F492040

General Info

Members Datasets Scaffolds Average Seq Length
1236 465 1036 108

Family's Representative Sequence

Representative Sequence 3300046463|Ga0495653_0001863|Ga0495653_0001863_5233_5616
Length 127
Sequence MSTTTPRQAIALSYDRQNAPTLTAKGDDELAEAILAVAREYEVPIYENAELVKMLARLELGDSIPEELYRTIAVIIAFAWRLQGKRPADFVEPQPGPEKDVTPVGGLLGSAKGQGQARPRSTTPGDH

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231011 Pseudomonas sp. GM30 Isolate Nodule
7 2511231016 Pseudomonas sp. GM50 Isolate Nodule
8 2511231031 Pseudomonas sp. GM16 Isolate Nodule
9 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
10 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
11 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
12 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
13 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
14 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
15 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
16 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
17 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
18 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
19 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
20 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
21 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
22 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
23 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
24 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
25 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
26 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
27 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
28 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
29 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
30 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
31 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
32 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
33 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
34 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
35 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
36 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
37 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
38 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
39 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
40 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
41 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
42 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
43 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
44 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
45 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
46 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
47 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
48 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
49 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
50 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
51 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
52 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
53 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
54 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
55 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
56 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
57 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
58 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
59 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
60 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
61 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
62 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
63 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
64 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
65 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
66 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
67 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
68 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
69 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
70 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
71 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
72 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
73 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
74 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
75 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
76 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
77 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
78 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
79 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
80 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
81 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
82 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
83 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
84 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
85 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
86 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
87 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
88 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
89 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
90 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
91 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
92 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
93 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
94 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
95 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
96 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
97 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
98 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
99 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
100 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
101 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
102 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
103 2773857670 Pseudomonas sp. 478 Isolate Unclassified
104 2773857673 Pseudomonas sp. 443 Isolate Unclassified
105 2784132063 Pseudomonas sp. 424 Isolate Unclassified
106 2784132072 Pseudomonas sp. 460 Isolate Unclassified
107 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
108 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
109 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
110 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
111 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
112 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
113 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
114 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
115 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
116 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
117 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
118 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
119 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
120 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
121 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
122 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
123 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
124 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
125 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
126 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
127 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
128 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
129 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
130 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
131 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
132 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
133 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
134 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
135 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
136 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
137 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
138 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
139 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
140 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
141 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
142 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
143 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
144 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
145 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
146 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
147 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
148 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
149 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
