_010124 | 3300046458 | Bacteria | 3683 |
| 448 | Ga0495591_011472 | 3300046458 | Bacteria | 3356 |
| 449 | Ga0495591_017039 | 3300046458 | Bacteria | 2507 |
| 450 | Ga0495591_017690 | 3300046458 | Bacteria | 2439 |
| 451 | Ga0495591_067006 | 3300046458 | Bacteria | 940 |
| 452 | Ga0495591_076017 | 3300046458 | Bacteria | 863 |
| 453 | Ga0495638_0001706 | 3300046460 | Bacteria | 19330 |
| 454 | Ga0495638_0016733 | 3300046460 | Bacteria | 4902 |
| 455 | Ga0495638_0017330 | 3300046460 | Bacteria | 4805 |
| 456 | Ga0495638_0017833 | 3300046460 | Bacteria | 4725 |
| 457 | Ga0495638_0064240 | 3300046460 | Bacteria | 2261 |
| 458 | Ga0495638_0076010 | 3300046460 | Bacteria | 2046 |
| 459 | Ga0495638_0222308 | 3300046460 | Bacteria | 1055 |
| 460 | Ga0495638_0295197 | 3300046460 | Bacteria | 875 |
| 461 | Ga0495638_0655906 | 3300046460 | Bacteria | 509 |
| 462 | Ga0495653_0001863 | 3300046463 | Bacteria | 16657 |
| 463 | Ga0495653_0009503 | 3300046463 | Bacteria | 7956 |
| 464 | Ga0495653_0011533 | 3300046463 | Bacteria | 7217 |
| 465 | Ga0495653_0037547 | 3300046463 | Bacteria | 3804 |
| 466 | Ga0495653_0104430 | 3300046463 | Bacteria | 2047 |
| 467 | Ga0495650_0000221 | 3300046471 | Bacteria | 118284 |
| 468 | Ga0495650_0005660 | 3300046471 | Bacteria | 8023 |
| 469 | Ga0495650_0010351 | 3300046471 | Bacteria | 5211 |
| 470 | Ga0495650_0011705 | 3300046471 | Bacteria | 4777 |
| 471 | Ga0495650_0018333 | 3300046471 | Bacteria | 3480 |
| 472 | Ga0495650_0023129 | 3300046471 | Bacteria | 2965 |
| 473 | Ga0495650_0064442 | 3300046471 | Bacteria | 1457 |
| 474 | Ga0495650_0131253 | 3300046471 | Bacteria | 913 |
| 475 | Ga0495605_0000032 | 3300046474 | Bacteria | 210550 |
| 476 | Ga0495605_0000047 | 3300046474 | Bacteria | 171270 |
| 477 | Ga0495605_0000525 | 3300046474 | Bacteria | 32358 |
| 478 | Ga0495605_0001124 | 3300046474 | Bacteria | 17808 |
| 479 | Ga0495605_0002483 | 3300046474 | Bacteria | 11408 |
| 480 | Ga0495605_0006439 | 3300046474 | Bacteria | 6748 |
| 481 | Ga0495605_0008789 | 3300046474 | Bacteria | 5700 |
| 482 | Ga0495605_0020475 | 3300046474 | Bacteria | 3514 |
| 483 | Ga0495605_0033135 | 3300046474 | Bacteria | 2625 |
| 484 | Ga0495605_0044971 | 3300046474 | Bacteria | 2179 |
| 485 | Ga0495605_0047485 | 3300046474 | Bacteria | 2106 |
| 486 | Ga0495605_0057111 | 3300046474 | Bacteria | 1880 |
| 487 | Ga0495605_0077969 | 3300046474 | Bacteria | 1553 |
| 488 | Ga0495605_0096412 | 3300046474 | Bacteria | 1364 |
| 489 | Ga0495605_0105752 | 3300046474 | Bacteria | 1289 |
| 490 | Ga0495605_0204128 | 3300046474 | Bacteria | 860 |
| 491 | Ga0495605_0281135 | 3300046474 | Bacteria | 707 |
| 492 | Ga0495605_0290274 | 3300046474 | Bacteria | 693 |
| 493 | Ga0495605_0460213 | 3300046474 | Bacteria | 523 |
| 494 | Ga0495605_0488815 | 3300046474 | Bacteria | 504 |
| 495 | Ga0495605_0490933 | 3300046474 | Bacteria | 502 |
| 496 | Ga0495584_0004829 | 3300046491 | Bacteria | 7199 |
| 497 | Ga0495584_0004946 | 3300046491 | Bacteria | 7106 |
| 498 | Ga0495584_0005292 | 3300046491 | Bacteria | 6836 |
| 499 | Ga0495584_0007295 | 3300046491 | Bacteria | 5767 |
| 500 | Ga0495584_0015934 | 3300046491 | Bacteria | 3835 |
| 501 | Ga0495584_0023984 | 3300046491 | Bacteria | 3092 |
| 502 | Ga0495584_0024705 | 3300046491 | Bacteria | 3046 |
| 503 | Ga0495584_0047415 | 3300046491 | Bacteria | 2166 |
| 504 | Ga0495584_0092177 | 3300046491 | Bacteria | 1528 |
| 505 | Ga0495584_0170503 | 3300046491 | Bacteria | 1106 |
| 506 | Ga0495584_0223314 | 3300046491 | Bacteria | 957 |
| 507 | Ga0495585_0000816 | 3300046492 | Bacteria | 26990 |
| 508 | Ga0495585_0007295 | 3300046492 | Bacteria | 6786 |
| 509 | Ga0495585_0007718 | 3300046492 | Bacteria | 6558 |
| 510 | Ga0495585_0024144 | 3300046492 | Bacteria | 3487 |
| 511 | Ga0495585_0040411 | 3300046492 | Bacteria | 2618 |
| 512 | Ga0495585_0043876 | 3300046492 | Bacteria | 2499 |
| 513 | Ga0495585_0094257 | 3300046492 | Bacteria | 1609 |
| 514 | Ga0495585_0143985 | 3300046492 | Bacteria | 1246 |
| 515 | Ga0495594_0000964 | 3300046499 | Bacteria | 14958 |
| 516 | Ga0495594_0085325 | 3300046499 | Bacteria | 1766 |
| 517 | Ga0495594_0218208 | 3300046499 | Bacteria | 1087 |
| 518 | Ga0495596_0018515 | 3300046500 | Bacteria | 2868 |
| 519 | Ga0495596_0051855 | 3300046500 | Bacteria | 1606 |
| 520 | Ga0495607_0000307 | 3300046501 | Bacteria | 51080 |
| 521 | Ga0495607_0000888 | 3300046501 | Bacteria | 27904 |
| 522 | Ga0495607_0001496 | 3300046501 | Bacteria | 20713 |
| 523 | Ga0495607_0001899 | 3300046501 | Bacteria | 17718 |
| 524 | Ga0495607_0002088 | 3300046501 | Bacteria | 16692 |
| 525 | Ga0495607_0003469 | 3300046501 | Bacteria | 12075 |
| 526 | Ga0495607_0011080 | 3300046501 | Bacteria | 6019 |
| 527 | Ga0495607_0011595 | 3300046501 | Bacteria | 5861 |
| 528 | Ga0495607_0026374 | 3300046501 | Bacteria | 3605 |
| 529 | Ga0495607_0027857 | 3300046501 | Bacteria | 3488 |
| 530 | Ga0495607_0034286 | 3300046501 | Bacteria | 3080 |
| 531 | Ga0495607_0036468 | 3300046501 | Bacteria | 2962 |
| 532 | Ga0495607_0042670 | 3300046501 | Bacteria | 2687 |
| 533 | Ga0495607_0043682 | 3300046501 | Bacteria | 2648 |
| 534 | Ga0495607_0049787 | 3300046501 | Bacteria | 2441 |
| 535 | Ga0495607_0053686 | 3300046501 | Bacteria | 2326 |
| 536 | Ga0495607_0055029 | 3300046501 | Bacteria | 2290 |
| 537 | Ga0495607_0079730 | 3300046501 | Bacteria | 1802 |
| 538 | Ga0495607_0119336 | 3300046501 | Bacteria | 1387 |
| 539 | Ga0495607_0134561 | 3300046501 | Bacteria | 1281 |
| 540 | Ga0495607_0160735 | 3300046501 | Bacteria | 1142 |
| 541 | Ga0495607_0246787 | 3300046501 | Bacteria | 861 |
| 542 | Ga0495607_0285744 | 3300046501 | Bacteria | 781 |
| 543 | Ga0495607_0312860 | 3300046501 | Bacteria | 735 |
| 544 | Ga0495607_0392143 | 3300046501 | Bacteria | 633 |
| 545 | Ga0495583_0000052 | 3300046506 | Bacteria | 211902 |
| 546 | Ga0495583_0001185 | 3300046506 | Bacteria | 28074 |
| 547 | Ga0495583_0001288 | 3300046506 | Bacteria | 26166 |
| 548 | Ga0495583_0003027 | 3300046506 | Bacteria | 13395 |
| 549 | Ga0495583_0003309 | 3300046506 | Bacteria | 12486 |
| 550 | Ga0495583_0006885 | 3300046506 | Bacteria | 7313 |
| 551 | Ga0495583_0009851 | 3300046506 | Bacteria | 5656 |
| 552 | Ga0495583_0012088 | 3300046506 | Bacteria | 4914 |
| 553 | Ga0495583_0058584 | 3300046506 | Bacteria | 1728 |
| 554 | Ga0495583_0128725 | 3300046506 | Bacteria | 1060 |
| 555 | Ga0495606_0000669 | 3300046507 | Bacteria | 53621 |
| 556 | Ga0495606_0000698 | 3300046507 | Bacteria | 52041 |
| 557 | Ga0495606_0002877 | 3300046507 | Bacteria | 19029 |
| 558 | Ga0495606_0004097 | 3300046507 | Bacteria | 14808 |
| 559 | Ga0495606_0009421 | 3300046507 | Bacteria | 8266 |
| 560 | Ga0495606_0025593 | 3300046507 | Bacteria | 4222 |
| 561 | Ga0495606_0042510 | 3300046507 | Bacteria | 3038 |
| 562 | Ga0495606_0051258 | 3300046507 | Bacteria | 2693 |
| 563 | Ga0495606_0057228 | 3300046507 | Bacteria | 2511 |
| 564 | Ga0495606_0078829 | 3300046507 | Bacteria | 2053 |
| 565 | Ga0495606_0121457 | 3300046507 | Bacteria | 1563 |
| 566 | Ga0495606_0140381 | 3300046507 | Bacteria | 1427 |
| 567 | Ga0495606_0204340 | 3300046507 | Bacteria | 1123 |
| 568 | Ga0495606_0239986 | 3300046507 | Bacteria | 1011 |
| 569 | Ga0495610_0008157 | 3300046512 | Bacteria | 6837 |
| 570 | Ga0495610_0009933 | 3300046512 | Bacteria | 5953 |
| 571 | Ga0495610_0011085 | 3300046512 | Bacteria | 5536 |
| 572 | Ga0495610_0016728 | 3300046512 | Bacteria | 4210 |
| 573 | Ga0495610_0018130 | 3300046512 | Bacteria | 3984 |
| 574 | Ga0495610_0019983 | 3300046512 | Bacteria | 3731 |
| 575 | Ga0495610_0022969 | 3300046512 | Bacteria | 3398 |
| 576 | Ga0495610_0039219 | 3300046512 | Bacteria | 2397 |
| 577 | Ga0495610_0043634 | 3300046512 | Bacteria | 2233 |
| 578 | Ga0495610_0071414 | 3300046512 | Bacteria | 1618 |
| 579 | Ga0495616_0004718 | 3300046513 | Bacteria | 8542 |
| 580 | Ga0495616_0014914 | 3300046513 | Bacteria | 4335 |
| 581 | Ga0495616_0039394 | 3300046513 | Bacteria | 2420 |
| 582 | Ga0495616_0045237 | 3300046513 | Bacteria | 2229 |
| 583 | Ga0495616_0149604 | 3300046513 | Bacteria | 1057 |
| 584 | Ga0495616_0207586 | 3300046513 | Bacteria | 858 |
| 585 | Ga0495620_0000019 | 3300046515 | Bacteria | 150014 |
| 586 | Ga0495620_0002079 | 3300046515 | Bacteria | 11642 |
| 587 | Ga0495620_0003560 | 3300046515 | Bacteria | 8904 |
| 588 | Ga0495620_0003930 | 3300046515 | Bacteria | 8466 |
| 589 | Ga0495620_0004911 | 3300046515 | Bacteria | 7501 |
| 590 | Ga0495620_0009877 | 3300046515 | Bacteria | 5054 |
| 591 | Ga0495620_0034175 | 3300046515 | Bacteria | 2300 |
| 592 | Ga0495620_0054930 | 3300046515 | Bacteria | 1680 |
| 593 | Ga0495620_0155932 | 3300046515 | Bacteria | 888 |
| 594 | Ga0495628_0853643 | 3300046516 | Bacteria | 634 |
| 595 | Ga0495630_0103393 | 3300046517 | Bacteria | 2155 |
| 596 | Ga0495630_0135343 | 3300046517 | Bacteria | 1872 |
| 597 | Ga0495630_0301436 | 3300046517 | Bacteria | 1224 |
| 598 | Ga0495631_0001595 | 3300046518 | Bacteria | 13584 |
| 599 | Ga0495631_0003133 | 3300046518 | Bacteria | 9117 |
| 600 | Ga0495631_0004610 | 3300046518 | Bacteria | 7297 |
| 601 | Ga0495631_0012360 | 3300046518 | Bacteria | 4172 |
| 602 | Ga0495631_0024408 | 3300046518 | Bacteria | 2791 |
| 603 | Ga0495631_0030286 | 3300046518 | Bacteria | 2455 |
| 604 | Ga0495631_0047306 | 3300046518 | Bacteria | 1889 |
| 605 | Ga0495631_0175573 | 3300046518 | Bacteria | 918 |
| 606 | Ga0495631_0277975 | 3300046518 | Bacteria | 713 |
| 607 | Ga0495632_0000867 | 3300046519 | Bacteria | 26585 |
| 608 | Ga0495632_0006130 | 3300046519 | Bacteria | 7791 |
| 609 | Ga0495632_0006981 | 3300046519 | Bacteria | 7166 |
| 610 | Ga0495632_0007851 | 3300046519 | Bacteria | 6638 |
| 611 | Ga0495632_0010370 | 3300046519 | Bacteria | 5524 |
| 612 | Ga0495632_0012404 | 3300046519 | Bacteria | 4918 |
| 613 | Ga0495632_0021400 | 3300046519 | Bacteria | 3485 |
| 614 | Ga0495632_0038866 | 3300046519 | Bacteria | 2406 |
| 615 | Ga0495632_0054897 | 3300046519 | Bacteria | 1951 |
| 616 | Ga0495632_0056635 | 3300046519 | Bacteria | 1916 |
| 617 | Ga0495632_0059273 | 3300046519 | Bacteria | 1863 |
| 618 | Ga0495632_0085924 | 3300046519 | Bacteria | 1496 |
| 619 | Ga0495632_0237222 | 3300046519 | Bacteria | 821 |
| 620 | Ga0495632_0471166 | 3300046519 | Bacteria | 543 |
| 621 | Ga0495637_0000023 | 3300046520 | Bacteria | 172407 |
| 622 | Ga0495637_0000546 | 3300046520 | Bacteria | 27049 |
| 623 | Ga0495637_0005605 | 3300046520 | Bacteria | 6374 |
| 624 | Ga0495637_0011553 | 3300046520 | Bacteria | 4241 |
| 625 | Ga0495637_0013587 | 3300046520 | Bacteria | 3861 |
| 626 | Ga0495637_0015066 | 3300046520 | Bacteria | 3634 |
| 627 | Ga0495637_0015151 | 3300046520 | Bacteria | 3621 |
| 628 | Ga0495637_0016164 | 3300046520 | Bacteria | 3490 |
| 629 | Ga0495637_0029129 | 3300046520 | Bacteria | 2459 |
| 630 | Ga0495637_0042635 | 3300046520 | Bacteria | 1940 |
| 631 | Ga0495637_0044103 | 3300046520 | Bacteria | 1900 |
| 632 | Ga0495637_0048706 | 3300046520 | Bacteria | 1783 |
| 633 | Ga0495637_0066593 | 3300046520 | Bacteria | 1463 |
| 634 | Ga0495637_0066869 | 3300046520 | Bacteria | 1460 |
| 635 | Ga0495637_0070580 | 3300046520 | Bacteria | 1411 |
| 636 | Ga0495637_0091323 | 3300046520 | Bacteria | 1200 |
| 637 | Ga0495637_0101046 | 3300046520 | Bacteria | 1126 |
| 638 | Ga0495637_0130973 | 3300046520 | Bacteria | 958 |
| 639 | Ga0495637_0143858 | 3300046520 | Bacteria | 903 |
| 640 | Ga0495643_0004890 | 3300046522 | Bacteria | 9221 |
| 641 | Ga0495643_0014229 | 3300046522 | Bacteria | 4738 |
| 642 | Ga0495643_0030455 | 3300046522 | Bacteria | 3012 |
| 643 | Ga0495643_0074948 | 3300046522 | Bacteria | 1771 |
| 644 | Ga0495643_0080477 | 3300046522 | Bacteria | 1695 |
| 645 | Ga0495643_0106502 | 3300046522 | Bacteria | 1430 |
| 646 | Ga0495643_0124477 | 3300046522 | Bacteria | 1299 |
| 647 | Ga0495643_0156469 | 3300046522 | Bacteria | 1124 |
| 648 | Ga0495643_0198434 | 3300046522 | Bacteria | 964 |
| 649 | Ga0495643_0249213 | 3300046522 | Bacteria | 829 |
| 650 | Ga0495643_0289421 | 3300046522 | Bacteria | 750 |
| 651 | Ga0495643_0379628 | 3300046522 | Bacteria | 627 |
| 652 | Ga0495644_0003325 | 3300046523 | Bacteria | 6356 |
| 653 | Ga0495644_0067435 | 3300046523 | Bacteria | 1344 |
| 654 | Ga0495644_0176274 | 3300046523 | Bacteria | 821 |
| 655 | Ga0495644_0401425 | 3300046523 | Bacteria | 543 |
| 656 | Ga0495648_0002803 | 3300046524 | Bacteria | 15688 |
| 657 | Ga0495648_0003237 | 3300046524 | Bacteria | 14438 |
| 658 | Ga0495648_0006229 | 3300046524 | Bacteria | 9762 |
| 659 | Ga0495648_0008767 | 3300046524 | Bacteria | 7916 |
| 660 | Ga0495648_0012794 | 3300046524 | Bacteria | 6231 |
| 661 | Ga0495648_0027655 | 3300046524 | Bacteria | 3792 |
| 662 | Ga0495648_0036639 | 3300046524 | Bacteria | 3160 |
| 663 | Ga0495648_0051414 | 3300046524 | Bacteria | 2511 |
| 664 | Ga0495648_0051615 | 3300046524 | Bacteria | 2505 |
| 665 | Ga0495648_0062503 | 3300046524 | Bacteria | 2204 |
| 666 | Ga0495648_0105954 | 3300046524 | Bacteria | 1540 |
| 667 | Ga0495648_0122100 | 3300046524 | Bacteria | 1398 |
| 668 | Ga0495648_0171523 | 3300046524 | Bacteria | 1111 |
| 669 | Ga0495648_0193086 | 3300046524 | Bacteria | 1025 |
| 670 | Ga0495666_0018221 | 3300046526 | Bacteria | 3497 |
| 671 | Ga0495666_0532493 | 3300046526 | Bacteria | 524 |
| 672 | Ga0495642_0001384 | 3300046528 | Bacteria | 10855 |
| 673 | Ga0495642_0003792 | 3300046528 | Bacteria | 5919 |
| 674 | Ga0495654_0000784 | 3300046530 | Bacteria | 24497 |
| 675 | Ga0495654_0001351 | 3300046530 | Bacteria | 17056 |
| 676 | Ga0495654_0001730 | 3300046530 | Bacteria | 14663 |
| 677 | Ga0495654_0002404 | 3300046530 | Bacteria | 12075 |
| 678 | Ga0495654_0007339 | 3300046530 | Bacteria | 6169 |
| 679 | Ga0495654_0007972 | 3300046530 | Bacteria | 5881 |
| 680 | Ga0495654_0011513 | 3300046530 | Bacteria | 4782 |
| 681 | Ga0495654_0011693 | 3300046530 | Bacteria | 4742 |
| 682 | Ga0495654_0013416 | 3300046530 | Bacteria | 4386 |
| 683 | Ga0495654_0021368 | 3300046530 | Bacteria | 3367 |
| 684 | Ga0495654_0028240 | 3300046530 | Bacteria | 2869 |
| 685 | Ga0495654_0051346 | 3300046530 | Bacteria | 2012 |
| 686 | Ga0495654_0069414 | 3300046530 | Bacteria | 1673 |
| 687 | Ga0495654_0088238 | 3300046530 | Bacteria | 1442 |
| 688 | Ga0495654_0160961 | 3300046530 | Bacteria | 985 |
| 689 | Ga0495654_0436540 | 3300046530 | Bacteria | 516 |
| 690 | Ga0495609_0000032 | 3300046538 | Bacteria | 211021 |
| 691 | Ga0495609_0000382 | 3300046538 | Bacteria | 37599 |
| 692 | Ga0495609_0000807 | 3300046538 | Bacteria | 23434 |
| 693 | Ga0495609_0002842 | 3300046538 | Bacteria | 10359 |
| 694 | Ga0495609_0010529 | 3300046538 | Bacteria | 4434 |
| 695 | Ga0495609_0030820 | 3300046538 | Bacteria | 2441 |
| 696 | Ga0495609_0032378 | 3300046538 | Bacteria | 2374 |
| 697 | Ga0495609_0038569 | 3300046538 | Bacteria | 2153 |
| 698 | Ga0495609_0039190 | 3300046538 | Bacteria | 2134 |
| 699 | Ga0495609_0081320 | 3300046538 | Bacteria | 1416 |
| 700 | Ga0495609_0089196 | 3300046538 | Bacteria | 1341 |
| 701 | Ga0495609_0142674 | 3300046538 | Bacteria | 1021 |
| 702 | Ga0495609_0463732 | 3300046538 | Bacteria | 502 |
| 703 | Ga0495597_0000004 | 3300046542 | Bacteria | 307496 |
| 704 | Ga0495597_0002903 | 3300046542 | Bacteria | 10426 |
| 705 | Ga0495597_0004663 | 3300046542 | Bacteria | 7454 |
| 706 | Ga0495597_0014599 | 3300046542 | Bacteria | 3737 |
| 707 | Ga0495597_0015825 | 3300046542 | Bacteria | 3569 |
| 708 | Ga0495597_0015984 | 3300046542 | Bacteria | 3548 |