150 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
151 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
152 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
153 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
154 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
155 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
156 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
157 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
158 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
159 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
160 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
161 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
162 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
163 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
164 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
165 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
166 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
167 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
168 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
169 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
170 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
171 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
172 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
173 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
174 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
175 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
176 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
177 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
178 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
179 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
180 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
181 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
182 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
183 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
184 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
185 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
186 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
187 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
188 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
189 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
190 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
191 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
192 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
193 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
194 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
195 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
196 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
197 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
198 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
199 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
200 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
201 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
202 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
203 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
204 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
205 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
206 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
207 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
208 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
209 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
210 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
211 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
212 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
213 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
214 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
215 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
216 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
217 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
218 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
219 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
220 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
221 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
222 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
223 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
224 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
225 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
226 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
227 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
228 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
229 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
230 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
231 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
232 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
233 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
234 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
235 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
236 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
237 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
238 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
239 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
241 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
245 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
246 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
247 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
248 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
250 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
251 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
252 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
253 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
255 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
273 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
276 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
280 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
281 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
282 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
283 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
284 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
285 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
286 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
287 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
288 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
289 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
290 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
291 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
292 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
293 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
294 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
295 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
296 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
297 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
298 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
299 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
300 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
301 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
302 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
303 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
304 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
305 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
306 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
307 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
308 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
309 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
310 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
311 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
312 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
313 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
314 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
315 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
316 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
317 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
318 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
319 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
320 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
321 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
322 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
323 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
324 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
325 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
326 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
327 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
328 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
329 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
330 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
331 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
332 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
333 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
334 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
335 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
336 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
337 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
338 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
339 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
340 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
341 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
342 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
343 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
344 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
345 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
346 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
347 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
348 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
349 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
350 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
351 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
352 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
353 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
354 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
355 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
356 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
357 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
358 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
359 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
360 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
361 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
362 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
363 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
364 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
365 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
366 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
367 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
368 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
369 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
370 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
371 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
372 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
373 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
374 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
375 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
376 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
377 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
378 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
379 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
380 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
381 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
382 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
383 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
384 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
385 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
386 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
387 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
388 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
389 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
390 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
391 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
392 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
393 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
394 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
395 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
396 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
397 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
398 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
399 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
400 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
401 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
402 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
403 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
404 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
405 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
406 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
407 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
408 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
409 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
410 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
411 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
412 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
413 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
414 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
415 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
416 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
417 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
418 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
419 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
420 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
421 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
422 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
423 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
424 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
425 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
426 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
427 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
428 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
429 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
430 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
431 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
437 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
438 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
439 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
440 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
441 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
442 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
443 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
444 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
445 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
446 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
447 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
448 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
449 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
450 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
451 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
452 8052494512 Pseudomonas putida LD6 Isolate Unclassified
453 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
454 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
455 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
456 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
457 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
458 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
459 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
460 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
461 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
462 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
463 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
464 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
465 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.06
Metatranscriptomes 0
Isolates 15.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.5
Nodule 1.13
Rhizoplane 6.15
Rhizosphere 77.1
Stem 0
Stem Tuber 0
Unclassified 10.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_746 2124908027 Bacteria 35830
2 SwRhRL2b_contig_936219 2162886007 Bacteria 5778
3 JGI25156J39149_1025463 3300002705 Bacteria 951
4 JGI25162J39368_1000037 3300002737 Bacteria 179339
5 JGI25162J39368_1000212 3300002737 Bacteria 61036
6 JGI25163J39215_1000442 3300002771 Bacteria 12724
7 JGI25163J39215_1000503 3300002771 Bacteria 11630
8 JGI25164J39214_1000020 3300002772 Bacteria 179339
9 JGI25164J39214_1000051 3300002772 Bacteria 122377
10 JGI25165J46597_1000077 3300003214 Bacteria 179339
11 JGI25165J46597_1000091 3300003214 Bacteria 167941