| 709 | Ga0495597_0016157 | 3300046542 | Bacteria | 3528 |
| 710 | Ga0495597_0074979 | 3300046542 | Bacteria | 1452 |
| 711 | Ga0495597_0085190 | 3300046542 | Bacteria | 1347 |
| 712 | Ga0495597_0174376 | 3300046542 | Bacteria | 871 |
| 713 | Ga0495597_0178997 | 3300046542 | Bacteria | 857 |
| 714 | Ga0495597_0202312 | 3300046542 | Bacteria | 795 |
| 715 | Ga0495645_0260605 | 3300046543 | Bacteria | 1148 |
| 716 | Ga0495645_0677434 | 3300046543 | Bacteria | 628 |
| 717 | Ga0495622_0003035 | 3300046557 | Bacteria | 7965 |
| 718 | Ga0495622_0007144 | 3300046557 | Bacteria | 5189 |
| 719 | Ga0495622_0014421 | 3300046557 | Bacteria | 3669 |
| 720 | Ga0495622_0016658 | 3300046557 | Bacteria | 3423 |
| 721 | Ga0495622_0042822 | 3300046557 | Bacteria | 2105 |
| 722 | Ga0495622_0046066 | 3300046557 | Bacteria | 2026 |
| 723 | Ga0495622_0053658 | 3300046557 | Bacteria | 1870 |
| 724 | Ga0495633_0000040 | 3300046558 | Bacteria | 177876 |
| 725 | Ga0495633_0009956 | 3300046558 | Bacteria | 5219 |
| 726 | Ga0495633_0021631 | 3300046558 | Bacteria | 3214 |
| 727 | Ga0495633_0109450 | 3300046558 | Bacteria | 1281 |
| 728 | Ga0495633_0359058 | 3300046558 | Bacteria | 660 |
| 729 | Ga0495668_0012999 | 3300046616 | Bacteria | 4926 |
| 730 | Ga0495668_0045577 | 3300046616 | Bacteria | 2438 |
| 731 | Ga0495668_0060256 | 3300046616 | Bacteria | 2094 |
| 732 | Ga0495668_0061005 | 3300046616 | Bacteria | 2080 |
| 733 | Ga0495668_0142717 | 3300046616 | Bacteria | 1310 |
| 734 | Ga0495668_0549199 | 3300046616 | Bacteria | 637 |
| 735 | Ga0495634_0005604 | 3300046642 | Bacteria | 9626 |
| 736 | Ga0495611_0000589 | 3300046648 | Bacteria | 20938 |
| 737 | Ga0495611_0004298 | 3300046648 | Bacteria | 6186 |
| 738 | Ga0495611_0007814 | 3300046648 | Bacteria | 4540 |
| 739 | Ga0495611_0261548 | 3300046648 | Bacteria | 801 |
| 740 | Ga0495625_0000010 | 3300046660 | Bacteria | 381775 |
| 741 | Ga0495625_0018258 | 3300046660 | Bacteria | 5481 |
| 742 | Ga0495625_0038836 | 3300046660 | Bacteria | 3480 |
| 743 | Ga0495625_0058557 | 3300046660 | Bacteria | 2737 |
| 744 | Ga0495625_0058870 | 3300046660 | Bacteria | 2727 |
| 745 | Ga0495625_0106245 | 3300046660 | Bacteria | 1922 |
| 746 | Ga0495625_0214390 | 3300046660 | Bacteria | 1264 |
| 747 | Ga0495635_0007473 | 3300046663 | Bacteria | 7627 |
| 748 | Ga0495659_0015676 | 3300046664 | Bacteria | 2493 |
| 749 | Ga0495661_0000020 | 3300046665 | Bacteria | 196901 |
| 750 | Ga0495661_0000037 | 3300046665 | Bacteria | 164234 |
| 751 | Ga0495661_0000095 | 3300046665 | Bacteria | 109100 |
| 752 | Ga0495661_0000208 | 3300046665 | Bacteria | 67762 |
| 753 | Ga0495661_0002196 | 3300046665 | Bacteria | 15222 |
| 754 | Ga0495661_0003095 | 3300046665 | Bacteria | 12492 |
| 755 | Ga0495661_0029738 | 3300046665 | Bacteria | 3484 |
| 756 | Ga0495661_0039047 | 3300046665 | Bacteria | 2952 |
| 757 | Ga0495661_0059224 | 3300046665 | Bacteria | 2280 |
| 758 | Ga0495661_0063119 | 3300046665 | Bacteria | 2191 |
| 759 | Ga0495661_0067592 | 3300046665 | Bacteria | 2099 |
| 760 | Ga0495661_0119376 | 3300046665 | Bacteria | 1458 |
| 761 | Ga0495661_0245484 | 3300046665 | Bacteria | 916 |
| 762 | Ga0495588_0538143 | 3300046674 | Bacteria | 612 |
| 763 | Ga0495623_0021747 | 3300046679 | Bacteria | 4143 |
| 764 | Ga0495623_0063065 | 3300046679 | Bacteria | 2321 |
| 765 | Ga0495646_0004545 | 3300046680 | Bacteria | 8739 |
| 766 | Ga0495646_0269496 | 3300046680 | Bacteria | 907 |
| 767 | Ga0495669_0004912 | 3300046684 | Bacteria | 5550 |
| 768 | Ga0495613_0039865 | 3300046689 | Bacteria | 3480 |
| 769 | Ga0495670_0002237 | 3300046691 | Bacteria | 9558 |
| 770 | Ga0495670_0017224 | 3300046691 | Bacteria | 3555 |
| 771 | Ga0495670_0031511 | 3300046691 | Bacteria | 2635 |
| 772 | Ga0495670_0071587 | 3300046691 | Bacteria | 1755 |
| 773 | Ga0495670_0085906 | 3300046691 | Bacteria | 1606 |
| 774 | Ga0495670_0087525 | 3300046691 | Bacteria | 1591 |
| 775 | Ga0495670_0296484 | 3300046691 | Bacteria | 866 |
| 776 | Ga0495670_0584722 | 3300046691 | Bacteria | 608 |
| 777 | Ga0495671_0002417 | 3300046692 | Bacteria | 11813 |
| 778 | Ga0495671_0006661 | 3300046692 | Bacteria | 6656 |
| 779 | Ga0495671_0007745 | 3300046692 | Bacteria | 6086 |
| 780 | Ga0495671_0009549 | 3300046692 | Bacteria | 5415 |
| 781 | Ga0495671_0012911 | 3300046692 | Bacteria | 4547 |
| 782 | Ga0495671_0013658 | 3300046692 | Bacteria | 4389 |
| 783 | Ga0495671_0015385 | 3300046692 | Bacteria | 4099 |
| 784 | Ga0495671_0015940 | 3300046692 | Bacteria | 4022 |
| 785 | Ga0495671_0023109 | 3300046692 | Bacteria | 3250 |
| 786 | Ga0495671_0035567 | 3300046692 | Bacteria | 2528 |
| 787 | Ga0495671_0037044 | 3300046692 | Bacteria | 2468 |
| 788 | Ga0495671_0044765 | 3300046692 | Bacteria | 2217 |
| 789 | Ga0495671_0047244 | 3300046692 | Bacteria | 2151 |
| 790 | Ga0495671_0068470 | 3300046692 | Bacteria | 1745 |
| 791 | Ga0495671_0174216 | 3300046692 | Bacteria | 1045 |
| 792 | Ga0495671_0186794 | 3300046692 | Bacteria | 1006 |
| 793 | Ga0495671_0202090 | 3300046692 | Bacteria | 963 |
| 794 | Ga0495671_0342924 | 3300046692 | Bacteria | 717 |
| 795 | Ga0495671_0609496 | 3300046692 | Bacteria | 519 |
| 796 | Ga0495649_0000953 | 3300046694 | Bacteria | 22833 |
| 797 | Ga0495649_0002103 | 3300046694 | Bacteria | 14280 |
| 798 | Ga0495649_0002258 | 3300046694 | Bacteria | 13696 |
| 799 | Ga0495649_0002986 | 3300046694 | Bacteria | 11622 |
| 800 | Ga0495649_0009685 | 3300046694 | Bacteria | 5709 |
| 801 | Ga0495649_0011065 | 3300046694 | Bacteria | 5313 |
| 802 | Ga0495649_0041888 | 3300046694 | Bacteria | 2503 |
| 803 | Ga0495649_0072621 | 3300046694 | Bacteria | 1844 |
| 804 | Ga0495649_0104174 | 3300046694 | Bacteria | 1506 |
| 805 | Ga0495649_0152929 | 3300046694 | Bacteria | 1211 |
| 806 | Ga0495649_0257811 | 3300046694 | Bacteria | 894 |
| 807 | Ga0495649_0280949 | 3300046694 | Bacteria | 850 |
| 808 | Ga0495649_0294823 | 3300046694 | Bacteria | 826 |
| 809 | Ga0495649_0322026 | 3300046694 | Bacteria | 784 |
| 810 | Ga0495649_0420409 | 3300046694 | Bacteria | 669 |
| 811 | Ga0495589_0000618 | 3300046794 | Bacteria | 23818 |
| 812 | Ga0495589_0005488 | 3300046794 | Bacteria | 6689 |
| 813 | Ga0495589_0011437 | 3300046794 | Bacteria | 4607 |
| 814 | Ga0495589_0014865 | 3300046794 | Bacteria | 4004 |
| 815 | Ga0495589_0027550 | 3300046794 | Bacteria | 2872 |
| 816 | Ga0495589_0036200 | 3300046794 | Bacteria | 2474 |
| 817 | Ga0495660_0000768 | 3300046810 | Bacteria | 24134 |
| 818 | Ga0495660_0000771 | 3300046810 | Bacteria | 24010 |
| 819 | Ga0495660_0001378 | 3300046810 | Bacteria | 16697 |
| 820 | Ga0495660_0004723 | 3300046810 | Bacteria | 8222 |
| 821 | Ga0495660_0014143 | 3300046810 | Bacteria | 4620 |
| 822 | Ga0495660_0014871 | 3300046810 | Bacteria | 4500 |
| 823 | Ga0495660_0015205 | 3300046810 | Bacteria | 4447 |
| 824 | Ga0495660_0015618 | 3300046810 | Bacteria | 4387 |
| 825 | Ga0495660_0016909 | 3300046810 | Bacteria | 4201 |
| 826 | Ga0495660_0023372 | 3300046810 | Bacteria | 3525 |
| 827 | Ga0495660_0025680 | 3300046810 | Bacteria | 3344 |
| 828 | Ga0495660_0030921 | 3300046810 | Bacteria | 3013 |
| 829 | Ga0495660_0048115 | 3300046810 | Bacteria | 2332 |
| 830 | Ga0495660_0049343 | 3300046810 | Bacteria | 2298 |
| 831 | Ga0495660_0055028 | 3300046810 | Bacteria | 2155 |
| 832 | Ga0495660_0094356 | 3300046810 | Bacteria | 1549 |
| 833 | Ga0495660_0360870 | 3300046810 | Bacteria | 644 |
| 834 | Ga0495660_0450211 | 3300046810 | Bacteria | 556 |
| 835 | Ga0495581_0016703 | 3300047315 | Bacteria | 4266 |
| 836 | Ga0495604_0005474 | 3300047317 | Bacteria | 10069 |
| 837 | Ga0495604_0332902 | 3300047317 | Bacteria | 1012 |
| 838 | Ga0495636_0002017 | 3300047318 | Bacteria | 7781 |
| 839 | Ga0495636_0076264 | 3300047318 | Bacteria | 1437 |
| 840 | Ga0495636_0361412 | 3300047318 | Bacteria | 686 |
| 841 | Ga0495674_0057529 | 3300047319 | Bacteria | 3403 |
| 842 | Ga0495672_0001771 | 3300047320 | Bacteria | 20762 |
| 843 | Ga0495672_0003431 | 3300047320 | Bacteria | 13579 |
| 844 | Ga0495672_0005720 | 3300047320 | Bacteria | 9789 |
| 845 | Ga0495672_0006315 | 3300047320 | Bacteria | 9214 |
| 846 | Ga0495672_0012012 | 3300047320 | Bacteria | 6065 |
| 847 | Ga0495672_0020829 | 3300047320 | Bacteria | 4288 |
| 848 | Ga0495672_0023525 | 3300047320 | Bacteria | 3986 |
| 849 | Ga0495672_0026101 | 3300047320 | Bacteria | 3731 |
| 850 | Ga0495672_0030856 | 3300047320 | Bacteria | 3353 |
| 851 | Ga0495672_0036156 | 3300047320 | Bacteria | 3035 |
| 852 | Ga0495672_0048921 | 3300047320 | Bacteria | 2505 |
| 853 | Ga0495672_0095014 | 3300047320 | Bacteria | 1628 |
| 854 | Ga0495672_0102384 | 3300047320 | Bacteria | 1550 |
| 855 | Ga0495672_0127767 | 3300047320 | Bacteria | 1341 |
| 856 | Ga0495676_0000002 | 3300047321 | Bacteria | 373918 |
| 857 | Ga0495676_0042527 | 3300047321 | Bacteria | 3728 |
| 858 | Ga0495680_0033240 | 3300047322 | Bacteria | 4177 |
| 859 | Ga0495680_0050082 | 3300047322 | Bacteria | 3267 |
| 860 | Ga0495680_0076006 | 3300047322 | Bacteria | 2547 |
| 861 | Ga0495683_0000011 | 3300047323 | Bacteria | 212053 |
| 862 | Ga0495683_0000089 | 3300047323 | Bacteria | 92081 |
| 863 | Ga0495683_0000519 | 3300047323 | Bacteria | 29556 |
| 864 | Ga0495683_0006147 | 3300047323 | Bacteria | 6582 |
| 865 | Ga0495683_0032444 | 3300047323 | Bacteria | 2660 |
| 866 | Ga0495683_0046212 | 3300047323 | Bacteria | 2185 |
| 867 | Ga0495683_0319425 | 3300047323 | Bacteria | 662 |
| 868 | Ga0495683_0375692 | 3300047323 | Bacteria | 595 |
| 869 | Ga0495687_001197 | 3300047443 | Bacteria | 24833 |
| 870 | Ga0495687_008493 | 3300047443 | Bacteria | 5874 |
| 871 | Ga0495687_132992 | 3300047443 | Bacteria | 877 |
| 872 | Ga0495675_0187607 | 3300047444 | Bacteria | 1263 |
| 873 | Ga0495677_0219662 | 3300047445 | Bacteria | 740 |
| 874 | Ga0495679_000126 | 3300047446 | Bacteria | 68027 |
| 875 | Ga0495679_000621 | 3300047446 | Bacteria | 23962 |
| 876 | Ga0495679_001367 | 3300047446 | Bacteria | 14010 |
| 877 | Ga0495679_009776 | 3300047446 | Bacteria | 3812 |
| 878 | Ga0495679_010978 | 3300047446 | Bacteria | 3523 |
| 879 | Ga0495679_017869 | 3300047446 | Bacteria | 2529 |
| 880 | Ga0495679_074556 | 3300047446 | Bacteria | 971 |
| 881 | Ga0495673_0000563 | 3300047469 | Bacteria | 37758 |
| 882 | Ga0495673_0001975 | 3300047469 | Bacteria | 15152 |
| 883 | Ga0495673_0002348 | 3300047469 | Bacteria | 13445 |
| 884 | Ga0495673_0002520 | 3300047469 | Bacteria | 12793 |
| 885 | Ga0495673_0003010 | 3300047469 | Bacteria | 11347 |
| 886 | Ga0495673_0003566 | 3300047469 | Bacteria | 10226 |
| 887 | Ga0495673_0006797 | 3300047469 | Bacteria | 6680 |
| 888 | Ga0495673_0007690 | 3300047469 | Bacteria | 6157 |
| 889 | Ga0495673_0007822 | 3300047469 | Bacteria | 6085 |
| 890 | Ga0495673_0012794 | 3300047469 | Bacteria | 4430 |
| 891 | Ga0495673_0013648 | 3300047469 | Bacteria | 4254 |
| 892 | Ga0495673_0016425 | 3300047469 | Bacteria | 3784 |
| 893 | Ga0495673_0021703 | 3300047469 | Bacteria | 3164 |
| 894 | Ga0495673_0035945 | 3300047469 | Bacteria | 2277 |
| 895 | Ga0495673_0037347 | 3300047469 | Bacteria | 2218 |
| 896 | Ga0495673_0083411 | 3300047469 | Bacteria | 1319 |
| 897 | Ga0495673_0085618 | 3300047469 | Bacteria | 1297 |
| 898 | Ga0495681_0000621 | 3300047470 | Bacteria | 26997 |
| 899 | Ga0495681_0002330 | 3300047470 | Bacteria | 13648 |
| 900 | Ga0495681_0006679 | 3300047470 | Bacteria | 7532 |
| 901 | Ga0495681_0007930 | 3300047470 | Bacteria | 6707 |
| 902 | Ga0495681_0010809 | 3300047470 | Bacteria | 5497 |
| 903 | Ga0495681_0013817 | 3300047470 | Bacteria | 4667 |
| 904 | Ga0495681_0024793 | 3300047470 | Bacteria | 3148 |
| 905 | Ga0495681_0025808 | 3300047470 | Bacteria | 3070 |
| 906 | Ga0495681_0026289 | 3300047470 | Bacteria | 3033 |
| 907 | Ga0495681_0040419 | 3300047470 | Bacteria | 2270 |
| 908 | Ga0495681_0060219 | 3300047470 | Bacteria | 1752 |
| 909 | Ga0495681_0140931 | 3300047470 | Bacteria | 1018 |
| 910 | Ga0495684_0057665 | 3300047471 | Bacteria | 2959 |
| 911 | Ga0495686_0009309 | 3300047472 | Bacteria | 7087 |
| 912 | Ga0495686_0011662 | 3300047472 | Bacteria | 6187 |
| 913 | Ga0495686_0019342 | 3300047472 | Bacteria | 4550 |
| 914 | Ga0495686_0028247 | 3300047472 | Bacteria | 3653 |
| 915 | Ga0495686_0058119 | 3300047472 | Bacteria | 2411 |
| 916 | Ga0495593_0015578 | 3300047673 | Bacteria | 4302 |
| 917 | Ga0495602_0058351 | 3300048088 | Bacteria | 3378 |
| 918 | Ga0495626_0000007 | 3300048091 | Bacteria | 276374 |
| 919 | Ga0495626_0000781 | 3300048091 | Bacteria | 28964 |
| 920 | Ga0495626_0001420 | 3300048091 | Bacteria | 19099 |
| 921 | Ga0495626_0008419 | 3300048091 | Bacteria | 5656 |
| 922 | Ga0495626_0014922 | 3300048091 | Bacteria | 3988 |
| 923 | Ga0495626_0029367 | 3300048091 | Bacteria | 2661 |
| 924 | Ga0495626_0038983 | 3300048091 | Bacteria | 2249 |
| 925 | Ga0495626_0070542 | 3300048091 | Bacteria | 1571 |
| 926 | Ga0495626_0080914 | 3300048091 | Bacteria | 1443 |
| 927 | Ga0495626_0146617 | 3300048091 | Bacteria | 997 |
| 928 | Ga0496102_0006862 | 3300048905 | Bacteria | 9717 |
| 929 | Ga0496103_0003992 | 3300048906 | Bacteria | 8965 |
| 930 | Ga0496110_0854144 | 3300048913 | Bacteria | 815 |
| 931 | Ga0496110_1223307 | 3300048913 | Bacteria | 660 |
| 932 | Ga0496111_0180419 | 3300048914 | Bacteria | 1569 |
| 933 | Ga0496111_0800673 | 3300048914 | Bacteria | 682 |
| 934 | Ga0496112_0261879 | 3300048915 | Bacteria | 1678 |
| 935 | Ga0496112_0336917 | 3300048915 | Bacteria | 1452 |
| 936 | Ga0496112_1564363 | 3300048915 | Bacteria | 573 |
| 937 | Ga0496115_1448611 | 3300048918 | Bacteria | 505 |
| 938 | Ga0496116_0000085 | 3300048919 | Bacteria | 219553 |
| 939 | Ga0496116_0015452 | 3300048919 | Bacteria | 6034 |
| 940 | Ga0496116_0026674 | 3300048919 | Bacteria | 4217 |
| 941 | Ga0496116_0044766 | 3300048919 | Bacteria | 3003 |
| 942 | Ga0496116_0136720 | 3300048919 | Bacteria | 1386 |
| 943 | Ga0496116_0204606 | 3300048919 | Bacteria | 1029 |
| 944 | Ga0496117_0001083 | 3300048920 | Bacteria | 41245 |
| 945 | Ga0496117_0008157 | 3300048920 | Bacteria | 10003 |
| 946 | Ga0496117_0023516 | 3300048920 | Bacteria | 4905 |
| 947 | Ga0496117_0037465 | 3300048920 | Bacteria | 3612 |
| 948 | Ga0496117_0042455 | 3300048920 | Bacteria | 3318 |
| 949 | Ga0496117_0063805 | 3300048920 | Bacteria | 2516 |
| 950 | Ga0496117_0209027 | 3300048920 | Bacteria | 1096 |
| 951 | Ga0496117_0255767 | 3300048920 | Bacteria | 952 |
| 952 | Ga0496118_0010079 | 3300048921 | Bacteria | 9402 |
| 953 | Ga0496118_0013576 | 3300048921 | Bacteria | 7688 |
| 954 | Ga0496118_0017227 | 3300048921 | Bacteria | 6586 |
| 955 | Ga0496118_0034320 | 3300048921 | Bacteria | 4142 |
| 956 | Ga0496118_0064986 | 3300048921 | Bacteria | 2673 |
| 957 | Ga0496118_0077732 | 3300048921 | Bacteria | 2352 |
| 958 | Ga0496119_0023660 | 3300048922 | Bacteria | 4346 |
| 959 | Ga0496119_0128944 | 3300048922 | Bacteria | 1380 |
| 960 | Ga0496119_0162752 | 3300048922 | Bacteria | 1184 |
| 961 | Ga0496120_0007999 | 3300048923 | Bacteria | 7780 |
| 962 | Ga0496120_0014080 | 3300048923 | Bacteria | 5343 |
| 963 | Ga0496120_0023314 | 3300048923 | Bacteria | 3875 |
| 964 | Ga0496121_0000505 | 3300048924 | Bacteria | 74599 |
| 965 | Ga0496121_0006247 | 3300048924 | Bacteria | 14916 |
| 966 | Ga0496121_0010756 | 3300048924 | Bacteria | 10257 |
| 967 | Ga0496121_0023128 | 3300048924 | Bacteria | 5999 |
| 968 | Ga0496121_0106897 | 3300048924 | Bacteria | 2144 |
| 969 | Ga0496121_0272838 | 3300048924 | Bacteria | 1161 |