12 rootH1_10334418 3300003323 Bacteria 1558
13 Ga0055538_1000090 3300003751 Bacteria 78300
14 Ga0055539_1000134 3300003752 Bacteria 78300
15 Ga0055533_1000138 3300003756 Bacteria 78275
16 Ga0055532_1000142 3300003758 Bacteria 69999
17 Ga0055525_1000183 3300003759 Bacteria 78300
18 Ga0055536_1000165 3300003781 Bacteria 56046
19 Ga0055536_1000886 3300003781 Bacteria 19484
20 Ga0055534_1047226 3300003784 Bacteria 619
21 Ga0055530_10000158 3300003791 Bacteria 61440
22 Ga0055530_10001115 3300003791 Bacteria 20999
23 Ga0055540_1000182 3300003792 Bacteria 61440
24 Ga0055540_1001167 3300003792 Bacteria 16310
25 Ga0055541_1000089 3300003841 Bacteria 78275
26 Ga0065714_10002255 3300005288 Bacteria 42568
27 Ga0065714_10002585 3300005288 Bacteria 18890
28 Ga0065714_10009355 3300005288 Bacteria 3078
29 Ga0065714_10040982 3300005288 Bacteria 835
30 Ga0065714_10080800 3300005288 Bacteria 2385
31 Ga0065714_10090909 3300005288 Bacteria 1928
32 Ga0065714_10347257 3300005288 Bacteria 631
33 Ga0065704_10070596 3300005289 Bacteria 19482
34 Ga0065704_10114457 3300005289 Bacteria 1886
35 Ga0065704_10520469 3300005289 Bacteria 654
36 Ga0065704_10576452 3300005289 Bacteria 620
37 Ga0065712_10068150 3300005290 Bacteria 13828
38 Ga0065715_10755421 3300005293 Bacteria 628
39 Ga0070670_100001221 3300005331 Bacteria 20451
40 Ga0070670_100053848 3300005331 Bacteria 3455
41 Ga0070661_100000029 3300005344 Bacteria 117682
42 Ga0070669_100000316 3300005353 Bacteria 37853
43 Ga0070662_100016721 3300005457 Bacteria 4931
44 Ga0068853_100008519 3300005539 Bacteria 8242
45 Ga0070664_100000046 3300005564 Bacteria 74475
46 Ga0068851_10000050 3300005834 Bacteria 72913
47 Ga0075364_10231658 3300006051 Bacteria 1254
48 Ga0075364_10324408 3300006051 Bacteria 1049
49 Ga0075364_10514232 3300006051 Bacteria 818
50 Ga0075432_10017532 3300006058 Bacteria 2442
51 Ga0075432_10086986 3300006058 Bacteria 1140
52 Ga0075432_10108892 3300006058 Bacteria 1031
53 Ga0075432_10344045 3300006058 Bacteria 630
54 Ga0075432_10419162 3300006058 Bacteria 581
55 Ga0075362_10098343 3300006177 Bacteria 1365
56 Ga0075362_10397381 3300006177 Bacteria 695
57 Ga0075369_10478098 3300006186 Bacteria 591
58 Ga0075369_10578558 3300006186 Bacteria 537
59 Ga0075370_10932662 3300006353 Bacteria 531
60 Ga0075436_100043124 3300006914 Bacteria 3110
61 Ga0075436_100593592 3300006914 Bacteria 815
62 Ga0075436_101107710 3300006914 Bacteria 596
63 Ga0079104_1000545 3300006946 Bacteria 39305
64 Ga0079104_1000574 3300006946 Bacteria 37165
65 Ga0099826_10002700 3300006948 Bacteria 11593
66 Ga0105251_10000060 3300009011 Bacteria 102799
67 Ga0105251_10000093 3300009011 Bacteria 86755
68 Ga0105251_10002821 3300009011 Bacteria 13145
69 Ga0105251_10009019 3300009011 Bacteria 5944
70 Ga0105251_10011769 3300009011 Bacteria 4982
71 Ga0105251_10045755 3300009011 Bacteria 2108
72 Ga0105251_10142509 3300009011 Bacteria 1084
73 Ga0105251_10175261 3300009011 Bacteria 966
74 Ga0105251_10356462 3300009011 Bacteria 668
75 Ga0105251_10652946 3300009011 Bacteria 503
76 Ga0105244_10000425 3300009036 Bacteria 39065
77 Ga0105244_10006180 3300009036 Bacteria 7811
78 Ga0105244_10009403 3300009036 Bacteria 6012
79 Ga0105244_10013620 3300009036 Bacteria 4741
80 Ga0105244_10014015 3300009036 Bacteria 4653
81 Ga0105244_10022723 3300009036 Bacteria 3448
82 Ga0105244_10024831 3300009036 Bacteria 3266
83 Ga0105244_10041755 3300009036 Bacteria 2376
84 Ga0105244_10044688 3300009036 Bacteria 2281
85 Ga0105244_10204121 3300009036 Bacteria 931
86 Ga0105244_10226688 3300009036 Bacteria 875
87 Ga0105244_10226689 3300009036 Bacteria 875
88 Ga0105250_10000074 3300009092 Bacteria 91652
89 Ga0105250_10000443 3300009092 Bacteria 29996
90 Ga0105250_10006271 3300009092 Bacteria 5215
91 Ga0105250_10006633 3300009092 Bacteria 5039
92 Ga0105250_10050006 3300009092 Bacteria 1677
93 Ga0105250_10093600 3300009092 Bacteria 1224
94 Ga0105243_10000158 3300009148 Bacteria 77305
95 Ga0105243_10000686 3300009148 Bacteria 33024
96 Ga0105243_10074167 3300009148 Bacteria 2759
97 Ga0105243_10343313 3300009148 Bacteria 1368
98 Ga0105242_10000360 3300009176 Bacteria 36330
99 Ga0105242_10517950 3300009176 Bacteria 1137
100 Ga0105248_10321002 3300009177 Bacteria 1744
101 Ga0105237_10001262 3300009545 Bacteria 33775
102 Ga0105237_10189228 3300009545 Bacteria 2058
103 Ga0105238_11390581 3300009551 Bacteria 729
104 Ga0105249_11200704 3300009553 Bacteria 830
105 Ga0105246_10000222 3300011119 Bacteria 28940
106 Ga0105246_10000876 3300011119 Bacteria 17243
107 Ga0105246_10008949 3300011119 Bacteria 6163
108 Ga0105246_10011023 3300011119 Bacteria 5602
109 Ga0157345_1000204 3300012498 Bacteria 9058
110 Ga0157347_1021565 3300012502 Bacteria 757
111 Ga0157373_10005441 3300013100 Bacteria 9564
112 Ga0157373_10012648 3300013100 Bacteria 6206
113 Ga0157373_10018039 3300013100 Bacteria 5139
114 Ga0157373_10018658 3300013100 Bacteria 5049
115 Ga0157373_10020190 3300013100 Bacteria 4845
116 Ga0157373_10022401 3300013100 Bacteria 4584
117 Ga0157371_10000513 3300013102 Bacteria 46606
118 Ga0157371_10000546 3300013102 Bacteria 44800
119 Ga0157371_10006014 3300013102 Bacteria 10111
120 Ga0157371_10010699 3300013102 Bacteria 7124
121 Ga0157371_11452969 3300013102 Bacteria 534
122 Ga0157370_10006411 3300013104 Bacteria 12978
123 Ga0157370_10098872 3300013104 Bacteria 2735
124 Ga0157370_10214040 3300013104 Bacteria 1785
125 Ga0157370_10253639 3300013104 Bacteria 1627
126 Ga0157370_10257479 3300013104 Bacteria 1613
127 Ga0157370_10539341 3300013104 Bacteria 1070
128 Ga0157370_10861112 3300013104 Bacteria 823
129 Ga0157369_10003927 3300013105 Bacteria 17636
130 Ga0157369_10027328 3300013105 Bacteria 6326
131 Ga0157369_10063255 3300013105 Bacteria 3987
132 Ga0157369_10104912 3300013105 Bacteria 3009
133 Ga0157369_10620541 3300013105 Bacteria 1116
134 Ga0157369_10955212 3300013105 Bacteria 878
135 Ga0157369_11069945 3300013105 Bacteria 825
136 Ga0157369_11503589 3300013105 Bacteria 685
137 Ga0157369_11765104 3300013105 Bacteria 628
138 Ga0157369_12427419 3300013105 Bacteria 531
139 Ga0163162_10009243 3300013306 Bacteria 9589
140 Ga0163162_10064941 3300013306 Bacteria 3696
141 Ga0163162_10472413 3300013306 Bacteria 1385
142 Ga0157372_10024791 3300013307 Bacteria 6518
143 Ga0157375_10034168 3300013308 Bacteria 4841
144 Ga0157375_10064541 3300013308 Bacteria 3646
145 Ga0157375_10090283 3300013308 Bacteria 3122
146 Ga0157375_10176459 3300013308 Bacteria 2286
147 Ga0157375_11404586 3300013308 Bacteria 822
148 Ga0182008_10000040 3300014497 Bacteria 120886
149 Ga0182008_10005526 3300014497 Bacteria 7188
150 Ga0182008_10007769 3300014497 Bacteria 5901
151 Ga0182008_10037856 3300014497 Bacteria 2413
152 Ga0182006_1000780 3300015261 Bacteria 21588
153 Ga0182006_1006561 3300015261 Bacteria 5394
154 Ga0182006_1009115 3300015261 Bacteria 4462
155 Ga0182006_1009778 3300015261 Bacteria 4288
156 Ga0182006_1010411 3300015261 Bacteria 4137
157 Ga0182006_1100196 3300015261 Bacteria 1029
158 Ga0182006_1165468 3300015261 Bacteria 743
159 Ga0182006_1192034 3300015261 Bacteria 678
160 Ga0182007_10010626 3300015262 Bacteria 3626
161 Ga0182005_1006110 3300015265 Bacteria 3710
162 Ga0182005_1007572 3300015265 Bacteria 3250
163 Ga0182005_1040982 3300015265 Bacteria 1259
164 Ga0163161_10016933 3300017792 Bacteria 5096
165 Ga0163161_10024761 3300017792 Bacteria 4243
166 Ga0163161_10048839 3300017792 Bacteria 3056
167 Ga0163161_10061578 3300017792 Bacteria 2732
168 Ga0163161_10070786 3300017792 Bacteria 2551
169 Ga0163161_10173224 3300017792 Bacteria 1651
170 Ga0163161_10305602 3300017792 Bacteria 1254
171 Ga0163161_10438064 3300017792 Bacteria 1054
172 Ga0163161_10609746 3300017792 Bacteria 901
173 Ga0163161_10821983 3300017792 Bacteria 782
174 Ga0163161_10951329 3300017792 Bacteria 731
175 Ga0209435_101205 3300025206 Bacteria 3482
176 Ga0209760_100022 3300025207 Bacteria 159218
177 Ga0209760_100053 3300025207 Bacteria 103438
178 Ga0209784_100040 3300025224 Bacteria 231812
179 Ga0209566_100051 3300025225 Bacteria 231920
180 Ga0209674_100072 3300025226 Bacteria 231812
181 Ga0209147_100067 3300025229 Bacteria 231812
182 Ga0209563_100073 3300025230 Bacteria 231920
183 Ga0207427_100001 3300025231 Bacteria 1410763
184 Ga0207427_100047 3300025231 Bacteria 240409
185 Ga0209437_100003 3300025233 Bacteria 1517827
186 Ga0209437_100009 3300025233 Bacteria 915954
187 Ga0209258_100490 3300025242 Bacteria 40292
188 Ga0209646_1000383 3300025246 Bacteria 28428
189 Ga0209677_100121 3300025253 Bacteria 80378
190 Ga0209759_1004999 3300025256 Bacteria 4773
191 Ga0209759_1038855 3300025256 Bacteria 842
192 Ga0209233_1000007 3300025261 Bacteria 1411234
193 Ga0209233_1000032 3300025