| 970 | Ga0496121_0486139 | 3300048924 | Bacteria | 787 |
| 971 | Ga0496122_0001761 | 3300048925 | Bacteria | 33221 |
| 972 | Ga0496122_0016161 | 3300048925 | Bacteria | 7088 |
| 973 | Ga0496122_0034212 | 3300048925 | Bacteria | 4162 |
| 974 | Ga0496122_0048132 | 3300048925 | Bacteria | 3283 |
| 975 | Ga0496122_0085139 | 3300048925 | Bacteria | 2182 |
| 976 | Ga0496123_0000087 | 3300048926 | Bacteria | 182994 |
| 977 | Ga0496123_0006202 | 3300048926 | Bacteria | 11667 |
| 978 | Ga0496123_0023965 | 3300048926 | Bacteria | 4656 |
| 979 | Ga0496123_0029384 | 3300048926 | Bacteria | 4047 |
| 980 | Ga0496123_0029506 | 3300048926 | Bacteria | 4035 |
| 981 | Ga0496124_0000807 | 3300048927 | Bacteria | 50885 |
| 982 | Ga0496124_0010005 | 3300048927 | Bacteria | 9683 |
| 983 | Ga0496124_0019173 | 3300048927 | Bacteria | 6381 |
| 984 | Ga0496124_0033056 | 3300048927 | Bacteria | 4555 |
| 985 | Ga0496124_0079625 | 3300048927 | Bacteria | 2697 |
| 986 | Ga0496124_0083036 | 3300048927 | Bacteria | 2629 |
| 987 | Ga0496124_0105664 | 3300048927 | Bacteria | 2274 |
| 988 | Ga0496124_0154721 | 3300048927 | Bacteria | 1794 |
| 989 | Ga0496124_0231892 | 3300048927 | Bacteria | 1379 |
| 990 | Ga0496124_0233131 | 3300048927 | Bacteria | 1375 |
| 991 | Ga0496125_0009460 | 3300048928 | Bacteria | 10007 |
| 992 | Ga0496125_0037515 | 3300048928 | Bacteria | 4211 |
| 993 | Ga0496125_0045252 | 3300048928 | Bacteria | 3707 |
| 994 | Ga0496125_0048393 | 3300048928 | Bacteria | 3546 |
| 995 | Ga0496125_0053638 | 3300048928 | Bacteria | 3303 |
| 996 | Ga0496126_0065462 | 3300048929 | Bacteria | 3252 |
| 997 | Ga0495678_000033 | 3300049459 | Bacteria | 211804 |
| 998 | Ga0495678_000787 | 3300049459 | Bacteria | 28437 |
| 999 | Ga0495678_003644 | 3300049459 | Bacteria | 9359 |
| 1000 | Ga0495678_005114 | 3300049459 | Bacteria | 7363 |
| 1001 | Ga0495678_007928 | 3300049459 | Bacteria | 5443 |
| 1002 | Ga0495678_007950 | 3300049459 | Bacteria | 5432 |
| 1003 | Ga0495678_008634 | 3300049459 | Bacteria | 5123 |
| 1004 | Ga0495678_011151 | 3300049459 | Bacteria | 4320 |
| 1005 | Ga0495678_021969 | 3300049459 | Bacteria | 2798 |
| 1006 | Ga0495678_025493 | 3300049459 | Bacteria | 2537 |
| 1007 | Ga0495678_026553 | 3300049459 | Bacteria | 2469 |
| 1008 | Ga0495678_040255 | 3300049459 | Bacteria | 1879 |
| 1009 | Ga0495678_053273 | 3300049459 | Bacteria | 1554 |
| 1010 | Ga0495678_135496 | 3300049459 | Bacteria | 811 |
| 1011 | Ga0495678_225402 | 3300049459 | Bacteria | 567 |
| 1012 | Ga0495682_0000213 | 3300049460 | Bacteria | 46502 |
| 1013 | Ga0495682_0001185 | 3300049460 | Bacteria | 14849 |
| 1014 | Ga0495682_0001329 | 3300049460 | Bacteria | 13707 |
| 1015 | Ga0495682_0013257 | 3300049460 | Bacteria | 3141 |
| 1016 | Ga0495682_0250408 | 3300049460 | Bacteria | 626 |
| 1017 | Ga0495682_0369401 | 3300049460 | Bacteria | 505 |
| 1018 | Ga0501032_0008112 | 3300049569 | Bacteria | 7657 |
| 1019 | Ga0501032_0549392 | 3300049569 | Bacteria | 736 |
| 1020 | Ga0501033_0169268 | 3300049570 | Bacteria | 1570 |
| 1021 | Ga0501034_0063993 | 3300049571 | Bacteria | 3692 |
| 1022 | Ga0501034_0393148 | 3300049571 | Bacteria | 1310 |
| 1023 | Ga0501039_0887325 | 3300049575 | Bacteria | 694 |
| 1024 | Ga0501035_0330596 | 3300049822 | Bacteria | 1279 |
| 1025 | Ga0501226_000014 | 3300049853 | Bacteria | 166091 |
| 1026 | nmdc:mga00v17_36416_c1 | 3300050491 | Bacteria | 2932 |
| 1027 | nmdc:mga00v17_528181_c1 | 3300050491 | Bacteria | 764 |
| 1028 | nmdc:mga08x19_186197_c1 | 3300050514 | Bacteria | 1419 |
| 1029 | nmdc:mga08x19_26948_c1 | 3300050514 | Bacteria | 3591 |
| 1030 | Ga0500572_008391 | 3300053111 | Bacteria | 2413 |
| 1031 | Ga0500618_003789 | 3300053125 | Bacteria | 5052 |
| 1032 | Ga0500618_125766 | 3300053125 | Bacteria | 581 |
| 1033 | Ga0500573_0039775 | 3300053140 | Bacteria | 2716 |
| 1034 | Ga0500577_0107555 | 3300053142 | Bacteria | 1147 |
| 1035 | Ga0500586_028477 | 3300053145 | Bacteria | 1825 |
| 1036 | Ga0500634_0001481 | 3300053161 | Bacteria | 9165 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046557 | Ga0495622_0042822 | Ga0495622_0042822_487_801 | 90 |
| 2 | 3300049569 | Ga0501032_0549392 | Ga0501032_0549392_337_651 | 98 |
| 3 | 3300049570 | Ga0501033_0169268 | Ga0501033_0169268_108_422 | 98 |
| 4 | 3300049822 | Ga0501035_0330596 | Ga0501035_0330596_699_1013 | 98 |
| 5 | iso_pu_bacteria | 8056125926 | 8056130207 | 98 |
| 6 | 3300027907 | Ga0207428_10034107 | Ga0207428_100341071 | 99 |
| 7 | 3300050514 | nmdc:mga08x19_186197_c1 | nmdc:mga08x19_186197_c1_862_1224 | 99 |
| 8 | iso_pu_bacteria | 2808606379 | 2808939202 | 99 |
| 9 | iso_pu_bacteria | 2842805378 | 2842809562 | 99 |
| 10 | iso_pu_bacteria | 640427133 | 640488501 | 99 |
| 11 | iso_pu_bacteria | 651053060 | 651176538 | 99 |
| 12 | iso_pu_bacteria | 2728369097 | 2729148331 | 100 |
| 13 | iso_pu_bacteria | 2811994881 | 2812365905 | 100 |
| 14 | iso_pu_bacteria | 2923519811 | 2923519926 | 100 |
| 15 | 3300006058 | Ga0075432_10419162 | Ga0075432_104191621 | 101 |
| 16 | 3300031824 | Ga0307413_10034240 | Ga0307413_100342404 | 101 |
| 17 | 3300032004 | Ga0307414_10317162 | Ga0307414_103171622 | 101 |
| 18 | 3300041404 | Ga0439436_0002308 | Ga0439436_0002308_3559_3897 | 101 |
| 19 | 3300041405 | Ga0439438_001957 | Ga0439438_001957_3559_3897 | 101 |
| 20 | 3300041407 | Ga0439447_001168 | Ga0439447_001168_47_385 | 101 |
| 21 | 3300041411 | Ga0439466_0003521 | Ga0439466_0003521_996_1334 | 101 |
| 22 | 3300041411 | Ga0439466_0013506 | Ga0439466_0013506_175_513 | 101 |
| 23 | 3300041997 | Ga0439431_0027336 | Ga0439431_0027336_516_854 | 101 |
| 24 | 3300042006 | Ga0439432_002029 | Ga0439432_002029_6793_7131 | 101 |
| 25 | 3300042006 | Ga0439432_042238 | Ga0439432_042238_211_549 | 101 |
| 26 | 3300042010 | Ga0439452_001645 | Ga0439452_001645_3574_3912 | 101 |
| 27 | 3300042185 | Ga0450909_013668 | Ga0450909_013668_346_684 | 101 |
| 28 | 3300042435 | Ga0439434_0009926 | Ga0439434_0009926_858_1196 | 101 |
| 29 | 3300046501 | Ga0495607_0036468 | Ga0495607_0036468_2562_2870 | 101 |
| 30 | 3300046692 | Ga0495671_0012911 | Ga0495671_0012911_55_363 | 101 |
| 31 | iso_pu_bacteria | 8011350971 | 8011354398 | 101 |
| 32 | iso_pu_bacteria | 8052494512 | 8052498459 | 101 |
| 33 | 3300027252 | Ga0209973_1009174 | Ga0209973_10091743 | 102 |
| 34 | 3300027395 | Ga0209996_1001433 | Ga0209996_10014332 | 102 |
| 35 | 3300027424 | Ga0209984_1002443 | Ga0209984_10024433 | 102 |
| 36 | 3300027526 | Ga0209968_1011170 | Ga0209968_10111702 | 102 |
| 37 | 3300027617 | Ga0210002_1042986 | Ga0210002_10429862 | 102 |
| 38 | 3300027665 | Ga0209983_1001930 | Ga0209983_10019307 | 102 |
| 39 | 3300027682 | Ga0209971_1004024 | Ga0209971_10040244 | 102 |
| 40 | 3300032002 | Ga0307416_100553357 | Ga0307416_1005533572 | 102 |
| 41 | 3300032004 | Ga0307414_10405551 | Ga0307414_104055512 | 102 |
| 42 | 3300042185 | Ga0450909_065048 | Ga0450909_065048_222_548 | 102 |
| 43 | 3300046455 | Ga0495603_0014388 | Ga0495603_0014388_1596_1931 | 102 |
| 44 | 3300046492 | Ga0495585_0007718 | Ga0495585_0007718_5984_6316 | 102 |
| 45 | 3300046501 | Ga0495607_0003469 | Ga0495607_0003469_6304_6639 | 102 |
| 46 | 3300046520 | Ga0495637_0066869 | Ga0495637_0066869_455_781 | 102 |
| 47 | 3300046520 | Ga0495637_0091323 | Ga0495637_0091323_594_929 | 102 |
| 48 | 3300046665 | Ga0495661_0000095 | Ga0495661_0000095_69451_69783 | 102 |
| 49 | 3300046692 | Ga0495671_0186794 | Ga0495671_0186794_55_381 | 102 |
| 50 | 3300046694 | Ga0495649_0002258 | Ga0495649_0002258_1688_2023 | 102 |
| 51 | 3300047323 | Ga0495683_0000089 | Ga0495683_0000089_16692_17027 | 102 |
| 52 | 3300053125 | Ga0500618_003789 | Ga0500618_003789_3675_3992 | 102 |
| 53 | iso_pu_bacteria | 2599185155 | 2599330481 | 102 |
| 54 | iso_pu_bacteria | 2738541271 | 2738691748 | 102 |
| 55 | iso_pu_bacteria | 2738543016 | 2739267522 | 102 |
| 56 | iso_pu_bacteria | 2808606373 | 2808904055 | 102 |
| 57 | iso_pu_bacteria | 2826581358 | 2826585241 | 102 |
| 58 | iso_pu_bacteria | 2842815866 | 2842818848 | 102 |
| 59 | iso_pu_bacteria | 2842849001 | 2842853558 | 102 |
| 60 | iso_pu_bacteria | 2990196909 | 2990198887 | 102 |
| 61 | 3300003781 | Ga0055536_1000165 | Ga0055536_100016548 | 103 |
| 62 | 3300003791 | Ga0055530_10001115 | Ga0055530_1000111518 | 103 |
| 63 | 3300003792 | Ga0055540_1001167 | Ga0055540_10011674 | 103 |
| 64 | 3300013104 | Ga0157370_10006411 | Ga0157370_100064114 | 103 |
| 65 | 3300013104 | Ga0157370_10253639 | Ga0157370_102536392 | 103 |
| 66 | 3300025284 | Ga0209130_1022427 | Ga0209130_10224273 | 103 |
| 67 | 3300025292 | Ga0209676_1000021 | Ga0209676_1000021215 | 103 |
| 68 | 3300025298 | Ga0209050_1000595 | Ga0209050_100059549 | 103 |
| 69 | 3300025303 | Ga0209051_1000407 | Ga0209051_100040712 | 103 |
| 70 | 3300025304 | Ga0209257_1031961 | Ga0209257_10319612 | 103 |
| 71 | 3300046507 | Ga0495606_0000669 | Ga0495606_0000669_40355_40687 | 103 |
| 72 | 3300046522 | Ga0495643_0004890 | Ga0495643_0004890_2857_3189 | 103 |
| 73 | 3300046692 | Ga0495671_0342924 | Ga0495671_0342924_319_651 | 103 |
| 74 | 3300046694 | Ga0495649_0002986 | Ga0495649_0002986_9590_9922 | 103 |
| 75 | 3300046694 | Ga0495649_0041888 | Ga0495649_0041888_577_909 | 103 |
| 76 | 3300049459 | Ga0495678_011151 | Ga0495678_011151_742_1074 | 103 |
| 77 | 3300049571 | Ga0501034_0063993 | Ga0501034_0063993_42_371 | 103 |
| 78 | iso_pu_bacteria | 2600254954 | 2600446761 | 103 |
| 79 | iso_pu_bacteria | 2600255283 | 2601625172 | 103 |
| 80 | iso_pu_bacteria | 2600255389 | 2602010701 | 103 |
| 81 | iso_pu_bacteria | 2823421272 | 2823423263 | 103 |
| 82 | iso_pu_bacteria | 2842854478 | 2842854557 | 103 |
| 83 | iso_pu_bacteria | 2919501602 | 2919505382 | 103 |
| 84 | iso_pu_bacteria | 2926063275 | 2926067059 | 103 |
| 85 | iso_pu_bacteria | 8034962539 | 8034963820 | 103 |
| 86 | iso_pu_bacteria | 8056143049 | 8056147357 | 103 |
| 87 | 3300006186 | Ga0075369_10578558 | Ga0075369_105785581 | 104 |
| 88 | 3300009011 | Ga0105251_10000093 | Ga0105251_100000931 | 104 |
| 89 | 3300009092 | Ga0105250_10000074 | Ga0105250_1000007420 | 104 |
| 90 | 3300013102 | Ga0157371_10000546 | Ga0157371_1000054615 | 104 |
| 91 | 3300025711 | Ga0207696_1000045 | Ga0207696_1000045301 | 104 |
| 92 | 3300025735 | Ga0207713_1000030 | Ga0207713_1000030288 | 104 |
| 93 | 3300027907 | Ga0207428_10016748 | Ga0207428_100167483 | 104 |
| 94 | 3300042156 | Ga0439446_0002949 | Ga0439446_0002949_3328_3660 | 104 |
| 95 | 3300046452 | Ga0495617_240028 | Ga0495617_240028_73_390 | 104 |
| 96 | 3300046453 | Ga0495627_000515 | Ga0495627_000515_17517_17834 | 104 |
| 97 | 3300046471 | Ga0495650_0005660 | Ga0495650_0005660_4246_4563 | 104 |
| 98 | 3300046471 | Ga0495650_0018333 | Ga0495650_0018333_1410_1727 | 104 |
| 99 | 3300046506 | Ga0495583_0001185 | Ga0495583_0001185_22582_22899 | 104 |
| 100 | 3300046512 | Ga0495610_0022969 | Ga0495610_0022969_1897_2214 | 104 |
| 101 | 3300046518 | Ga0495631_0003133 | Ga0495631_0003133_3499_3816 | 104 |
| 102 | 3300046519 | Ga0495632_0010370 | Ga0495632_0010370_228_545 | 104 |
| 103 | 3300046519 | Ga0495632_0012404 | Ga0495632_0012404_1035_1352 | 104 |
| 104 | 3300046530 | Ga0495654_0001351 | Ga0495654_0001351_10556_10873 | 104 |
| 105 | 3300046543 | Ga0495645_0677434 | Ga0495645_0677434_216_533 | 104 |
| 106 | 3300046665 | Ga0495661_0000208 | Ga0495661_0000208_57270_57587 | 104 |
| 107 | 3300046692 | Ga0495671_0007745 | Ga0495671_0007745_1815_2132 | 104 |
| 108 | 3300046692 | Ga0495671_0609496 | Ga0495671_0609496_10_327 | 104 |
| 109 | 3300046810 | Ga0495660_0055028 | Ga0495660_0055028_455_772 | 104 |
| 110 | 3300047320 | Ga0495672_0003431 | Ga0495672_0003431_4881_5198 | 104 |
| 111 | 3300047469 | Ga0495673_0083411 | Ga0495673_0083411_762_1079 | 104 |
| 112 | 3300049460 | Ga0495682_0000213 | Ga0495682_0000213_20339_20656 | 104 |
| 113 | iso_pu_bacteria | 3007315729 | 3007318959 | 104 |
| 114 | 3300005288 | Ga0065714_10080800 | Ga0065714_100808003 | 105 |
| 115 | 3300005290 | Ga0065712_10068150 | Ga0065712_100681502 | 105 |
| 116 | 3300009011 | Ga0105251_10045755 | Ga0105251_100457552 | 105 |
| 117 | 3300009036 | Ga0105244_10000425 | Ga0105244_100004258 | 105 |
| 118 | 3300009036 | Ga0105244_10022723 | Ga0105244_100227231 | 105 |
| 119 | 3300014497 | Ga0182008_10005526 | Ga0182008_100055265 | 105 |
| 120 | 3300015265 | Ga0182005_1006110 | Ga0182005_10061102 | 105 |
| 121 | 3300017792 | Ga0163161_10821983 | Ga0163161_108219831 | 105 |
| 122 | 3300025728 | Ga0207655_1009296 | Ga0207655_10092964 | 105 |
| 123 | 3300025735 | Ga0207713_1103409 | Ga0207713_11034092 | 105 |
| 124 | 3300041408 | Ga0439453_0118321 | Ga0439453_0118321_113_457 | 105 |
| 125 | 3300041411 | Ga0439466_0031227 | Ga0439466_0031227_939_1262 | 105 |
| 126 | 3300041997 | Ga0439431_0031989 | Ga0439431_0031989_339_683 | 105 |
| 127 | 3300042000 | Ga0439437_001530 | Ga0439437_001530_2052_2396 | 105 |
| 128 | 3300042006 | Ga0439432_002162 | Ga0439432_002162_5658_5996 | 105 |
| 129 | 3300042012 | Ga0439455_0009878 | Ga0439455_0009878_284_628 | 105 |
| 130 | 3300042013 | Ga0439456_041604 | Ga0439456_041604_600_944 | 105 |
| 131 | 3300042016 | Ga0439463_000685 | Ga0439463_000685_4187_4504 | 105 |
| 132 | 3300042115 | Ga0450911_000001 | Ga0450911_000001_216021_216365 | 105 |
| 133 | 3300042120 | Ga0450917_001875 | Ga0450917_001875_892_1236 | 105 |
| 134 | 3300042138 | Ga0450903_007378 | Ga0450903_007378_549_893 | 105 |
| 135 | 3300042139 | Ga0450904_000013 | Ga0450904_000013_33744_34088 | 105 |
| 136 | 3300042142 | Ga0450905_001551 | Ga0450905_001551_865_1203 | 105 |
| 137 | 3300042156 | Ga0439446_0020995 | Ga0439446_0020995_1151_1495 | 105 |
| 138 | 3300042438 | Ga0439459_0073899 | Ga0439459_0073899_138_482 | 105 |
| 139 | 3300042439 | Ga0439464_0000553 | Ga0439464_0000553_5146_5487 | 105 |
| 140 | 3300042530 | Ga0450916_044058 | Ga0450916_044058_16_360 | 105 |
| 141 | 3300042532 | Ga0450893_0000927 | Ga0450893_0000927_3464_3808 | 105 |
| 142 | 3300042533 | Ga0450901_010845 | Ga0450901_010845_149_493 | 105 |
| 143 | 3300046452 | Ga0495617_136067 | Ga0495617_136067_125_445 | 105 |
| 144 | 3300046453 | Ga0495627_000013 | Ga0495627_000013_221938_222261 | 105 |
| 145 | 3300046453 | Ga0495627_016690 | Ga0495627_016690_590_913 | 105 |
| 146 | 3300046453 | Ga0495627_022975 | Ga0495627_022975_393_713 | 105 |
| 147 | 3300046458 | Ga0495591_000020 | Ga0495591_000020_150531_150854 | 105 |
| 148 | 3300046458 | Ga0495591_001051 | Ga0495591_001051_7255_7575 | 105 |
| 149 | 3300046458 | Ga0495591_001253 | Ga0495591_001253_5495_5812 | 105 |
| 150 | 3300046460 | Ga0495638_0076010 | Ga0495638_0076010_329_649 | 105 |
| 151 | 3300046463 | Ga0495653_0001863 | Ga0495653_0001863_5233_5616 | 105 |
| 152 | 3300046471 | Ga0495650_0023129 | Ga0495650_0023129_1896_2219 | 105 |
| 153 | 3300046474 | Ga0495605_0000032 | Ga0495605_0000032_140468_140791 | 105 |
| 154 | 3300046474 | Ga0495605_0000047 | Ga0495605_0000047_85090_85410 | 105 |
| 155 | 3300046474 | Ga0495605_0000525 | Ga0495605_0000525_22169_22486 | 105 |
| 156 | 3300046474 | Ga0495605_0002483 | Ga0495605_0002483_10936_11259 | 105 |
| 157 | 3300046474 | Ga0495605_0008789 | Ga0495605_0008789_427_747 | 105 |
| 158 | 3300046474 | Ga0495605_0044971 | Ga0495605_0044971_1826_2149 | 105 |
| 159 | 3300046474 | Ga0495605_0105752 | Ga0495605_0105752_842_1165 | 105 |
| 160 | 3300046474 | Ga0495605_0460213 | Ga0495605_0460213_119_439 | 105 |
| 161 | 3300046474 | Ga0495605_0490933 | Ga0495605_0490933_21_341 | 105 |
| 162 | 3300046499 | Ga0495594_0000964 | Ga0495594_0000964_5255_5578 | 105 |
| 163 | 3300046501 | Ga0495607_0000307 | Ga0495607_0000307_43714_44037 | 105 |
| 164 | 3300046501 | Ga0495607_0001899 | Ga0495607_0001899_7523_7840 | 105 |
| 165 | 3300046501 | Ga0495607_0002088 | Ga0495607_0002088_11765_12088 | 105 |
| 166 | 3300046501 | Ga0495607_0011080 | Ga0495607_0011080_372_692 | 105 |
| 167 | 3300046501 | Ga0495607_0027857 | Ga0495607_0027857_823_1143 | 105 |
| 168 | 3300046501 | Ga0495607_0079730 | Ga0495607_0079730_1007_1327 | 105 |
| 169 | 3300046501 | Ga0495607_0119336 | Ga0495607_0119336_564_887 | 105 |
| 170 | 3300046501 | Ga0495607_0160735 | Ga0495607_0160735_639_959 | 105 |
| 171 | 3300046501 | Ga0495607_0285744 | Ga0495607_0285744_121_441 | 105 |
| 172 | 3300046501 | Ga0495607_0392143 | Ga0495607_0392143_287_610 | 105 |
| 173 | 3300046506 | Ga0495583_0000052 | Ga0495583_0000052_141828_142151 | 105 |
| 174 | 3300046506 | Ga0495583_0009851 | Ga0495583_0009851_3885_4205 | 105 |
| 175 | 3300046506 | Ga0495583_0012088 | Ga0495583_0012088_3454_3771 | 105 |
| 176 | 3300046507 | Ga0495606_0000698 | Ga0495606_0000698_40494_40877 | 105 |
| 177 | 3300046507 | Ga0495606_0002877 | Ga0495606_0002877_10466_10783 | 105 |
| 178 | 3300046507 | Ga0495606_0042510 | Ga0495606_0042510_1307_1627 | 105 |
| 179 | 3300046507 | Ga0495606_0121457 | Ga0495606_0121457_60_380 | 105 |
| 180 | 3300046507 | Ga0495606_0239986 | Ga0495606_0239986_126_449 | 105 |
| 181 | 3300046512 | Ga0495610_0018130 | Ga0495610_0018130_1992_2315 | 105 |
| 182 | 3300046513 | Ga0495616_0149604 | Ga0495616_0149604_496_879 | 105 |
| 183 | 3300046515 | Ga0495620_0000019 | Ga0495620_0000019_141154_141477 | 105 |
| 184 | 3300046515 | Ga0495620_0003560 | Ga0495620_0003560_1408_1725 | 105 |
| 185 | 3300046515 | Ga0495620_0054930 | Ga0495620_0054930_570_887 | 105 |
| 186 | 3300046518 | Ga0495631_0012360 | Ga0495631_0012360_3569_3892 | 105 |
| 187 | 3300046520 | Ga0495637_0000023 | Ga0495637_0000023_2953_3273 | 105 |
| 188 | 3300046520 | Ga0495637_0048706 | Ga0495637_0048706_738_1061 | 105 |
| 189 | 3300046520 | Ga0495637_0070580 | Ga0495637_0070580_751_1134 | 105 |
| 190 | 3300046520 | Ga0495637_0130973 | Ga0495637_0130973_544_867 | 105 |
| 191 | 3300046524 | Ga0495648_0012794 | Ga0495648_0012794_5802_6125 | 105 |
| 192 | 3300046530 | Ga0495654_0001730 | Ga0495654_0001730_1522_1845 | 105 |
| 193 | 3300046538 | Ga0495609_0000032 | Ga0495609_0000032_69734_70057 | 105 |
| 194 | 3300046538 | Ga0495609_0000807 | Ga0495609_0000807_12892_13212 | 105 |
| 195 | 3300046538 | Ga0495609_0010529 | Ga0495609_0010529_1438_1758 | 105 |
| 196 | 3300046542 | Ga0495597_0000004 | Ga0495597_0000004_217378_217701 | 105 |
| 197 | 3300046542 | Ga0495597_0002903 | Ga0495597_0002903_6758_7081 | 105 |
| 198 | 3300046543 | Ga0495645_0260605 | Ga0495645_0260605_449_769 | 105 |
| 199 | 3300046557 | Ga0495622_0014421 | Ga0495622_0014421_2980_3300 | 105 |
| 200 | 3300046558 | Ga0495633_0000040 | Ga0495633_0000040_36067_36390 | 105 |
| 201 | 3300046616 | Ga0495668_0060256 | Ga0495668_0060256_224_547 | 105 |
| 202 | 3300046616 | Ga0495668_0061005 | Ga0495668_0061005_1464_1781 | 105 |
| 203 | 3300046648 | Ga0495611_0007814 | Ga0495611_0007814_1294_1617 | 105 |
| 204 | 3300046660 | Ga0495625_0214390 | Ga0495625_0214390_342_665 | 105 |
| 205 | 3300046665 | Ga0495661_0000037 | Ga0495661_0000037_139890_140213 | 105 |
| 206 | 3300046665 | Ga0495661_0119376 | Ga0495661_0119376_891_1208 | 105 |
| 207 | 3300046674 | Ga0495588_0538143 | Ga0495588_0538143_174_497 | 105 |
| 208 | 3300046691 | Ga0495670_0085906 | Ga0495670_0085906_639_959 | 105 |
| 209 | 3300046691 | Ga0495670_0087525 | Ga0495670_0087525_1008_1331 | 105 |
| 210 | 3300046692 | Ga0495671_0013658 | Ga0495671_0013658_3654_3977 | 105 |
| 211 | 3300046794 | Ga0495589_0000618 | Ga0495589_0000618_22218_22541 | 105 |
| 212 | 3300046810 | Ga0495660_0000768 | Ga0495660_0000768_6323_6646 | 105 |
| 213 | 3300046810 | Ga0495660_0000771 | Ga0495660_0000771_245_568 | 105 |
| 214 | 3300046810 | Ga0495660_0001378 | Ga0495660_0001378_7024_7347 | 105 |
| 215 | 3300047320 | Ga0495672_0005720 | Ga0495672_0005720_5663_5986 | 105 |
| 216 | 3300047320 | Ga0495672_0036156 | Ga0495672_0036156_177_500 | 105 |
| 217 | 3300047321 | Ga0495676_0000002 | Ga0495676_0000002_107167_107487 | 105 |
| 218 | 3300047323 | Ga0495683_0000011 | Ga0495683_0000011_141993_142316 | 105 |
| 219 | 3300047446 | Ga0495679_001367 | Ga0495679_001367_12680_13003 | 105 |
| 220 | 3300047469 | Ga0495673_0000563 | Ga0495673_0000563_15381_15701 | 105 |
| 221 | 3300047469 | Ga0495673_0003010 | Ga0495673_0003010_1948_2271 | 105 |
| 222 | 3300047469 | Ga0495673_0012794 | Ga0495673_0012794_3543_3860 | 105 |
| 223 | 3300047469 | Ga0495673_0085618 | Ga0495673_0085618_392_709 | 105 |
| 224 | 3300047470 | Ga0495681_0026289 | Ga0495681_0026289_844_1167 | 105 |
| 225 | 3300047472 | Ga0495686_0009309 | Ga0495686_0009309_3477_3797 | 105 |
| 226 | 3300048913 | Ga0496110_1223307 | Ga0496110_1223307_206_523 | 105 |
| 227 | 3300048914 | Ga0496111_0800673 | Ga0496111_0800673_248_565 | 105 |
| 228 | 3300048915 | Ga0496112_0336917 | Ga0496112_0336917_911_1228 | 105 |
| 229 | 3300048915 | Ga0496112_1564363 | Ga0496112_1564363_105_425 | 105 |
| 230 | 3300048919 | Ga0496116_0044766 | Ga0496116_0044766_2358_2675 | 105 |
| 231 | 3300048920 | Ga0496117_0063805 | Ga0496117_0063805_617_937 | 105 |
| 232 | 3300048920 | Ga0496117_0209027 | Ga0496117_0209027_73_390 | 105 |
| 233 | 3300048921 | Ga0496118_0064986 | Ga0496118_0064986_1035_1352 | 105 |
| 234 | 3300048924 | Ga0496121_0006247 | Ga0496121_0006247_6551_6871 | 105 |
| 235 | 3300048924 | Ga0496121_0010756 | Ga0496121_0010756_2462_2779 | 105 |
| 236 | 3300048924 | Ga0496121_0486139 | Ga0496121_0486139_250_567 | 105 |
| 237 | 3300048925 | Ga0496122_0001761 | Ga0496122_0001761_10875_11195 | 105 |
| 238 | 3300048925 | Ga0496122_0034212 | Ga0496122_0034212_1803_2126 | 105 |
| 239 | 3300048925 | Ga0496122_0048132 | Ga0496122_0048132_2099_2416 | 105 |
| 240 | 3300048926 | Ga0496123_0000087 | Ga0496123_0000087_281_601 | 105 |
| 241 | 3300048926 | Ga0496123_0023965 | Ga0496123_0023965_3627_3944 | 105 |
| 242 | 3300048926 | Ga0496123_0029506 | Ga0496123_0029506_1910_2233 | 105 |
| 243 | 3300048927 | Ga0496124_0000807 | Ga0496124_0000807_26417_26737 | 105 |
| 244 | 3300048927 | Ga0496124_0019173 | Ga0496124_0019173_5427_5744 | 105 |
| 245 | 3300048927 | Ga0496124_0079625 | Ga0496124_0079625_662_979 | 105 |
| 246 | 3300048927 | Ga0496124_0083036 | Ga0496124_0083036_310_633 | 105 |
| 247 | 3300048927 | Ga0496124_0233131 | Ga0496124_0233131_147_488 | 105 |
| 248 | 3300049459 | Ga0495678_000033 | Ga0495678_000033_70321_70644 | 105 |
| 249 | 3300049459 | Ga0495678_007950 | Ga0495678_007950_3372_3755 | 105 |
| 250 | 3300049460 | Ga0495682_0001185 | Ga0495682_0001185_7395_7712 | 105 |
| 251 | 3300049569 | Ga0501032_0008112 | Ga0501032_0008112_2557_2892 | 105 |
| 252 | 3300049571 | Ga0501034_0393148 | Ga0501034_0393148_635_970 | 105 |
| 253 | 3300049575 | Ga0501039_0887325 | Ga0501039_0887325_297_632 | 105 |
| 254 | 3300049853 | Ga0501226_000014 | Ga0501226_000014_58146_58490 | 105 |
| 255 | 3300053125 | Ga0500618_125766 | Ga0500618_125766_179_502 | 105 |
| 256 | 3300053140 | Ga0500573_0039775 | Ga0500573_0039775_678_1001 | 105 |
| 257 | 3300053142 | Ga0500577_0107555 | Ga0500577_0107555_340_660 | 105 |
| 258 | 3300053145 | Ga0500586_028477 | Ga0500586_028477_192_515 | 105 |
| 259 | iso_pu_bacteria | 2511231004 | 2511252476 | 105 |
| 260 | iso_pu_bacteria | 2511231006 | 2511263682 | 105 |
| 261 | iso_pu_bacteria | 2511231007 | 2511272399 | 105 |
| 262 | iso_pu_bacteria | 2511231011 | 2511293831 | 105 |
| 263 | iso_pu_bacteria | 2511231016 | 2511329364 | 105 |
| 264 | iso_pu_bacteria | 2511231031 | 2511416304 | 105 |
| 265 | iso_pu_bacteria | 2511231156 | 2511823584 | 105 |
| 266 | iso_pu_bacteria | 2512047018 | 2512324903 | 105 |
| 267 | iso_pu_bacteria | 2554235341 | 2555668658 | 105 |
| 268 | iso_pu_bacteria | 2582580891 | 2583791029 | 105 |
| 269 | iso_pu_bacteria | 2597489887 | 2597856826 | 105 |
| 270 | iso_pu_bacteria | 2597489888 | 2597863037 | 105 |
| 271 | iso_pu_bacteria | 2597489889 | 2597868829 | 105 |
| 272 | iso_pu_bacteria | 2599185160 | 2599357029 | 105 |
| 273 | iso_pu_bacteria | 2599185161 | 2599362184 | 105 |
| 274 | iso_pu_bacteria | 2599185162 | 2599368504 | 105 |
| 275 | iso_pu_bacteria | 2599185163 | 2599375293 | 105 |
| 276 | iso_pu_bacteria | 2599185164 | 2599382134 | 105 |
| 277 | iso_pu_bacteria | 2599185165 | 2599388581 | 105 |
| 278 | iso_pu_bacteria | 2599185166 | 2599394151 | 105 |
| 279 | iso_pu_bacteria | 2599185167 | 2599401619 | 105 |
| 280 | iso_pu_bacteria | 2599185168 | 2599405916 | 105 |
| 281 | iso_pu_bacteria | 2599185179 | 2599451840 | 105 |
| 282 | iso_pu_bacteria | 2599185181 | 2599464466 | 105 |
| 283 | iso_pu_bacteria | 2599185182 | 2599468790 | 105 |
| 284 | iso_pu_bacteria | 2599185185 | 2599483849 | 105 |
| 285 | iso_pu_bacteria | 2599185186 | 2599493489 | 105 |
| 286 | iso_pu_bacteria | 2599185188 | 2599504073 | 105 |
| 287 | iso_pu_bacteria | 2599185189 | 2599509610 | 105 |
| 288 | iso_pu_bacteria | 2599185190 | 2599514863 | 105 |
| 289 | iso_pu_bacteria | 2599185191 | 2599520961 | 105 |
| 290 | iso_pu_bacteria | 2599185212 | 2599611730 | 105 |
| 291 | iso_pu_bacteria | 2599185248 | 2599770173 | 105 |
| 292 | iso_pu_bacteria | 2599185257 | 2599801495 | 105 |
| 293 | iso_pu_bacteria | 2599185289 | 2599887627 | 105 |
| 294 | iso_pu_bacteria | 2599185290 | 2599894340 | 105 |
| 295 | iso_pu_bacteria | 2599185291 | 2599899894 | 105 |
| 296 | iso_pu_bacteria | 2599185300 | 2599932034 | 105 |
| 297 | iso_pu_bacteria | 2599185302 | 2599941900 | 105 |
| 298 | iso_pu_bacteria | 2599185304 | 2599952580 | 105 |
| 299 | iso_pu_bacteria | 2599185305 | 2599960471 | 105 |
| 300 | iso_pu_bacteria | 2599185306 | 2599965379 | 105 |
| 301 | iso_pu_bacteria | 2599185308 | 2599978482 | 105 |
| 302 | iso_pu_bacteria | 2599185309 | 2599982064 | 105 |
| 303 | iso_pu_bacteria | 2599185310 | 2599987974 | 105 |
| 304 | iso_pu_bacteria | 2599185311 | 2599995675 | 105 |
| 305 | iso_pu_bacteria | 2599185312 | 2599998136 | 105 |
| 306 | iso_pu_bacteria | 2599185313 | 2600008613 | 105 |
| 307 | iso_pu_bacteria | 2599185314 | 2600010611 | 105 |
| 308 | iso_pu_bacteria | 2599185315 | 2600017489 | 105 |
| 309 | iso_pu_bacteria | 2599185316 | 2600025505 | 105 |
| 310 | iso_pu_bacteria | 2599185317 | 2600027742 | 105 |
| 311 | iso_pu_bacteria | 2599185318 | 2600034508 | 105 |
| 312 | iso_pu_bacteria | 2599185319 | 2600041651 | 105 |
| 313 | iso_pu_bacteria | 2599185320 | 2600046302 | 105 |
| 314 | iso_pu_bacteria | 2599185321 | 2600052313 | 105 |
| 315 | iso_pu_bacteria | 2599185322 | 2600057678 | 105 |
| 316 | iso_pu_bacteria | 2599185323 | 2600065115 | 105 |
| 317 | iso_pu_bacteria | 2599185324 | 2600073741 | 105 |
| 318 | iso_pu_bacteria | 2599185325 | 2600078789 | 105 |
| 319 | iso_pu_bacteria | 2599185356 | 2600216743 | 105 |
| 320 | iso_pu_bacteria | 2600254930 | 2600356549 | 105 |
| 321 | iso_pu_bacteria | 2600254931 | 2600365796 | 105 |
| 322 | iso_pu_bacteria | 2600255296 | 2601694254 | 105 |
| 323 | iso_pu_bacteria | 2600255313 | 2601776660 | 105 |
| 324 | iso_pu_bacteria | 2600255318 | 2601795482 | 105 |
| 325 | iso_pu_bacteria | 2603880185 | 2606075551 | 105 |
| 326 | iso_pu_bacteria | 2603880199 | 2606128537 | 105 |
| 327 | iso_pu_bacteria | 2606217733 | 2608380337 | 105 |
| 328 | iso_pu_bacteria | 2619619299 | 2621300889 | 105 |
| 329 | iso_pu_bacteria | 2623620443 | 2624479419 | 105 |
| 330 | iso_pu_bacteria | 2643221571 | 2643871627 | 105 |
| 331 | iso_pu_bacteria | 2643221589 | 2643952554 | 105 |
| 332 | iso_pu_bacteria | 2643221602 | 2644022316 | 105 |
| 333 | iso_pu_bacteria | 2643221633 | 2644187173 | 105 |
| 334 | iso_pu_bacteria | 2643221650 | 2644281732 | 105 |
| 335 | iso_pu_bacteria | 2643221713 | 2644623138 | 105 |
| 336 | iso_pu_bacteria | 2651869719 | 2652544728 | 105 |
| 337 | iso_pu_bacteria | 2667528170 | 2671090288 | 105 |
| 338 | iso_pu_bacteria | 2667528171 | 2671098823 | 105 |
| 339 | iso_pu_bacteria | 2667528176 | 2671125906 | 105 |
| 340 | iso_pu_bacteria | 2671180172 | 2671768444 | 105 |
| 341 | iso_pu_bacteria | 2675903420 | 2677896875 | 105 |
| 342 | iso_pu_bacteria | 2675903515 | 2678262504 | 105 |
| 343 | iso_pu_bacteria | 2713897148 | 2715753816 | 105 |
| 344 | iso_pu_bacteria | 2713897149 | 2715757685 | 105 |
| 345 | iso_pu_bacteria | 2721755607 | 2723247854 | 105 |
| 346 | iso_pu_bacteria | 2738541265 | 2738670486 | 105 |
| 347 | iso_pu_bacteria | 2738541282 | 2738748879 | 105 |
| 348 | iso_pu_bacteria | 2738541303 | 2738857921 | 105 |
| 349 | iso_pu_bacteria | 2738543025 | 2739316039 | 105 |
| 350 | iso_pu_bacteria | 2740892503 | 2743736254 | 105 |
| 351 | iso_pu_bacteria | 2744054620 | 2745008846 | 105 |
| 352 | iso_pu_bacteria | 2773857670 | 2774122857 | 105 |
| 353 | iso_pu_bacteria | 2773857673 | 2774137576 | 105 |
| 354 | iso_pu_bacteria | 2784132063 | 2784265675 | 105 |
| 355 | iso_pu_bacteria | 2784132072 | 2784315215 | 105 |
| 356 | iso_pu_bacteria | 2791355520 | 2794596311 | 105 |
| 357 | iso_pu_bacteria | 2808606361 | 2808856127 | 105 |
| 358 | iso_pu_bacteria | 2808606376 | 2808923595 | 105 |
| 359 | iso_pu_bacteria | 2808606377 | 2808927347 | 105 |
| 360 | iso_pu_bacteria | 2808606378 | 2808936122 | 105 |
| 361 | iso_pu_bacteria | 2808606380 | 2808945642 | 105 |
| 362 | iso_pu_bacteria | 2808606381 | 2808950114 | 105 |
| 363 | iso_pu_bacteria | 2808606382 | 2808957670 | 105 |
| 364 | iso_pu_bacteria | 2808606383 | 2808964632 | 105 |
| 365 | iso_pu_bacteria | 2808606385 | 2808979425 | 105 |
| 366 | iso_pu_bacteria | 2808606388 | 2808995349 | 105 |
| 367 | iso_pu_bacteria | 2808606389 | 2808999520 | 105 |
| 368 | iso_pu_bacteria | 2816332298 | 2817489810 | 105 |
| 369 | iso_pu_bacteria | 2818991464 | 2819703944 | 105 |
| 370 | iso_pu_bacteria | 2825651385 | 2825653138 | 105 |
| 371 | iso_pu_bacteria | 2834028612 | 2834029687 | 105 |
| 372 | iso_pu_bacteria | 2842826826 | 2842831952 | 105 |
| 373 | iso_pu_bacteria | 2842832357 | 2842832711 | 105 |
| 374 | iso_pu_bacteria | 2842837860 | 2842841536 | 105 |
| 375 | iso_pu_bacteria | 2842843487 | 2842848205 | 105 |
| 376 | iso_pu_bacteria | 2844665904 | 2844669158 | 105 |
| 377 | iso_pu_bacteria | 2852612431 | 2852618432 | 105 |
| 378 | iso_pu_bacteria | 2852657418 | 2852658901 | 105 |
| 379 | iso_pu_bacteria | 2852667396 | 2852673432 | 105 |
| 380 | iso_pu_bacteria | 2860339153 | 2860340038 | 105 |
| 381 | iso_pu_bacteria | 2860867994 | 2860869683 | 105 |
| 382 | iso_pu_bacteria | 2878029506 | 2878031422 | 105 |
| 383 | iso_pu_bacteria | 2880230671 | 2880232290 | 105 |
| 384 | iso_pu_bacteria | 2904518522 | 2904521817 | 105 |
| 385 | iso_pu_bacteria | 2908446538 | 2908448601 | 105 |
| 386 | iso_pu_bacteria | 2913036834 | 2913038476 | 105 |
| 387 | iso_pu_bacteria | 2917070673 | 2917072430 | 105 |
| 388 | iso_pu_bacteria | 2919481497 | 2919481760 | 105 |
| 389 | iso_pu_bacteria | 2919487758 | 2919491332 | 105 |
| 390 | iso_pu_bacteria | 2923153595 | 2923155268 | 105 |
| 391 | iso_pu_bacteria | 2923586266 | 2923587403 | 105 |
| 392 | iso_pu_bacteria | 2929144301 | 2929145935 | 105 |
| 393 | iso_pu_bacteria | 2929189879 | 2929191655 | 105 |
| 394 | iso_pu_bacteria | 2931369376 | 2931370725 | 105 |
| 395 | iso_pu_bacteria | 2931390751 | 2931392755 | 105 |
| 396 | iso_pu_bacteria | 2931396565 | 2931400069 | 105 |
| 397 | iso_pu_bacteria | 2935353572 | 2935354594 | 105 |
| 398 | iso_pu_bacteria | 2939636861 | 2939639758 | 105 |
| 399 | iso_pu_bacteria | 2945928738 | 2945928911 | 105 |
| 400 | iso_pu_bacteria | 2945961074 | 2945965194 | 105 |
| 401 | iso_pu_bacteria | 2946027586 | 2946029938 | 105 |
| 402 | iso_pu_bacteria | 2947233263 | 2947236509 | 105 |
| 403 | iso_pu_bacteria | 2969304461 | 2969306205 | 105 |
| 404 | iso_pu_bacteria | 2974289157 | 2974292141 | 105 |
| 405 | iso_pu_bacteria | 2988728565 | 2988733471 | 105 |
| 406 | iso_pu_bacteria | 2998139840 | 2998141602 | 105 |
| 407 | iso_pu_bacteria | 3007395558 | 3007400809 | 105 |
| 408 | iso_pu_bacteria | 3007419365 | 3007421270 | 105 |
| 409 | iso_pu_bacteria | 3007511990 | 3007512985 | 105 |
| 410 | iso_pu_bacteria | 3007614139 | 3007617607 | 105 |
| 411 | iso_pu_bacteria | 3007718800 | 3007723345 | 105 |
| 412 | iso_pu_bacteria | 3007866637 | 3007870429 | 105 |
| 413 | iso_pu_bacteria | 637000220 | 637319017 | 105 |
| 414 | iso_pu_bacteria | 8015687852 | 8015689489 | 105 |
| 415 | iso_pu_bacteria | 8019769354 | 8019774108 | 105 |
| 416 | iso_pu_bacteria | 8054285046 | 8054288636 | 105 |
| 417 | iso_pu_bacteria | 8054347763 | 8054352116 | 105 |
| 418 | iso_pu_bacteria | 8054503363 | 8054505257 | 105 |
| 419 | iso_pu_bacteria | 8055817908 | 8055819800 | 105 |
| 420 | iso_pu_bacteria | 8056125926 | 8056130202 | 105 |
| 421 | iso_pu_bacteria | 8056131705 | 8056133584 | 105 |
| 422 | iso_pu_bacteria | 8056148874 | 8056150489 | 105 |
| 423 | iso_pu_bacteria | 8056155041 | 8056156251 | 105 |
| 424 | iso_pu_bacteria | 8056161164 | 8056165005 | 105 |
| 425 | iso_pu_bacteria | 8056172158 | 8056175574 | 105 |
| 426 | iso_pu_bacteria | 8056177738 | 8056181114 | 105 |
| 427 | iso_pu_bacteria | 8057798959 | 8057799050 | 105 |
| 428 | 3300006058 | Ga0075432_10344045 | Ga0075432_103440452 | 106 |
| 429 | 3300006914 | Ga0075436_101107710 | Ga0075436_1011077102 | 106 |
| 430 | 3300009011 | Ga0105251_10142509 | Ga0105251_101425092 | 106 |
| 431 | 3300009011 | Ga0105251_10652946 | Ga0105251_106529462 | 106 |
| 432 | 3300009036 | Ga0105244_10009403 | Ga0105244_100094032 | 106 |
| 433 | 3300009036 | Ga0105244_10014015 | Ga0105244_100140154 | 106 |
| 434 | 3300025728 | Ga0207655_1004518 | Ga0207655_10045187 | 106 |
| 435 | 3300025728 | Ga0207655_1010611 | Ga0207655_10106112 | 106 |
| 436 | 3300042010 | Ga0439452_031519 | Ga0439452_031519_81_419 | 106 |
| 437 | 3300042439 | Ga0439464_0001317 | Ga0439464_0001317_5438_5776 | 106 |
| 438 | 3300046457 | Ga0495590_0284124 | Ga0495590_0284124_165_491 | 106 |
| 439 | 3300046458 | Ga0495591_001297 | Ga0495591_001297_3068_3394 | 106 |
| 440 | 3300046458 | Ga0495591_011472 | Ga0495591_011472_90_416 | 106 |
| 441 | 3300046471 | Ga0495650_0000221 | Ga0495650_0000221_14533_14859 | 106 |
| 442 | 3300046474 | Ga0495605_0006439 | Ga0495605_0006439_5321_5647 | 106 |
| 443 | 3300046474 | Ga0495605_0077969 | Ga0495605_0077969_71_397 | 106 |
| 444 | 3300046491 | Ga0495584_0004829 | Ga0495584_0004829_1200_1526 | 106 |
| 445 | 3300046491 | Ga0495584_0004946 | Ga0495584_0004946_1978_2304 | 106 |
| 446 | 3300046492 | Ga0495585_0143985 | Ga0495585_0143985_396_722 | 106 |
| 447 | 3300046500 | Ga0495596_0051855 | Ga0495596_0051855_183_509 | 106 |
| 448 | 3300046501 | Ga0495607_0001496 | Ga0495607_0001496_20021_20347 | 106 |
| 449 | 3300046501 | Ga0495607_0011595 | Ga0495607_0011595_5461_5787 | 106 |
| 450 | 3300046506 | Ga0495583_0001288 | Ga0495583_0001288_21954_22280 | 106 |
| 451 | 3300046506 | Ga0495583_0006885 | Ga0495583_0006885_3354_3680 | 106 |
| 452 | 3300046507 | Ga0495606_0204340 | Ga0495606_0204340_744_1070 | 106 |
| 453 | 3300046518 | Ga0495631_0004610 | Ga0495631_0004610_60_386 | 106 |
| 454 | 3300046519 | Ga0495632_0000867 | Ga0495632_0000867_20073_20399 | 106 |
| 455 | 3300046519 | Ga0495632_0021400 | Ga0495632_0021400_3085_3411 | 106 |
| 456 | 3300046519 | Ga0495632_0056635 | Ga0495632_0056635_1069_1395 | 106 |
| 457 | 3300046520 | Ga0495637_0000546 | Ga0495637_0000546_12634_12960 | 106 |
| 458 | 3300046520 | Ga0495637_0015151 | Ga0495637_0015151_1851_2177 | 106 |
| 459 | 3300046520 | Ga0495637_0042635 | Ga0495637_0042635_255_581 | 106 |
| 460 | 3300046522 | Ga0495643_0106502 | Ga0495643_0106502_177_503 | 106 |
| 461 | 3300046522 | Ga0495643_0124477 | Ga0495643_0124477_47_373 | 106 |
| 462 | 3300046522 | Ga0495643_0289421 | Ga0495643_0289421_238_564 | 106 |
| 463 | 3300046523 | Ga0495644_0003325 | Ga0495644_0003325_2784_3110 | 106 |
| 464 | 3300046524 | Ga0495648_0002803 | Ga0495648_0002803_5019_5345 | 106 |
| 465 | 3300046528 | Ga0495642_0003792 | Ga0495642_0003792_1481_1807 | 106 |
| 466 | 3300046530 | Ga0495654_0007339 | Ga0495654_0007339_4454_4780 | 106 |
| 467 | 3300046530 | Ga0495654_0088238 | Ga0495654_0088238_727_1053 | 106 |
| 468 | 3300046530 | Ga0495654_0160961 | Ga0495654_0160961_318_644 | 106 |
| 469 | 3300046538 | Ga0495609_0000382 | Ga0495609_0000382_24837_25163 | 106 |
| 470 | 3300046538 | Ga0495609_0089196 | Ga0495609_0089196_945_1271 | 106 |
| 471 | 3300046542 | Ga0495597_0202312 | Ga0495597_0202312_276_602 | 106 |
| 472 | 3300046616 | Ga0495668_0012999 | Ga0495668_0012999_54_380 | 106 |
| 473 | 3300046616 | Ga0495668_0142717 | Ga0495668_0142717_446_772 | 106 |
| 474 | 3300046616 | Ga0495668_0549199 | Ga0495668_0549199_300_626 | 106 |
| 475 | 3300046648 | Ga0495611_0000589 | Ga0495611_0000589_19230_19556 | 106 |
| 476 | 3300046660 | Ga0495625_0000010 | Ga0495625_0000010_272270_272596 | 106 |
| 477 | 3300046665 | Ga0495661_0000020 | Ga0495661_0000020_10996_11322 | 106 |
| 478 | 3300046665 | Ga0495661_0039047 | Ga0495661_0039047_93_419 | 106 |
| 479 | 3300046665 | Ga0495661_0067592 | Ga0495661_0067592_11_337 | 106 |
| 480 | 3300046691 | Ga0495670_0296484 | Ga0495670_0296484_270_596 | 106 |
| 481 | 3300046692 | Ga0495671_0002417 | Ga0495671_0002417_8513_8839 | 106 |
| 482 | 3300046692 | Ga0495671_0047244 | Ga0495671_0047244_1681_2007 | 106 |
| 483 | 3300046694 | Ga0495649_0000953 | Ga0495649_0000953_6036_6362 | 106 |
| 484 | 3300046794 | Ga0495589_0036200 | Ga0495589_0036200_1231_1557 | 106 |
| 485 | 3300046810 | Ga0495660_0014143 | Ga0495660_0014143_922_1248 | 106 |
| 486 | 3300047318 | Ga0495636_0076264 | Ga0495636_0076264_64_390 | 106 |
| 487 | 3300047320 | Ga0495672_0030856 | Ga0495672_0030856_2115_2441 | 106 |
| 488 | 3300047320 | Ga0495672_0048921 | Ga0495672_0048921_183_509 | 106 |
| 489 | 3300047320 | Ga0495672_0127767 | Ga0495672_0127767_71_397 | 106 |
| 490 | 3300047323 | Ga0495683_0006147 | Ga0495683_0006147_3626_3952 | 106 |
| 491 | 3300047446 | Ga0495679_000126 | Ga0495679_000126_63_389 | 106 |
| 492 | 3300047469 | Ga0495673_0002520 | Ga0495673_0002520_7201_7527 | 106 |
| 493 | 3300047469 | Ga0495673_0003566 | Ga0495673_0003566_6569_6895 | 106 |
| 494 | 3300047469 | Ga0495673_0007822 | Ga0495673_0007822_5189_5515 | 106 |
| 495 | 3300047469 | Ga0495673_0035945 | Ga0495673_0035945_1390_1716 | 106 |
| 496 | 3300047470 | Ga0495681_0024793 | Ga0495681_0024793_1041_1367 | 106 |
| 497 | 3300047472 | Ga0495686_0019342 | Ga0495686_0019342_3158_3484 | 106 |
| 498 | 3300048091 | Ga0495626_0000007 | Ga0495626_0000007_110521_110847 | 106 |
| 499 | 3300048091 | Ga0495626_0008419 | Ga0495626_0008419_3620_3946 | 106 |
| 500 | 3300049459 | Ga0495678_000787 | Ga0495678_000787_14087_14413 | 106 |
| 501 | 3300049459 | Ga0495678_005114 | Ga0495678_005114_3457_3783 | 106 |
| 502 | 3300049459 | Ga0495678_007928 | Ga0495678_007928_3336_3662 | 106 |
| 503 | 3300049459 | Ga0495678_021969 | Ga0495678_021969_1421_1747 | 106 |
| 504 | 3300009011 | Ga0105251_10000060 | Ga0105251_1000006074 | 107 |
| 505 | 3300013102 | Ga0157371_11452969 | Ga0157371_114529692 | 107 |
| 506 | 3300013105 | Ga0157369_10955212 | Ga0157369_109552122 | 107 |
| 507 | 3300015261 | Ga0182006_1100196 | Ga0182006_11001962 | 107 |
| 508 | 3300025735 | Ga0207713_1000150 | Ga0207713_100015026 | 107 |
| 509 | 3300031548 | Ga0307408_100035752 | Ga0307408_1000357522 | 107 |
| 510 | 3300031731 | Ga0307405_10075341 | Ga0307405_100753412 | 107 |
| 511 | 3300031824 | Ga0307413_10537800 | Ga0307413_105378002 | 107 |
| 512 | 3300031852 | Ga0307410_11658515 | Ga0307410_116585151 | 107 |
| 513 | 3300031911 | Ga0307412_10015329 | Ga0307412_100153292 | 107 |
| 514 | 3300032004 | Ga0307414_10667585 | Ga0307414_106675852 | 107 |
| 515 | 3300032005 | Ga0307411_10113942 | Ga0307411_101139422 | 107 |
| 516 | 3300042137 | Ga0450902_006763 | Ga0450902_006763_866_1195 | 107 |
| 517 | 3300042439 | Ga0439464_0010620 | Ga0439464_0010620_392_733 | 107 |
| 518 | 3300042461 | Ga0439460_0012892 | Ga0439460_0012892_1726_2055 | 107 |
| 519 | 3300046474 | Ga0495605_0488815 | Ga0495605_0488815_89_412 | 107 |
| 520 | 3300027543 | Ga0209999_1041556 | Ga0209999_10415562 | 108 |
| 521 | 3300042137 | Ga0450902_002811 | Ga0450902_002811_1818_2150 | 108 |
| 522 | 3300042138 | Ga0450903_009656 | Ga0450903_009656_312_644 | 108 |
| 523 | 3300042439 | Ga0439464_0067337 | Ga0439464_0067337_139_465 | 108 |
| 524 | 3300046558 | Ga0495633_0109450 | Ga0495633_0109450_220_546 | 108 |
| 525 | 3300047320 | Ga0495672_0020829 | Ga0495672_0020829_1260_1586 | 108 |
| 526 | 3300047470 | Ga0495681_0002330 | Ga0495681_0002330_10788_11114 | 108 |
| 527 | 2124908027 | MRS2a_Contig_746 | MRS2a_00603890 | 109 |
| 528 | 2162886007 | SwRhRL2b_contig_936219 | SwRhRL2b_0886.00006900 | 109 |
| 529 | 3300002705 | JGI25156J39149_1025463 | JGI25156J39149_10254632 | 109 |
| 530 | 3300002737 | JGI25162J39368_1000037 | JGI25162J39368_100003740 | 109 |
| 531 | 3300002737 | JGI25162J39368_1000212 | JGI25162J39368_100021216 | 109 |
| 532 | 3300002771 | JGI25163J39215_1000442 | JGI25163J39215_10004429 | 109 |
| 533 | 3300002771 | JGI25163J39215_1000503 | JGI25163J39215_10005035 | 109 |
| 534 | 3300002772 | JGI25164J39214_1000020 | JGI25164J39214_100002040 | 109 |
| 535 | 3300002772 | JGI25164J39214_1000051 | JGI25164J39214_100005149 | 109 |
| 536 | 3300003214 | JGI25165J46597_1000077 | JGI25165J46597_100007740 | 109 |
| 537 | 3300003214 | JGI25165J46597_1000091 | JGI25165J46597_100009149 | 109 |
| 538 | 3300003323 | rootH1_10334418 | rootH1_103344182 | 109 |
| 539 | 3300003751 | Ga0055538_1000090 | Ga0055538_100009017 | 109 |
| 540 | 3300003752 | Ga0055539_1000134 | Ga0055539_100013417 | 109 |
| 541 | 3300003756 | Ga0055533_1000138 | Ga0055533_100013865 | 109 |
| 542 | 3300003758 | Ga0055532_1000142 | Ga0055532_100014217 | 109 |
| 543 | 3300003759 | Ga0055525_1000183 | Ga0055525_100018317 | 109 |
| 544 | 3300003781 | Ga0055536_1000886 | Ga0055536_100088620 | 109 |
| 545 | 3300003784 | Ga0055534_1047226 | Ga0055534_10472262 | 109 |
| 546 | 3300003791 | Ga0055530_10000158 | Ga0055530_1000015811 | 109 |
| 547 | 3300003792 | Ga0055540_1000182 | Ga0055540_100018211 | 109 |
| 548 | 3300003841 | Ga0055541_1000089 | Ga0055541_100008917 | 109 |
| 549 | 3300005288 | Ga0065714_10002255 | Ga0065714_1000225534 | 109 |
| 550 | 3300005288 | Ga0065714_10002585 | Ga0065714_1000258520 | 109 |
| 551 | 3300005288 | Ga0065714_10009355 | Ga0065714_100093552 | 109 |
| 552 | 3300005288 | Ga0065714_10040982 | Ga0065714_100409822 | 109 |
| 553 | 3300005288 | Ga0065714_10090909 | Ga0065714_100909092 | 109 |
| 554 | 3300005288 | Ga0065714_10347257 | Ga0065714_103472572 | 109 |
| 555 | 3300005289 | Ga0065704_10070596 | Ga0065704_100705968 | 109 |
| 556 | 3300005289 | Ga0065704_10114457 | Ga0065704_101144572 | 109 |
| 557 | 3300005289 | Ga0065704_10520469 | Ga0065704_105204692 | 109 |
| 558 | 3300005289 | Ga0065704_10576452 | Ga0065704_105764522 | 109 |
| 559 | 3300005293 | Ga0065715_10755421 | Ga0065715_107554212 | 109 |
| 560 | 3300005331 | Ga0070670_100001221 | Ga0070670_10000122121 | 109 |
| 561 | 3300005331 | Ga0070670_100053848 | Ga0070670_1000538481 | 109 |
| 562 | 3300005344 | Ga0070661_100000029 | Ga0070661_10000002929 | 109 |
| 563 | 3300005353 | Ga0070669_100000316 | Ga0070669_1000003168 | 109 |
| 564 | 3300005457 | Ga0070662_100016721 | Ga0070662_1000167212 | 109 |
| 565 | 3300005539 | Ga0068853_100008519 | Ga0068853_10000851910 | 109 |
| 566 | 3300005564 | Ga0070664_100000046 | Ga0070664_10000004645 | 109 |
| 567 | 3300005834 | Ga0068851_10000050 | Ga0068851_1000005044 | 109 |
| 568 | 3300006051 | Ga0075364_10231658 | Ga0075364_102316582 | 109 |
| 569 | 3300006051 | Ga0075364_10324408 | Ga0075364_103244082 | 109 |
| 570 | 3300006051 | Ga0075364_10514232 | Ga0075364_105142321 | 109 |
| 571 | 3300006058 | Ga0075432_10017532 | Ga0075432_100175322 | 109 |
| 572 | 3300006058 | Ga0075432_10086986 | Ga0075432_100869862 | 109 |
| 573 | 3300006058 | Ga0075432_10108892 | Ga0075432_101088922 | 109 |
| 574 | 3300006177 | Ga0075362_10098343 | Ga0075362_100983432 | 109 |
| 575 | 3300006177 | Ga0075362_10397381 | Ga0075362_103973812 | 109 |
| 576 | 3300006186 | Ga0075369_10478098 | Ga0075369_104780982 | 109 |
| 577 | 3300006353 | Ga0075370_10932662 | Ga0075370_109326621 | 109 |
| 578 | 3300006914 | Ga0075436_100043124 | Ga0075436_1000431243 | 109 |
| 579 | 3300006914 | Ga0075436_100593592 | Ga0075436_1005935921 | 109 |
| 580 | 3300006946 | Ga0079104_1000545 | Ga0079104_100054514 | 109 |
| 581 | 3300006946 | Ga0079104_1000574 | Ga0079104_100057416 | 109 |
| 582 | 3300006948 | Ga0099826_10002700 | Ga0099826_100027009 | 109 |
| 583 | 3300009011 | Ga0105251_10002821 | Ga0105251_1000282111 | 109 |
| 584 | 3300009011 | Ga0105251_10009019 | Ga0105251_100090192 | 109 |
| 585 | 3300009011 | Ga0105251_10011769 | Ga0105251_100117695 | 109 |
| 586 | 3300009011 | Ga0105251_10175261 | Ga0105251_101752611 | 109 |
| 587 | 3300009011 | Ga0105251_10356462 | Ga0105251_103564621 | 109 |
| 588 | 3300009036 | Ga0105244_10006180 | Ga0105244_100061804 | 109 |
| 589 | 3300009036 | Ga0105244_10013620 | Ga0105244_100136202 | 109 |
| 590 | 3300009036 | Ga0105244_10024831 | Ga0105244_100248312 | 109 |
| 591 | 3300009036 | Ga0105244_10041755 | Ga0105244_100417553 | 109 |
| 592 | 3300009036 | Ga0105244_10044688 | Ga0105244_100446881 | 109 |
| 593 | 3300009036 | Ga0105244_10204121 | Ga0105244_102041212 | 109 |
| 594 | 3300009036 | Ga0105244_10226688 | Ga0105244_102266882 | 109 |
| 595 | 3300009036 | Ga0105244_10226689 | Ga0105244_102266892 | 109 |
| 596 | 3300009092 | Ga0105250_10000443 | Ga0105250_1000044324 | 109 |
| 597 | 3300009092 | Ga0105250_10006271 | Ga0105250_100062717 | 109 |
| 598 | 3300009092 | Ga0105250_10006633 | Ga0105250_100066335 | 109 |
| 599 | 3300009092 | Ga0105250_10050006 | Ga0105250_100500062 | 109 |
| 600 | 3300009092 | Ga0105250_10093600 | Ga0105250_100936002 | 109 |
| 601 | 3300009148 | Ga0105243_10000158 | Ga0105243_1000015836 | 109 |
| 602 | 3300009148 | Ga0105243_10000686 | Ga0105243_1000068614 | 109 |
| 603 | 3300009148 | Ga0105243_10074167 | Ga0105243_100741672 | 109 |
| 604 | 3300009148 | Ga0105243_10343313 | Ga0105243_103433131 | 109 |
| 605 | 3300009176 | Ga0105242_10000360 | Ga0105242_1000036013 | 109 |
| 606 | 3300009176 | Ga0105242_10517950 | Ga0105242_105179501 | 109 |
| 607 | 3300009177 | Ga0105248_10321002 | Ga0105248_103210022 | 109 |
| 608 | 3300009545 | Ga0105237_10001262 | Ga0105237_100012621 | 109 |
| 609 | 3300009545 | Ga0105237_10189228 | Ga0105237_101892282 | 109 |
| 610 | 3300009551 | Ga0105238_11390581 | Ga0105238_113905812 | 109 |
| 611 | 3300009553 | Ga0105249_11200704 | Ga0105249_112007042 | 109 |
| 612 | 3300011119 | Ga0105246_10000222 | Ga0105246_1000022226 | 109 |
| 613 | 3300011119 | Ga0105246_10000876 | Ga0105246_100008769 | 109 |
| 614 | 3300011119 | Ga0105246_10008949 | Ga0105246_100089496 | 109 |
| 615 | 3300011119 | Ga0105246_10011023 | Ga0105246_100110232 | 109 |
| 616 | 3300012498 | Ga0157345_1000204 | Ga0157345_10002044 | 109 |
| 617 | 3300012502 | Ga0157347_1021565 | Ga0157347_10215652 | 109 |
| 618 | 3300013100 | Ga0157373_10005441 | Ga0157373_100054419 | 109 |
| 619 | 3300013100 | Ga0157373_10012648 | Ga0157373_100126484 | 109 |
| 620 | 3300013100 | Ga0157373_10018039 | Ga0157373_100180394 | 109 |
| 621 | 3300013100 | Ga0157373_10018658 | Ga0157373_100186583 | 109 |
| 622 | 3300013100 | Ga0157373_10020190 | Ga0157373_100201905 | 109 |
| 623 | 3300013100 | Ga0157373_10022401 | Ga0157373_100224015 | 109 |
| 624 | 3300013102 | Ga0157371_10000513 | Ga0157371_1000051340 | 109 |
| 625 | 3300013102 | Ga0157371_10006014 | Ga0157371_100060144 | 109 |
| 626 | 3300013102 | Ga0157371_10010699 | Ga0157371_100106995 | 109 |
| 627 | 3300013104 | Ga0157370_10098872 | Ga0157370_100988722 | 109 |
| 628 | 3300013104 | Ga0157370_10214040 | Ga0157370_102140402 | 109 |
| 629 | 3300013104 | Ga0157370_10257479 | Ga0157370_102574792 | 109 |
| 630 | 3300013104 | Ga0157370_10539341 | Ga0157370_105393412 | 109 |
| 631 | 3300013104 | Ga0157370_10861112 | Ga0157370_108611121 | 109 |
| 632 | 3300013105 | Ga0157369_10003927 | Ga0157369_1000392718 | 109 |
| 633 | 3300013105 | Ga0157369_10027328 | Ga0157369_100273284 | 109 |
| 634 | 3300013105 | Ga0157369_10063255 | Ga0157369_100632554 | 109 |
| 635 | 3300013105 | Ga0157369_10104912 | Ga0157369_101049122 | 109 |
| 636 | 3300013105 | Ga0157369_10620541 | Ga0157369_106205411 | 109 |
| 637 | 3300013105 | Ga0157369_11069945 | Ga0157369_110699452 | 109 |
| 638 | 3300013105 | Ga0157369_11503589 | Ga0157369_115035891 | 109 |
| 639 | 3300013105 | Ga0157369_11765104 | Ga0157369_117651042 | 109 |
| 640 | 3300013105 | Ga0157369_12427419 | Ga0157369_124274192 | 109 |
| 641 | 3300013306 | Ga0163162_10009243 | Ga0163162_100092438 | 109 |
| 642 | 3300013306 | Ga0163162_10064941 | Ga0163162_100649416 | 109 |
| 643 | 3300013306 | Ga0163162_10472413 | Ga0163162_104724132 | 109 |
| 644 | 3300013307 | Ga0157372_10024791 | Ga0157372_100247914 | 109 |
| 645 | 3300013308 | Ga0157375_10034168 | Ga0157375_100341685 | 109 |
| 646 | 3300013308 | Ga0157375_10064541 | Ga0157375_100645412 | 109 |
| 647 | 3300013308 | Ga0157375_10090283 | Ga0157375_100902833 | 109 |
| 648 | 3300013308 | Ga0157375_10176459 | Ga0157375_101764593 | 109 |
| 649 | 3300013308 | Ga0157375_11404586 | Ga0157375_114045861 | 109 |
| 650 | 3300014497 | Ga0182008_10000040 | Ga0182008_1000004036 | 109 |
| 651 | 3300014497 | Ga0182008_10007769 | Ga0182008_100077692 | 109 |
| 652 | 3300014497 | Ga0182008_10037856 | Ga0182008_100378562 | 109 |
| 653 | 3300015261 | Ga0182006_1000780 | Ga0182006_10007803 | 109 |
| 654 | 3300015261 | Ga0182006_1006561 | Ga0182006_10065614 | 109 |
| 655 | 3300015261 | Ga0182006_1009115 | Ga0182006_10091152 | 109 |
| 656 | 3300015261 | Ga0182006_1009778 | Ga0182006_10097782 | 109 |
| 657 | 3300015261 | Ga0182006_1010411 | Ga0182006_10104114 | 109 |
| 658 | 3300015261 | Ga0182006_1165468 | Ga0182006_11654681 | 109 |
| 659 | 3300015261 | Ga0182006_1192034 | Ga0182006_11920341 | 109 |
| 660 | 3300015262 | Ga0182007_10010626 | Ga0182007_100106262 | 109 |
| 661 | 3300015265 | Ga0182005_1007572 | Ga0182005_10075723 | 109 |
| 662 | 3300015265 | Ga0182005_1040982 | Ga0182005_10409822 | 109 |
| 663 | 3300017792 | Ga0163161_10016933 | Ga0163161_100169334 | 109 |
| 664 | 3300017792 | Ga0163161_10024761 | Ga0163161_100247613 | 109 |
| 665 | 3300017792 | Ga0163161_10048839 | Ga0163161_100488392 | 109 |
| 666 | 3300017792 | Ga0163161_10061578 | Ga0163161_100615782 | 109 |
| 667 | 3300017792 | Ga0163161_10070786 | Ga0163161_100707862 | 109 |
| 668 | 3300017792 | Ga0163161_10173224 | Ga0163161_101732242 | 109 |
| 669 | 3300017792 | Ga0163161_10305602 | Ga0163161_103056021 | 109 |
| 670 | 3300017792 | Ga0163161_10438064 | Ga0163161_104380642 | 109 |
| 671 | 3300017792 | Ga0163161_10609746 | Ga0163161_106097462 | 109 |
| 672 | 3300017792 | Ga0163161_10951329 | Ga0163161_109513292 | 109 |
| 673 | 3300025206 | Ga0209435_101205 | Ga0209435_1012052 | 109 |
| 674 | 3300025207 | Ga0209760_100022 | Ga0209760_100022125 | 109 |
| 675 | 3300025207 | Ga0209760_100053 | Ga0209760_10005323 | 109 |
| 676 | 3300025224 | Ga0209784_100040 | Ga0209784_100040164 | 109 |
| 677 | 3300025225 | Ga0209566_100051 | Ga0209566_100051164 | 109 |
| 678 | 3300025226 | Ga0209674_100072 | Ga0209674_100072164 | 109 |
| 679 | 3300025229 | Ga0209147_100067 | Ga0209147_100067164 | 109 |
| 680 | 3300025230 | Ga0209563_100073 | Ga0209563_100073164 | 109 |
| 681 | 3300025231 | Ga0207427_100001 | Ga0207427_100001915 | 109 |
| 682 | 3300025231 | Ga0207427_100047 | Ga0207427_100047125 | 109 |
| 683 | 3300025233 | Ga0209437_100003 | Ga0209437_100003457 | 109 |
| 684 | 3300025233 | Ga0209437_100009 | Ga0209437_100009125 | 109 |
| 685 | 3300025242 | Ga0209258_100490 | Ga0209258_10049017 | 109 |
| 686 | 3300025246 | Ga0209646_1000383 | Ga0209646_100038314 | 109 |
| 687 | 3300025253 | Ga0209677_100121 | Ga0209677_10012117 | 109 |
| 688 | 3300025256 | Ga0209759_1004999 | Ga0209759_10049993 | 109 |
| 689 | 3300025256 | Ga0209759_1038855 | Ga0209759_10388552 | 109 |
| 690 | 3300025261 | Ga0209233_1000007 | Ga0209233_1000007915 | 109 |
| 691 | 3300025261 | Ga0209233_1000032 | Ga0209233_1000032125 | 109 |
| 692 | 3300025291 | Ga0209675_1002532 | Ga0209675_10025326 | 109 |
| 693 | 3300025292 | Ga0209676_1000016 | Ga0209676_1000016520 | 109 |
| 694 | 3300025292 | Ga0209676_1000033 | Ga0209676_1000033342 | 109 |
| 695 | 3300025292 | Ga0209676_1022616 | Ga0209676_10226162 | 109 |
| 696 | 3300025298 | Ga0209050_1000009 | Ga0209050_1000009255 | 109 |
| 697 | 3300025298 | Ga0209050_1000036 | Ga0209050_100003638 | 109 |
| 698 | 3300025303 | Ga0209051_1000008 | Ga0209051_100000812 | 109 |
| 699 | 3300025303 | Ga0209051_1000043 | Ga0209051_1000043110 | 109 |
| 700 | 3300025304 | Ga0209257_1000098 | Ga0209257_1000098203 | 109 |
| 701 | 3300025304 | Ga0209257_1014823 | Ga0209257_10148232 | 109 |
| 702 | 3300025321 | Ga0207656_10000293 | Ga0207656_1000029311 | 109 |
| 703 | 3300025711 | Ga0207696_1000101 | Ga0207696_100010143 | 109 |
| 704 | 3300025711 | Ga0207696_1004427 | Ga0207696_10044272 | 109 |
| 705 | 3300025711 | Ga0207696_1021804 | Ga0207696_10218041 | 109 |
| 706 | 3300025711 | Ga0207696_1023426 | Ga0207696_10234261 | 109 |
| 707 | 3300025711 | Ga0207696_1029694 | Ga0207696_10296942 | 109 |
| 708 | 3300025711 | Ga0207696_1076456 | Ga0207696_10764562 | 109 |
| 709 | 3300025728 | Ga0207655_1000019 | Ga0207655_1000019298 | 109 |
| 710 | 3300025728 | Ga0207655_1000337 | Ga0207655_100033728 | 109 |
| 711 | 3300025728 | Ga0207655_1001070 | Ga0207655_10010708 | 109 |
| 712 | 3300025728 | Ga0207655_1008174 | Ga0207655_10081744 | 109 |
| 713 | 3300025728 | Ga0207655_1014895 | Ga0207655_10148952 | 109 |
| 714 | 3300025728 | Ga0207655_1020507 | Ga0207655_10205072 | 109 |
| 715 | 3300025728 | Ga0207655_1021617 | Ga0207655_10216172 | 109 |
| 716 | 3300025728 | Ga0207655_1024802 | Ga0207655_10248024 | 109 |
| 717 | 3300025728 | Ga0207655_1028229 | Ga0207655_10282293 | 109 |
| 718 | 3300025728 | Ga0207655_1155576 | Ga0207655_11555762 | 109 |
| 719 | 3300025735 | Ga0207713_1001217 | Ga0207713_10012178 | 109 |
| 720 | 3300025735 | Ga0207713_1002539 | Ga0207713_10025395 | 109 |
| 721 | 3300025735 | Ga0207713_1003187 | Ga0207713_10031879 | 109 |
| 722 | 3300025735 | Ga0207713_1009720 | Ga0207713_10097202 | 109 |
| 723 | 3300025735 | Ga0207713_1010908 | Ga0207713_10109083 | 109 |
| 724 | 3300025735 | Ga0207713_1015010 | Ga0207713_10150102 | 109 |
| 725 | 3300025735 | Ga0207713_1155567 | Ga0207713_11555672 | 109 |
| 726 | 3300025914 | Ga0207671_10000287 | Ga0207671_1000028771 | 109 |
| 727 | 3300025920 | Ga0207649_10000068 | Ga0207649_1000006832 | 109 |
| 728 | 3300025923 | Ga0207681_10012718 | Ga0207681_100127184 | 109 |
| 729 | 3300025925 | Ga0207650_10000174 | Ga0207650_1000017435 | 109 |
| 730 | 3300025925 | Ga0207650_10000405 | Ga0207650_1000040543 | 109 |
| 731 | 3300025933 | Ga0207706_10027125 | Ga0207706_100271252 | 109 |
| 732 | 3300025934 | Ga0207686_10279286 | Ga0207686_102792862 | 109 |
| 733 | 3300025934 | Ga0207686_10662983 | Ga0207686_106629832 | 109 |
| 734 | 3300025935 | Ga0207709_10000053 | Ga0207709_10000053116 | 109 |
| 735 | 3300025935 | Ga0207709_10001997 | Ga0207709_1000199714 | 109 |
| 736 | 3300025935 | Ga0207709_10259055 | Ga0207709_102590552 | 109 |
| 737 | 3300025945 | Ga0207679_10000018 | Ga0207679_1000001869 | 109 |
| 738 | 3300025961 | Ga0207712_11179674 | Ga0207712_111796742 | 109 |
| 739 | 3300025981 | Ga0207640_10436920 | Ga0207640_104369202 | 109 |
| 740 | 3300026041 | Ga0207639_10005291 | Ga0207639_1000529110 | 109 |
| 741 | 3300027111 | Ga0209281_1000018 | Ga0209281_1000018441 | 109 |
| 742 | 3300027111 | Ga0209281_1000174 | Ga0209281_100017445 | 109 |
| 743 | 3300027111 | Ga0209281_1007040 | Ga0209281_10070402 | 109 |
| 744 | 3300027666 | Ga0209282_1020576 | Ga0209282_10205764 | 109 |
| 745 | 3300027907 | Ga0207428_10016748 | Ga0207428_100167488 | 109 |
| 746 | 3300027907 | Ga0207428_10034107 | Ga0207428_100341073 | 109 |
| 747 | 3300027907 | Ga0207428_10049806 | Ga0207428_100498064 | 109 |
| 748 | 3300027907 | Ga0207428_10313871 | Ga0207428_103138712 | 109 |
| 749 | 3300030521 | Ga0307511_10122554 | Ga0307511_101225542 | 109 |
| 750 | 3300030521 | Ga0307511_10223593 | Ga0307511_102235932 | 109 |
| 751 | 3300030731 | Ga0316177_1130413 | Ga0316177_11304131 | 109 |
| 752 | 3300030733 | Ga0314311_1092402 | Ga0314311_10924022 | 109 |
| 753 | 3300030742 | Ga0316183_1023970 | Ga0316183_10239703 | 109 |
| 754 | 3300030744 | Ga0316181_1134508 | Ga0316181_11345082 | 109 |
| 755 | 3300030745 | Ga0316182_1273877 | Ga0316182_12738772 | 109 |
| 756 | 3300031548 | Ga0307408_100770846 | Ga0307408_1007708462 | 109 |
| 757 | 3300031731 | Ga0307405_10002888 | Ga0307405_1000288810 | 109 |
| 758 | 3300031901 | Ga0307406_10005725 | Ga0307406_100057258 | 109 |
| 759 | 3300031995 | Ga0307409_100042016 | Ga0307409_1000420162 | 109 |
| 760 | 3300032004 | Ga0307414_10005562 | Ga0307414_100055621 | 109 |
| 761 | 3300032004 | Ga0307414_11948460 | Ga0307414_119484601 | 109 |
| 762 | 3300032005 | Ga0307411_10026265 | Ga0307411_100262654 | 109 |
| 763 | 3300033180 | Ga0307510_10042593 | Ga0307510_100425934 | 109 |
| 764 | 3300038705 | Ga0237819_01731 | Ga0237819_01731_136_465 | 109 |
| 765 | 3300041405 | Ga0439438_002727 | Ga0439438_002727_3624_3953 | 109 |
| 766 | 3300041405 | Ga0439438_003107 | Ga0439438_003107_5897_6226 | 109 |
| 767 | 3300041405 | Ga0439438_006132 | Ga0439438_006132_2649_2978 | 109 |
| 768 | 3300041405 | Ga0439438_009657 | Ga0439438_009657_215_544 | 109 |
| 769 | 3300041405 | Ga0439438_010066 | Ga0439438_010066_1719_2048 | 109 |
| 770 | 3300041405 | Ga0439438_012149 | Ga0439438_012149_1320_1649 | 109 |
| 771 | 3300041405 | Ga0439438_025751 | Ga0439438_025751_951_1280 | 109 |
| 772 | 3300041407 | Ga0439447_001200 | Ga0439447_001200_5907_6236 | 109 |
| 773 | 3300041407 | Ga0439447_002577 | Ga0439447_002577_3913_4242 | 109 |
| 774 | 3300041407 | Ga0439447_004106 | Ga0439447_004106_2683_3012 | 109 |
| 775 | 3300041407 | Ga0439447_007315 | Ga0439447_007315_2170_2499 | 109 |
| 776 | 3300041407 | Ga0439447_007389 | Ga0439447_007389_2812_3168 | 109 |
| 777 | 3300041407 | Ga0439447_024940 | Ga0439447_024940_826_1155 | 109 |
| 778 | 3300041407 | Ga0439447_066057 | Ga0439447_066057_394_723 | 109 |
| 779 | 3300041411 | Ga0439466_0003625 | Ga0439466_0003625_5037_5366 | 109 |
| 780 | 3300041411 | Ga0439466_0007541 | Ga0439466_0007541_772_1101 | 109 |
| 781 | 3300041411 | Ga0439466_0012205 | Ga0439466_0012205_1167_1496 | 109 |
| 782 | 3300041411 | Ga0439466_0014044 | Ga0439466_0014044_1990_2319 | 109 |
| 783 | 3300041411 | Ga0439466_0046387 | Ga0439466_0046387_14_343 | 109 |
| 784 | 3300041411 | Ga0439466_0082304 | Ga0439466_0082304_409_738 | 109 |
| 785 | 3300041411 | Ga0439466_0158325 | Ga0439466_0158325_15_344 | 109 |
| 786 | 3300041413 | Ga0439465_0016937 | Ga0439465_0016937_719_1075 | 109 |
| 787 | 3300041498 | Ga0451841_1129590 | Ga0451841_1129590_195_524 | 109 |
| 788 | 3300042006 | Ga0439432_000221 | Ga0439432_000221_18452_18781 | 109 |
| 789 | 3300042006 | Ga0439432_002029 | Ga0439432_002029_2423_2752 | 109 |
| 790 | 3300042006 | Ga0439432_004560 | Ga0439432_004560_3668_3997 | 109 |
| 791 | 3300042006 | Ga0439432_008649 | Ga0439432_008649_2940_3296 | 109 |
| 792 | 3300042006 | Ga0439432_021318 | Ga0439432_021318_688_1017 | 109 |
| 793 | 3300042006 | Ga0439432_212400 | Ga0439432_212400_182_511 | 109 |
| 794 | 3300042009 | Ga0439451_002269 | Ga0439451_002269_3208_3543 | 109 |
| 795 | 3300042009 | Ga0439451_003957 | Ga0439451_003957_890_1219 | 109 |
| 796 | 3300042009 | Ga0439451_014900 | Ga0439451_014900_356_685 | 109 |
| 797 | 3300042009 | Ga0439451_043076 | Ga0439451_043076_266_595 | 109 |
| 798 | 3300042009 | Ga0439451_052473 | Ga0439451_052473_132_461 | 109 |
| 799 | 3300042010 | Ga0439452_001336 | Ga0439452_001336_9590_9946 | 109 |
| 800 | 3300042010 | Ga0439452_001829 | Ga0439452_001829_5894_6223 | 109 |
| 801 | 3300042010 | Ga0439452_002038 | Ga0439452_002038_4344_4673 | 109 |
| 802 | 3300042010 | Ga0439452_009381 | Ga0439452_009381_2493_2822 | 109 |
| 803 | 3300042010 | Ga0439452_012733 | Ga0439452_012733_616_945 | 109 |
| 804 | 3300042010 | Ga0439452_019054 | Ga0439452_019054_905_1234 | 109 |
| 805 | 3300042010 | Ga0439452_038804 | Ga0439452_038804_614_955 | 109 |
| 806 | 3300042010 | Ga0439452_111834 | Ga0439452_111834_26_355 | 109 |
| 807 | 3300042013 | Ga0439456_014477 | Ga0439456_014477_245_574 | 109 |
| 808 | 3300042013 | Ga0439456_026414 | Ga0439456_026414_711_1040 | 109 |
| 809 | 3300042013 | Ga0439456_041021 | Ga0439456_041021_199_528 | 109 |
| 810 | 3300042013 | Ga0439456_067960 | Ga0439456_067960_32_361 | 109 |
| 811 | 3300042013 | Ga0439456_115794 | Ga0439456_115794_120_449 | 109 |
| 812 | 3300042016 | Ga0439463_002704 | Ga0439463_002704_731_1060 | 109 |
| 813 | 3300042016 | Ga0439463_042225 | Ga0439463_042225_663_992 | 109 |
| 814 | 3300042016 | Ga0439463_194838 | Ga0439463_194838_24_353 | 109 |
| 815 | 3300042115 | Ga0450911_002493 | Ga0450911_002493_276_605 | 109 |
| 816 | 3300042115 | Ga0450911_027641 | Ga0450911_027641_133_462 | 109 |
| 817 | 3300042121 | Ga0450919_027712 | Ga0450919_027712_217_573 | 109 |
| 818 | 3300042122 | Ga0450920_000665 | Ga0450920_000665_877_1206 | 109 |
| 819 | 3300042124 | Ga0450922_000171 | Ga0450922_000171_2599_2928 | 109 |
| 820 | 3300042124 | Ga0450922_004241 | Ga0450922_004241_615_944 | 109 |
| 821 | 3300042124 | Ga0450922_018578 | Ga0450922_018578_311_667 | 109 |
| 822 | 3300042125 | Ga0450923_042746 | Ga0450923_042746_347_676 | 109 |
| 823 | 3300042129 | Ga0450891_001832 | Ga0450891_001832_526_855 | 109 |
| 824 | 3300042137 | Ga0450902_003679 | Ga0450902_003679_1684_2013 | 109 |
| 825 | 3300042137 | Ga0450902_017166 | Ga0450902_017166_790_1119 | 109 |
| 826 | 3300042138 | Ga0450903_001475 | Ga0450903_001475_1912_2241 | 109 |
| 827 | 3300042138 | Ga0450903_037582 | Ga0450903_037582_233_562 | 109 |
| 828 | 3300042139 | Ga0450904_001580 | Ga0450904_001580_2160_2489 | 109 |
| 829 | 3300042142 | Ga0450905_012348 | Ga0450905_012348_146_475 | 109 |
| 830 | 3300042145 | Ga0450906_001615 | Ga0450906_001615_4277_4606 | 109 |
| 831 | 3300042145 | Ga0450906_003073 | Ga0450906_003073_981_1310 | 109 |
| 832 | 3300042146 | Ga0450907_000141 | Ga0450907_000141_21572_21901 | 109 |
| 833 | 3300042146 | Ga0450907_015898 | Ga0450907_015898_276_605 | 109 |
| 834 | 3300042146 | Ga0450907_046959 | Ga0450907_046959_353_682 | 109 |
| 835 | 3300042147 | Ga0450910_005462 | Ga0450910_005462_57_386 | 109 |
| 836 | 3300042147 | Ga0450910_028114 | Ga0450910_028114_372_701 | 109 |
| 837 | 3300042184 | Ga0450908_002630 | Ga0450908_002630_291_620 | 109 |
| 838 | 3300042184 | Ga0450908_015523 | Ga0450908_015523_982_1311 | 109 |
| 839 | 3300042185 | Ga0450909_017845 | Ga0450909_017845_603_932 | 109 |
| 840 | 3300042533 | Ga0450901_004466 | Ga0450901_004466_689_1018 | 109 |
| 841 | 3300042993 | Ga0439440_0002059 | Ga0439440_0002059_2391_2720 | 109 |
| 842 | 3300046452 | Ga0495617_000345 | Ga0495617_000345_5367_5696 | 109 |
| 843 | 3300046452 | Ga0495617_005322 | Ga0495617_005322_2448_2777 | 109 |
| 844 | 3300046452 | Ga0495617_025647 | Ga0495617_025647_1233_1562 | 109 |
| 845 | 3300046452 | Ga0495617_043372 | Ga0495617_043372_470_799 | 109 |
| 846 | 3300046452 | Ga0495617_056964 | Ga0495617_056964_233_562 | 109 |
| 847 | 3300046452 | Ga0495617_144765 | Ga0495617_144765_20_349 | 109 |
| 848 | 3300046453 | Ga0495627_002477 | Ga0495627_002477_2742_3071 | 109 |
| 849 | 3300046453 | Ga0495627_011679 | Ga0495627_011679_1547_1876 | 109 |
| 850 | 3300046453 | Ga0495627_016219 | Ga0495627_016219_1746_2075 | 109 |
| 851 | 3300046453 | Ga0495627_019374 | Ga0495627_019374_1547_1876 | 109 |
| 852 | 3300046453 | Ga0495627_129405 | Ga0495627_129405_55_384 | 109 |
| 853 | 3300046453 | Ga0495627_219590 | Ga0495627_219590_68_397 | 109 |
| 854 | 3300046455 | Ga0495603_0043524 | Ga0495603_0043524_621_950 | 109 |
| 855 | 3300046455 | Ga0495603_0075049 | Ga0495603_0075049_1254_1583 | 109 |
| 856 | 3300046457 | Ga0495590_0000407 | Ga0495590_0000407_19264_19593 | 109 |
| 857 | 3300046457 | Ga0495590_0001249 | Ga0495590_0001249_5423_5752 | 109 |
| 858 | 3300046457 | Ga0495590_0021035 | Ga0495590_0021035_1484_1813 | 109 |
| 859 | 3300046457 | Ga0495590_0189453 | Ga0495590_0189453_190_519 | 109 |
| 860 | 3300046458 | Ga0495591_002664 | Ga0495591_002664_6708_7037 | 109 |
| 861 | 3300046458 | Ga0495591_002875 | Ga0495591_002875_4968_5297 | 109 |
| 862 | 3300046458 | Ga0495591_008226 | Ga0495591_008226_575_904 | 109 |
| 863 | 3300046458 | Ga0495591_010124 | Ga0495591_010124_2604_2933 | 109 |
| 864 | 3300046458 | Ga0495591_017039 | Ga0495591_017039_1670_1999 | 109 |
| 865 | 3300046458 | Ga0495591_017690 | Ga0495591_017690_321_650 | 109 |
| 866 | 3300046458 | Ga0495591_067006 | Ga0495591_067006_50_379 | 109 |
| 867 | 3300046458 | Ga0495591_076017 | Ga0495591_076017_335_664 | 109 |
| 868 | 3300046460 | Ga0495638_0001706 | Ga0495638_0001706_18304_18633 | 109 |
| 869 | 3300046460 | Ga0495638_0016733 | Ga0495638_0016733_2515_2844 | 109 |
| 870 | 3300046460 | Ga0495638_0017330 | Ga0495638_0017330_3837_4166 | 109 |
| 871 | 3300046460 | Ga0495638_0017833 | Ga0495638_0017833_2324_2653 | 109 |
| 872 | 3300046460 | Ga0495638_0064240 | Ga0495638_0064240_95_424 | 109 |
| 873 | 3300046460 | Ga0495638_0222308 | Ga0495638_0222308_471_800 | 109 |
| 874 | 3300046460 | Ga0495638_0295197 | Ga0495638_0295197_534_863 | 109 |
| 875 | 3300046460 | Ga0495638_0655906 | Ga0495638_0655906_28_357 | 109 |
| 876 | 3300046463 | Ga0495653_0009503 | Ga0495653_0009503_619_948 | 109 |
| 877 | 3300046463 | Ga0495653_0011533 | Ga0495653_0011533_1786_2115 | 109 |
| 878 | 3300046463 | Ga0495653_0037547 | Ga0495653_0037547_2901_3230 | 109 |
| 879 | 3300046463 | Ga0495653_0104430 | Ga0495653_0104430_1150_1479 | 109 |
| 880 | 3300046471 | Ga0495650_0010351 | Ga0495650_0010351_2608_2937 | 109 |
| 881 | 3300046471 | Ga0495650_0011705 | Ga0495650_0011705_3005_3334 | 109 |
| 882 | 3300046471 | Ga0495650_0064442 | Ga0495650_0064442_575_904 | 109 |
| 883 | 3300046471 | Ga0495650_0131253 | Ga0495650_0131253_339_668 | 109 |
| 884 | 3300046474 | Ga0495605_0001124 | Ga0495605_0001124_13317_13646 | 109 |
| 885 | 3300046474 | Ga0495605_0020475 | Ga0495605_0020475_1260_1589 | 109 |
| 886 | 3300046474 | Ga0495605_0033135 | Ga0495605_0033135_524_853 | 109 |
| 887 | 3300046474 | Ga0495605_0047485 | Ga0495605_0047485_642_971 | 109 |
| 888 | 3300046474 | Ga0495605_0057111 | Ga0495605_0057111_503_832 | 109 |
| 889 | 3300046474 | Ga0495605_0096412 | Ga0495605_0096412_498_827 | 109 |
| 890 | 3300046474 | Ga0495605_0204128 | Ga0495605_0204128_49_378 | 109 |
| 891 | 3300046474 | Ga0495605_0281135 | Ga0495605_0281135_204_533 | 109 |
| 892 | 3300046474 | Ga0495605_0290274 | Ga0495605_0290274_281_610 | 109 |
| 893 | 3300046491 | Ga0495584_0005292 | Ga0495584_0005292_2706_3035 | 109 |
| 894 | 3300046491 | Ga0495584_0007295 | Ga0495584_0007295_2662_2991 | 109 |
| 895 | 3300046491 | Ga0495584_0015934 | Ga0495584_0015934_1996_2325 | 109 |
| 896 | 3300046491 | Ga0495584_0023984 | Ga0495584_0023984_1729_2058 | 109 |
| 897 | 3300046491 | Ga0495584_0024705 | Ga0495584_0024705_1061_1390 | 109 |
| 898 | 3300046491 | Ga0495584_0047415 | Ga0495584_0047415_1788_2117 | 109 |
| 899 | 3300046491 | Ga0495584_0092177 | Ga0495584_0092177_1174_1503 | 109 |
| 900 | 3300046491 | Ga0495584_0170503 | Ga0495584_0170503_347_676 | 109 |
| 901 | 3300046491 | Ga0495584_0223314 | Ga0495584_0223314_477_806 | 109 |
| 902 | 3300046492 | Ga0495585_0000816 | Ga0495585_0000816_10869_11198 | 109 |
| 903 | 3300046492 | Ga0495585_0007295 | Ga0495585_0007295_3759_4088 | 109 |
| 904 | 3300046492 | Ga0495585_0024144 | Ga0495585_0024144_528_857 | 109 |
| 905 | 3300046492 | Ga0495585_0040411 | Ga0495585_0040411_1625_1954 | 109 |
| 906 | 3300046492 | Ga0495585_0043876 | Ga0495585_0043876_1746_2075 | 109 |
| 907 | 3300046492 | Ga0495585_0094257 | Ga0495585_0094257_561_890 | 109 |
| 908 | 3300046499 | Ga0495594_0085325 | Ga0495594_0085325_322_651 | 109 |
| 909 | 3300046499 | Ga0495594_0218208 | Ga0495594_0218208_367_696 | 109 |
| 910 | 3300046500 | Ga0495596_0018515 | Ga0495596_0018515_2447_2776 | 109 |
| 911 | 3300046501 | Ga0495607_0000888 | Ga0495607_0000888_22210_22539 | 109 |
| 912 | 3300046501 | Ga0495607_0026374 | Ga0495607_0026374_1862_2191 | 109 |
| 913 | 3300046501 | Ga0495607_0034286 | Ga0495607_0034286_1458_1787 | 109 |
| 914 | 3300046501 | Ga0495607_0042670 | Ga0495607_0042670_1730_2059 | 109 |
| 915 | 3300046501 | Ga0495607_0043682 | Ga0495607_0043682_1851_2180 | 109 |
| 916 | 3300046501 | Ga0495607_0049787 | Ga0495607_0049787_141_470 | 109 |
| 917 | 3300046501 | Ga0495607_0053686 | Ga0495607_0053686_1601_1930 | 109 |
| 918 | 3300046501 | Ga0495607_0055029 | Ga0495607_0055029_759_1088 | 109 |
| 919 | 3300046501 | Ga0495607_0134561 | Ga0495607_0134561_401_730 | 109 |
| 920 | 3300046501 | Ga0495607_0246787 | Ga0495607_0246787_69_398 | 109 |
| 921 | 3300046501 | Ga0495607_0312860 | Ga0495607_0312860_23_352 | 109 |
| 922 | 3300046506 | Ga0495583_0003027 | Ga0495583_0003027_2601_2930 | 109 |
| 923 | 3300046506 | Ga0495583_0003309 | Ga0495583_0003309_10488_10817 | 109 |
| 924 | 3300046506 | Ga0495583_0058584 | Ga0495583_0058584_140_469 | 109 |
| 925 | 3300046506 | Ga0495583_0128725 | Ga0495583_0128725_591_920 | 109 |
| 926 | 3300046507 | Ga0495606_0004097 | Ga0495606_0004097_9430_9759 | 109 |
| 927 | 3300046507 | Ga0495606_0009421 | Ga0495606_0009421_3373_3702 | 109 |
| 928 | 3300046507 | Ga0495606_0025593 | Ga0495606_0025593_1156_1485 | 109 |
| 929 | 3300046507 | Ga0495606_0051258 | Ga0495606_0051258_48_377 | 109 |
| 930 | 3300046507 | Ga0495606_0057228 | Ga0495606_0057228_1601_1930 | 109 |
| 931 | 3300046507 | Ga0495606_0078829 | Ga0495606_0078829_850_1179 | 109 |
| 932 | 3300046507 | Ga0495606_0140381 | Ga0495606_0140381_290_619 | 109 |
| 933 | 3300046512 | Ga0495610_0008157 | Ga0495610_0008157_3135_3464 | 109 |
| 934 | 3300046512 | Ga0495610_0009933 | Ga0495610_0009933_32_361 | 109 |
| 935 | 3300046512 | Ga0495610_0011085 | Ga0495610_0011085_1776_2105 | 109 |
| 936 | 3300046512 | Ga0495610_0016728 | Ga0495610_0016728_43_372 | 109 |
| 937 | 3300046512 | Ga0495610_0019983 | Ga0495610_0019983_548_877 | 109 |
| 938 | 3300046512 | Ga0495610_0039219 | Ga0495610_0039219_1049_1378 | 109 |
| 939 | 3300046512 | Ga0495610_0043634 | Ga0495610_0043634_1775_2104 | 109 |
| 940 | 3300046512 | Ga0495610_0071414 | Ga0495610_0071414_649_978 | 109 |
| 941 | 3300046513 | Ga0495616_0004718 | Ga0495616_0004718_6290_6619 | 109 |
| 942 | 3300046513 | Ga0495616_0014914 | Ga0495616_0014914_3409_3738 | 109 |
| 943 | 3300046513 | Ga0495616_0039394 | Ga0495616_0039394_1690_2019 | 109 |
| 944 | 3300046513 | Ga0495616_0045237 | Ga0495616_0045237_1739_2068 | 109 |
| 945 | 3300046513 | Ga0495616_0207586 | Ga0495616_0207586_168_497 | 109 |
| 946 | 3300046515 | Ga0495620_0002079 | Ga0495620_0002079_7330_7659 | 109 |
| 947 | 3300046515 | Ga0495620_0003930 | Ga0495620_0003930_5446_5775 | 109 |
| 948 | 3300046515 | Ga0495620_0004911 | Ga0495620_0004911_5602_5931 | 109 |
| 949 | 3300046515 | Ga0495620_0009877 | Ga0495620_0009877_3298_3627 | 109 |
| 950 | 3300046515 | Ga0495620_0034175 | Ga0495620_0034175_1571_1900 | 109 |
| 951 | 3300046515 | Ga0495620_0155932 | Ga0495620_0155932_432_761 | 109 |
| 952 | 3300046516 | Ga0495628_0853643 | Ga0495628_0853643_154_483 | 109 |
| 953 | 3300046517 | Ga0495630_0103393 | Ga0495630_0103393_1707_2036 | 109 |
| 954 | 3300046517 | Ga0495630_0135343 | Ga0495630_0135343_1043_1372 | 109 |
| 955 | 3300046517 | Ga0495630_0301436 | Ga0495630_0301436_140_469 | 109 |
| 956 | 3300046518 | Ga0495631_0001595 | Ga0495631_0001595_7260_7589 | 109 |
| 957 | 3300046518 | Ga0495631_0024408 | Ga0495631_0024408_731_1060 | 109 |
| 958 | 3300046518 | Ga0495631_0030286 | Ga0495631_0030286_1726_2055 | 109 |
| 959 | 3300046518 | Ga0495631_0047306 | Ga0495631_0047306_72_401 | 109 |
| 960 | 3300046518 | Ga0495631_0175573 | Ga0495631_0175573_428_757 | 109 |
| 961 | 3300046518 | Ga0495631_0277975 | Ga0495631_0277975_13_342 | 109 |
| 962 | 3300046519 | Ga0495632_0006130 | Ga0495632_0006130_4835_5164 | 109 |
| 963 | 3300046519 | Ga0495632_0006981 | Ga0495632_0006981_5038_5367 | 109 |
| 964 | 3300046519 | Ga0495632_0007851 | Ga0495632_0007851_4739_5068 | 109 |
| 965 | 3300046519 | Ga0495632_0038866 | Ga0495632_0038866_523_852 | 109 |
| 966 | 3300046519 | Ga0495632_0054897 | Ga0495632_0054897_52_381 | 109 |
| 967 | 3300046519 | Ga0495632_0059273 | Ga0495632_0059273_1198_1527 | 109 |
| 968 | 3300046519 | Ga0495632_0085924 | Ga0495632_0085924_731_1060 | 109 |
| 969 | 3300046519 | Ga0495632_0237222 | Ga0495632_0237222_401_730 | 109 |
| 970 | 3300046519 | Ga0495632_0471166 | Ga0495632_0471166_111_440 | 109 |
| 971 | 3300046520 | Ga0495637_0005605 | Ga0495637_0005605_2776_3105 | 109 |
| 972 | 3300046520 | Ga0495637_0011553 | Ga0495637_0011553_1596_1925 | 109 |
| 973 | 3300046520 | Ga0495637_0013587 | Ga0495637_0013587_2006_2335 | 109 |
| 974 | 3300046520 | Ga0495637_0015066 | Ga0495637_0015066_650_979 | 109 |
| 975 | 3300046520 | Ga0495637_0016164 | Ga0495637_0016164_1253_1582 | 109 |
| 976 | 3300046520 | Ga0495637_0029129 | Ga0495637_0029129_1551_1880 | 109 |
| 977 | 3300046520 | Ga0495637_0044103 | Ga0495637_0044103_530_859 | 109 |
| 978 | 3300046520 | Ga0495637_0066593 | Ga0495637_0066593_530_859 | 109 |
| 979 | 3300046520 | Ga0495637_0101046 | Ga0495637_0101046_365_694 | 109 |
| 980 | 3300046520 | Ga0495637_0143858 | Ga0495637_0143858_174_503 | 109 |
| 981 | 3300046522 | Ga0495643_0014229 | Ga0495643_0014229_3554_3883 | 109 |
| 982 | 3300046522 | Ga0495643_0030455 | Ga0495643_0030455_90_419 | 109 |
| 983 | 3300046522 | Ga0495643_0074948 | Ga0495643_0074948_501_830 | 109 |
| 984 | 3300046522 | Ga0495643_0080477 | Ga0495643_0080477_1352_1681 | 109 |
| 985 | 3300046522 | Ga0495643_0156469 | Ga0495643_0156469_530_859 | 109 |
| 986 | 3300046522 | Ga0495643_0198434 | Ga0495643_0198434_489_818 | 109 |
| 987 | 3300046522 | Ga0495643_0249213 | Ga0495643_0249213_15_344 | 109 |
| 988 | 3300046522 | Ga0495643_0379628 | Ga0495643_0379628_286_615 | 109 |
| 989 | 3300046523 | Ga0495644_0067435 | Ga0495644_0067435_150_479 | 109 |
| 990 | 3300046523 | Ga0495644_0176274 | Ga0495644_0176274_359_688 | 109 |
| 991 | 3300046523 | Ga0495644_0401425 | Ga0495644_0401425_118_447 | 109 |
| 992 | 3300046524 | Ga0495648_0003237 | Ga0495648_0003237_4222_4551 | 109 |
| 993 | 3300046524 | Ga0495648_0006229 | Ga0495648_0006229_3719_4048 | 109 |
| 994 | 3300046524 | Ga0495648_0008767 | Ga0495648_0008767_1896_2225 | 109 |
| 995 | 3300046524 | Ga0495648_0027655 | Ga0495648_0027655_2988_3317 | 109 |
| 996 | 3300046524 | Ga0495648_0036639 | Ga0495648_0036639_2121_2450 | 109 |
| 997 | 3300046524 | Ga0495648_0051414 | Ga0495648_0051414_310_639 | 109 |
| 998 | 3300046524 | Ga0495648_0051615 | Ga0495648_0051615_540_869 | 109 |
| 999 | 3300046524 | Ga0495648_0062503 | Ga0495648_0062503_305_634 | 109 |
| 1000 | 3300046524 | Ga0495648_0105954 | Ga0495648_0105954_883_1212 | 109 |
| 1001 | 3300046524 | Ga0495648_0122100 | Ga0495648_0122100_339_668 | 109 |
| 1002 | 3300046524 | Ga0495648_0171523 | Ga0495648_0171523_630_959 | 109 |
| 1003 | 3300046524 | Ga0495648_0193086 | Ga0495648_0193086_78_407 | 109 |
| 1004 | 3300046526 | Ga0495666_0018221 | Ga0495666_0018221_1883_2212 | 109 |
| 1005 | 3300046526 | Ga0495666_0532493 | Ga0495666_0532493_158_487 | 109 |
| 1006 | 3300046528 | Ga0495642_0001384 | Ga0495642_0001384_5828_6157 | 109 |
| 1007 | 3300046530 | Ga0495654_0000784 | Ga0495654_0000784_1669_1998 | 109 |
| 1008 | 3300046530 | Ga0495654_0002404 | Ga0495654_0002404_19_348 | 109 |
| 1009 | 3300046530 | Ga0495654_0007972 | Ga0495654_0007972_2514_2843 | 109 |
| 1010 | 3300046530 | Ga0495654_0011513 | Ga0495654_0011513_4127_4456 | 109 |
| 1011 | 3300046530 | Ga0495654_0011693 | Ga0495654_0011693_3409_3738 | 109 |
| 1012 | 3300046530 | Ga0495654_0013416 | Ga0495654_0013416_2380_2709 | 109 |
| 1013 | 3300046530 | Ga0495654_0021368 | Ga0495654_0021368_1666_1995 | 109 |
| 1014 | 3300046530 | Ga0495654_0028240 | Ga0495654_0028240_2228_2557 | 109 |
| 1015 | 3300046530 | Ga0495654_0051346 | Ga0495654_0051346_71_400 | 109 |
| 1016 | 3300046530 | Ga0495654_0069414 | Ga0495654_0069414_607_936 | 109 |
| 1017 | 3300046530 | Ga0495654_0436540 | Ga0495654_0436540_48_377 | 109 |
| 1018 | 3300046538 | Ga0495609_0002842 | Ga0495609_0002842_6920_7249 | 109 |
| 1019 | 3300046538 | Ga0495609_0030820 | Ga0495609_0030820_1226_1555 | 109 |
| 1020 | 3300046538 | Ga0495609_0032378 | Ga0495609_0032378_1391_1720 | 109 |
| 1021 | 3300046538 | Ga0495609_0038569 | Ga0495609_0038569_1534_1863 | 109 |
| 1022 | 3300046538 | Ga0495609_0039190 | Ga0495609_0039190_942_1271 | 109 |
| 1023 | 3300046538 | Ga0495609_0081320 | Ga0495609_0081320_926_1255 | 109 |
| 1024 | 3300046538 | Ga0495609_0142674 | Ga0495609_0142674_474_803 | 109 |
| 1025 | 3300046538 | Ga0495609_0463732 | Ga0495609_0463732_103_432 | 109 |
| 1026 | 3300046542 | Ga0495597_0004663 | Ga0495597_0004663_4573_4902 | 109 |
| 1027 | 3300046542 | Ga0495597_0014599 | Ga0495597_0014599_737_1066 | 109 |
| 1028 | 3300046542 | Ga0495597_0015825 | Ga0495597_0015825_2786_3115 | 109 |
| 1029 | 3300046542 | Ga0495597_0015984 | Ga0495597_0015984_774_1103 | 109 |
| 1030 | 3300046542 | Ga0495597_0016157 | Ga0495597_0016157_579_908 | 109 |
| 1031 | 3300046542 | Ga0495597_0074979 | Ga0495597_0074979_213_542 | 109 |
| 1032 | 3300046542 | Ga0495597_0085190 | Ga0495597_0085190_536_865 | 109 |
| 1033 | 3300046542 | Ga0495597_0174376 | Ga0495597_0174376_237_593 | 109 |
| 1034 | 3300046542 | Ga0495597_0178997 | Ga0495597_0178997_449_778 | 109 |
| 1035 | 3300046557 | Ga0495622_0003035 | Ga0495622_0003035_3371_3700 | 109 |
| 1036 | 3300046557 | Ga0495622_0007144 | Ga0495622_0007144_4325_4654 | 109 |
| 1037 | 3300046557 | Ga0495622_0016658 | Ga0495622_0016658_2599_2928 | 109 |
| 1038 | 3300046557 | Ga0495622_0046066 | Ga0495622_0046066_666_995 | 109 |
| 1039 | 3300046557 | Ga0495622_0053658 | Ga0495622_0053658_477_806 | 109 |
| 1040 | 3300046558 | Ga0495633_0009956 | Ga0495633_0009956_2497_2826 | 109 |
| 1041 | 3300046558 | Ga0495633_0021631 | Ga0495633_0021631_2423_2752 | 109 |
| 1042 | 3300046558 | Ga0495633_0359058 | Ga0495633_0359058_162_491 | 109 |
| 1043 | 3300046616 | Ga0495668_0045577 | Ga0495668_0045577_2068_2397 | 109 |
| 1044 | 3300046642 | Ga0495634_0005604 | Ga0495634_0005604_5862_6191 | 109 |
| 1045 | 3300046648 | Ga0495611_0004298 | Ga0495611_0004298_3072_3401 | 109 |
| 1046 | 3300046648 | Ga0495611_0261548 | Ga0495611_0261548_77_406 | 109 |
| 1047 | 3300046660 | Ga0495625_0018258 | Ga0495625_0018258_515_853 | 109 |
| 1048 | 3300046660 | Ga0495625_0038836 | Ga0495625_0038836_1658_1987 | 109 |
| 1049 | 3300046660 | Ga0495625_0058557 | Ga0495625_0058557_2376_2705 | 109 |
| 1050 | 3300046660 | Ga0495625_0058870 | Ga0495625_0058870_602_931 | 109 |
| 1051 | 3300046660 | Ga0495625_0106245 | Ga0495625_0106245_277_606 | 109 |
| 1052 | 3300046663 | Ga0495635_0007473 | Ga0495635_0007473_2663_2992 | 109 |
| 1053 | 3300046664 | Ga0495659_0015676 | Ga0495659_0015676_1878_2207 | 109 |
| 1054 | 3300046665 | Ga0495661_0002196 | Ga0495661_0002196_7194_7523 | 109 |
| 1055 | 3300046665 | Ga0495661_0003095 | Ga0495661_0003095_1437_1766 | 109 |
| 1056 | 3300046665 | Ga0495661_0029738 | Ga0495661_0029738_1907_2236 | 109 |
| 1057 | 3300046665 | Ga0495661_0059224 | Ga0495661_0059224_1555_1884 | 109 |
| 1058 | 3300046665 | Ga0495661_0063119 | Ga0495661_0063119_122_451 | 109 |
| 1059 | 3300046665 | Ga0495661_0245484 | Ga0495661_0245484_479_808 | 109 |
| 1060 | 3300046679 | Ga0495623_0021747 | Ga0495623_0021747_862_1191 | 109 |
| 1061 | 3300046679 | Ga0495623_0063065 | Ga0495623_0063065_1252_1581 | 109 |
| 1062 | 3300046680 | Ga0495646_0004545 | Ga0495646_0004545_2559_2888 | 109 |
| 1063 | 3300046680 | Ga0495646_0269496 | Ga0495646_0269496_485_814 | 109 |
| 1064 | 3300046684 | Ga0495669_0004912 | Ga0495669_0004912_2407_2736 | 109 |
| 1065 | 3300046689 | Ga0495613_0039865 | Ga0495613_0039865_536_865 | 109 |
| 1066 | 3300046691 | Ga0495670_0002237 | Ga0495670_0002237_5447_5776 | 109 |
| 1067 | 3300046691 | Ga0495670_0017224 | Ga0495670_0017224_2687_3016 | 109 |
| 1068 | 3300046691 | Ga0495670_0031511 | Ga0495670_0031511_611_940 | 109 |
| 1069 | 3300046691 | Ga0495670_0071587 | Ga0495670_0071587_998_1327 | 109 |
| 1070 | 3300046691 | Ga0495670_0584722 | Ga0495670_0584722_158_487 | 109 |
| 1071 | 3300046692 | Ga0495671_0006661 | Ga0495671_0006661_1189_1518 | 109 |
| 1072 | 3300046692 | Ga0495671_0009549 | Ga0495671_0009549_3426_3755 | 109 |
| 1073 | 3300046692 | Ga0495671_0015385 | Ga0495671_0015385_475_804 | 109 |
| 1074 | 3300046692 | Ga0495671_0015940 | Ga0495671_0015940_2603_2932 | 109 |
| 1075 | 3300046692 | Ga0495671_0023109 | Ga0495671_0023109_1190_1519 | 109 |
| 1076 | 3300046692 | Ga0495671_0035567 | Ga0495671_0035567_1793_2122 | 109 |
| 1077 | 3300046692 | Ga0495671_0037044 | Ga0495671_0037044_497_826 | 109 |
| 1078 | 3300046692 | Ga0495671_0044765 | Ga0495671_0044765_73_402 | 109 |
| 1079 | 3300046692 | Ga0495671_0068470 | Ga0495671_0068470_1381_1710 | 109 |
| 1080 | 3300046692 | Ga0495671_0174216 | Ga0495671_0174216_619_948 | 109 |
| 1081 | 3300046692 | Ga0495671_0202090 | Ga0495671_0202090_88_417 | 109 |
| 1082 | 3300046694 | Ga0495649_0002103 | Ga0495649_0002103_13631_13960 | 109 |
| 1083 | 3300046694 | Ga0495649_0009685 | Ga0495649_0009685_3863_4192 | 109 |
| 1084 | 3300046694 | Ga0495649_0011065 | Ga0495649_0011065_2421_2750 | 109 |
| 1085 | 3300046694 | Ga0495649_0072621 | Ga0495649_0072621_1364_1693 | 109 |
| 1086 | 3300046694 | Ga0495649_0104174 | Ga0495649_0104174_711_1040 | 109 |
| 1087 | 3300046694 | Ga0495649_0152929 | Ga0495649_0152929_526_855 | 109 |
| 1088 | 3300046694 | Ga0495649_0257811 | Ga0495649_0257811_64_393 | 109 |
| 1089 | 3300046694 | Ga0495649_0280949 | Ga0495649_0280949_444_773 | 109 |
| 1090 | 3300046694 | Ga0495649_0294823 | Ga0495649_0294823_105_434 | 109 |
| 1091 | 3300046694 | Ga0495649_0322026 | Ga0495649_0322026_378_707 | 109 |
| 1092 | 3300046694 | Ga0495649_0420409 | Ga0495649_0420409_87_416 | 109 |
| 1093 | 3300046794 | Ga0495589_0005488 | Ga0495589_0005488_1877_2206 | 109 |
| 1094 | 3300046794 | Ga0495589_0011437 | Ga0495589_0011437_3425_3754 | 109 |
| 1095 | 3300046794 | Ga0495589_0014865 | Ga0495589_0014865_3119_3448 | 109 |
| 1096 | 3300046794 | Ga0495589_0027550 | Ga0495589_0027550_436_765 | 109 |
| 1097 | 3300046810 | Ga0495660_0004723 | Ga0495660_0004723_7657_7986 | 109 |
| 1098 | 3300046810 | Ga0495660_0014871 | Ga0495660_0014871_561_890 | 109 |
| 1099 | 3300046810 | Ga0495660_0015205 | Ga0495660_0015205_2712_3041 | 109 |
| 1100 | 3300046810 | Ga0495660_0015618 | Ga0495660_0015618_2398_2727 | 109 |
| 1101 | 3300046810 | Ga0495660_0016909 | Ga0495660_0016909_696_1025 | 109 |
| 1102 | 3300046810 | Ga0495660_0023372 | Ga0495660_0023372_1025_1354 | 109 |
| 1103 | 3300046810 | Ga0495660_0025680 | Ga0495660_0025680_1718_2047 | 109 |
| 1104 | 3300046810 | Ga0495660_0030921 | Ga0495660_0030921_27_356 | 109 |
| 1105 | 3300046810 | Ga0495660_0048115 | Ga0495660_0048115_305_634 | 109 |
| 1106 | 3300046810 | Ga0495660_0049343 | Ga0495660_0049343_1512_1841 | 109 |
| 1107 | 3300046810 | Ga0495660_0094356 | Ga0495660_0094356_476_805 | 109 |
| 1108 | 3300046810 | Ga0495660_0360870 | Ga0495660_0360870_109_438 | 109 |
| 1109 | 3300046810 | Ga0495660_0450211 | Ga0495660_0450211_78_407 | 109 |
| 1110 | 3300047315 | Ga0495581_0016703 | Ga0495581_0016703_1956_2285 | 109 |
| 1111 | 3300047317 | Ga0495604_0005474 | Ga0495604_0005474_7174_7503 | 109 |
| 1112 | 3300047317 | Ga0495604_0332902 | Ga0495604_0332902_87_416 | 109 |
| 1113 | 3300047318 | Ga0495636_0002017 | Ga0495636_0002017_1967_2296 | 109 |
| 1114 | 3300047318 | Ga0495636_0361412 | Ga0495636_0361412_21_350 | 109 |
| 1115 | 3300047319 | Ga0495674_0057529 | Ga0495674_0057529_3004_3333 | 109 |
| 1116 | 3300047320 | Ga0495672_0001771 | Ga0495672_0001771_103_432 | 109 |
| 1117 | 3300047320 | Ga0495672_0006315 | Ga0495672_0006315_860_1189 | 109 |
| 1118 | 3300047320 | Ga0495672_0012012 | Ga0495672_0012012_3378_3707 | 109 |
| 1119 | 3300047320 | Ga0495672_0023525 | Ga0495672_0023525_2771_3100 | 109 |
| 1120 | 3300047320 | Ga0495672_0026101 | Ga0495672_0026101_2571_2900 | 109 |
| 1121 | 3300047320 | Ga0495672_0095014 | Ga0495672_0095014_887_1216 | 109 |
| 1122 | 3300047320 | Ga0495672_0102384 | Ga0495672_0102384_1044_1373 | 109 |
| 1123 | 3300047321 | Ga0495676_0042527 | Ga0495676_0042527_764_1093 | 109 |
| 1124 | 3300047322 | Ga0495680_0033240 | Ga0495680_0033240_805_1134 | 109 |
| 1125 | 3300047322 | Ga0495680_0050082 | Ga0495680_0050082_601_930 | 109 |
| 1126 | 3300047322 | Ga0495680_0076006 | Ga0495680_0076006_476_805 | 109 |
| 1127 | 3300047323 | Ga0495683_0000519 | Ga0495683_0000519_2985_3314 | 109 |
| 1128 | 3300047323 | Ga0495683_0032444 | Ga0495683_0032444_573_902 | 109 |
| 1129 | 3300047323 | Ga0495683_0046212 | Ga0495683_0046212_1757_2086 | 109 |
| 1130 | 3300047323 | Ga0495683_0319425 | Ga0495683_0319425_99_428 | 109 |
| 1131 | 3300047323 | Ga0495683_0375692 | Ga0495683_0375692_214_543 | 109 |
| 1132 | 3300047443 | Ga0495687_001197 | Ga0495687_001197_23441_23797 | 109 |
| 1133 | 3300047443 | Ga0495687_008493 | Ga0495687_008493_3403_3732 | 109 |
| 1134 | 3300047443 | Ga0495687_132992 | Ga0495687_132992_481_810 | 109 |
| 1135 | 3300047444 | Ga0495675_0187607 | Ga0495675_0187607_277_606 | 109 |
| 1136 | 3300047445 | Ga0495677_0219662 | Ga0495677_0219662_313_642 | 109 |
| 1137 | 3300047446 | Ga0495679_000621 | Ga0495679_000621_1446_1775 | 109 |
| 1138 | 3300047446 | Ga0495679_009776 | Ga0495679_009776_990_1319 | 109 |
| 1139 | 3300047446 | Ga0495679_010978 | Ga0495679_010978_2699_3028 | 109 |
| 1140 | 3300047446 | Ga0495679_017869 | Ga0495679_017869_494_823 | 109 |
| 1141 | 3300047446 | Ga0495679_074556 | Ga0495679_074556_134_463 | 109 |
| 1142 | 3300047469 | Ga0495673_0001975 | Ga0495673_0001975_5022_5351 | 109 |
| 1143 | 3300047469 | Ga0495673_0002348 | Ga0495673_0002348_1375_1704 | 109 |
| 1144 | 3300047469 | Ga0495673_0006797 | Ga0495673_0006797_3298_3627 | 109 |
| 1145 | 3300047469 | Ga0495673_0007690 | Ga0495673_0007690_2607_2936 | 109 |
| 1146 | 3300047469 | Ga0495673_0013648 | Ga0495673_0013648_523_852 | 109 |
| 1147 | 3300047469 | Ga0495673_0016425 | Ga0495673_0016425_1448_1777 | 109 |
| 1148 | 3300047469 | Ga0495673_0021703 | Ga0495673_0021703_2436_2765 | 109 |
| 1149 | 3300047469 | Ga0495673_0037347 | Ga0495673_0037347_224_553 | 109 |
| 1150 | 3300047470 | Ga0495681_0000621 | Ga0495681_0000621_5662_5991 | 109 |
| 1151 | 3300047470 | Ga0495681_0006679 | Ga0495681_0006679_6512_6841 | 109 |
| 1152 | 3300047470 | Ga0495681_0007930 | Ga0495681_0007930_3261_3590 | 109 |
| 1153 | 3300047470 | Ga0495681_0010809 | Ga0495681_0010809_3315_3644 | 109 |
| 1154 | 3300047470 | Ga0495681_0013817 | Ga0495681_0013817_1528_1857 | 109 |
| 1155 | 3300047470 | Ga0495681_0025808 | Ga0495681_0025808_2687_3016 | 109 |
| 1156 | 3300047470 | Ga0495681_0040419 | Ga0495681_0040419_94_423 | 109 |
| 1157 | 3300047470 | Ga0495681_0060219 | Ga0495681_0060219_741_1070 | 109 |
| 1158 | 3300047470 | Ga0495681_0140931 | Ga0495681_0140931_499_828 | 109 |
| 1159 | 3300047471 | Ga0495684_0057665 | Ga0495684_0057665_392_721 | 109 |
| 1160 | 3300047472 | Ga0495686_0011662 | Ga0495686_0011662_5400_5729 | 109 |
| 1161 | 3300047472 | Ga0495686_0028247 | Ga0495686_0028247_3233_3562 | 109 |
| 1162 | 3300047472 | Ga0495686_0058119 | Ga0495686_0058119_557_886 | 109 |
| 1163 | 3300047673 | Ga0495593_0015578 | Ga0495593_0015578_2467_2796 | 109 |
| 1164 | 3300048088 | Ga0495602_0058351 | Ga0495602_0058351_494_823 | 109 |
| 1165 | 3300048091 | Ga0495626_0000781 | Ga0495626_0000781_8229_8558 | 109 |
| 1166 | 3300048091 | Ga0495626_0001420 | Ga0495626_0001420_14638_14967 | 109 |
| 1167 | 3300048091 | Ga0495626_0014922 | Ga0495626_0014922_435_764 | 109 |
| 1168 | 3300048091 | Ga0495626_0029367 | Ga0495626_0029367_1760_2089 | 109 |
| 1169 | 3300048091 | Ga0495626_0038983 | Ga0495626_0038983_1497_1826 | 109 |
| 1170 | 3300048091 | Ga0495626_0070542 | Ga0495626_0070542_845_1174 | 109 |
| 1171 | 3300048091 | Ga0495626_0080914 | Ga0495626_0080914_562_891 | 109 |
| 1172 | 3300048091 | Ga0495626_0146617 | Ga0495626_0146617_103_432 | 109 |
| 1173 | 3300048905 | Ga0496102_0006862 | Ga0496102_0006862_5759_6088 | 109 |
| 1174 | 3300048906 | Ga0496103_0003992 | Ga0496103_0003992_5375_5704 | 109 |
| 1175 | 3300048913 | Ga0496110_0854144 | Ga0496110_0854144_314_643 | 109 |
| 1176 | 3300048914 | Ga0496111_0180419 | Ga0496111_0180419_999_1328 | 109 |
| 1177 | 3300048915 | Ga0496112_0261879 | Ga0496112_0261879_950_1279 | 109 |
| 1178 | 3300048918 | Ga0496115_1448611 | Ga0496115_1448611_41_370 | 109 |
| 1179 | 3300048919 | Ga0496116_0000085 | Ga0496116_0000085_183752_184081 | 109 |
| 1180 | 3300048919 | Ga0496116_0015452 | Ga0496116_0015452_2665_2994 | 109 |
| 1181 | 3300048919 | Ga0496116_0026674 | Ga0496116_0026674_684_1013 | 109 |
| 1182 | 3300048919 | Ga0496116_0136720 | Ga0496116_0136720_884_1213 | 109 |
| 1183 | 3300048919 | Ga0496116_0204606 | Ga0496116_0204606_146_475 | 109 |
| 1184 | 3300048920 | Ga0496117_0001083 | Ga0496117_0001083_25877_26206 | 109 |
| 1185 | 3300048920 | Ga0496117_0008157 | Ga0496117_0008157_6000_6329 | 109 |
| 1186 | 3300048920 | Ga0496117_0023516 | Ga0496117_0023516_3051_3380 | 109 |
| 1187 | 3300048920 | Ga0496117_0037465 | Ga0496117_0037465_1839_2168 | 109 |
| 1188 | 3300048920 | Ga0496117_0042455 | Ga0496117_0042455_54_383 | 109 |
| 1189 | 3300048920 | Ga0496117_0255767 | Ga0496117_0255767_124_453 | 109 |
| 1190 | 3300048921 | Ga0496118_0010079 | Ga0496118_0010079_212_541 | 109 |
| 1191 | 3300048921 | Ga0496118_0013576 | Ga0496118_0013576_7082_7411 | 109 |
| 1192 | 3300048921 | Ga0496118_0017227 | Ga0496118_0017227_3137_3466 | 109 |
| 1193 | 3300048921 | Ga0496118_0034320 | Ga0496118_0034320_1047_1376 | 109 |
| 1194 | 3300048921 | Ga0496118_0077732 | Ga0496118_0077732_1496_1825 | 109 |
| 1195 | 3300048922 | Ga0496119_0023660 | Ga0496119_0023660_3918_4247 | 109 |
| 1196 | 3300048922 | Ga0496119_0128944 | Ga0496119_0128944_898_1227 | 109 |
| 1197 | 3300048922 | Ga0496119_0162752 | Ga0496119_0162752_723_1052 | 109 |
| 1198 | 3300048923 | Ga0496120_0007999 | Ga0496120_0007999_4089_4418 | 109 |
| 1199 | 3300048923 | Ga0496120_0014080 | Ga0496120_0014080_1058_1387 | 109 |
| 1200 | 3300048923 | Ga0496120_0023314 | Ga0496120_0023314_1194_1523 | 109 |
| 1201 | 3300048924 | Ga0496121_0000505 | Ga0496121_0000505_38805_39134 | 109 |
| 1202 | 3300048924 | Ga0496121_0023128 | Ga0496121_0023128_3045_3374 | 109 |
| 1203 | 3300048924 | Ga0496121_0106897 | Ga0496121_0106897_125_454 | 109 |
| 1204 | 3300048924 | Ga0496121_0272838 | Ga0496121_0272838_149_478 | 109 |
| 1205 | 3300048925 | Ga0496122_0016161 | Ga0496122_0016161_3656_3985 | 109 |
| 1206 | 3300048925 | Ga0496122_0085139 | Ga0496122_0085139_981_1310 | 109 |
| 1207 | 3300048926 | Ga0496123_0006202 | Ga0496123_0006202_5282_5611 | 109 |
| 1208 | 3300048926 | Ga0496123_0029384 | Ga0496123_0029384_873_1202 | 109 |
| 1209 | 3300048927 | Ga0496124_0010005 | Ga0496124_0010005_3354_3683 | 109 |
| 1210 | 3300048927 | Ga0496124_0033056 | Ga0496124_0033056_1374_1703 | 109 |
| 1211 | 3300048927 | Ga0496124_0105664 | Ga0496124_0105664_752_1081 | 109 |
| 1212 | 3300048927 | Ga0496124_0154721 | Ga0496124_0154721_529_858 | 109 |
| 1213 | 3300048927 | Ga0496124_0231892 | Ga0496124_0231892_816_1145 | 109 |
| 1214 | 3300048928 | Ga0496125_0009460 | Ga0496125_0009460_3674_4003 | 109 |
| 1215 | 3300048928 | Ga0496125_0037515 | Ga0496125_0037515_3568_3897 | 109 |
| 1216 | 3300048928 | Ga0496125_0045252 | Ga0496125_0045252_1658_1987 | 109 |
| 1217 | 3300048928 | Ga0496125_0048393 | Ga0496125_0048393_233_562 | 109 |
| 1218 | 3300048928 | Ga0496125_0053638 | Ga0496125_0053638_2757_3086 | 109 |
| 1219 | 3300048929 | Ga0496126_0065462 | Ga0496126_0065462_2480_2809 | 109 |
| 1220 | 3300049459 | Ga0495678_003644 | Ga0495678_003644_5380_5709 | 109 |
| 1221 | 3300049459 | Ga0495678_008634 | Ga0495678_008634_15_344 | 109 |
| 1222 | 3300049459 | Ga0495678_025493 | Ga0495678_025493_1801_2130 | 109 |
| 1223 | 3300049459 | Ga0495678_026553 | Ga0495678_026553_773_1102 | 109 |
| 1224 | 3300049459 | Ga0495678_040255 | Ga0495678_040255_56_385 | 109 |
| 1225 | 3300049459 | Ga0495678_053273 | Ga0495678_053273_576_905 | 109 |
| 1226 | 3300049459 | Ga0495678_135496 | Ga0495678_135496_321_650 | 109 |
| 1227 | 3300049459 | Ga0495678_225402 | Ga0495678_225402_133_462 | 109 |
| 1228 | 3300049460 | Ga0495682_0001329 | Ga0495682_0001329_3592_3921 | 109 |
| 1229 | 3300049460 | Ga0495682_0013257 | Ga0495682_0013257_387_716 | 109 |
| 1230 | 3300049460 | Ga0495682_0250408 | Ga0495682_0250408_38_367 | 109 |
| 1231 | 3300049460 | Ga0495682_0369401 | Ga0495682_0369401_121_450 | 109 |
| 1232 | 3300050491 | nmdc:mga00v17_36416_c1 | nmdc:mga00v17_36416_c1_2540_2869 | 109 |
| 1233 | 3300050491 | nmdc:mga00v17_528181_c1 | nmdc:mga00v17_528181_c1_355_684 | 109 |
| 1234 | 3300050514 | nmdc:mga08x19_26948_c1 | nmdc:mga08x19_26948_c1_1549_1878 | 109 |
| 1235 | 3300053111 | Ga0500572_008391 | Ga0500572_008391_1690_2019 | 109 |
| 1236 | 3300053161 | Ga0500634_0001481 | Ga0500634_0001481_7563_7892 | 109 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar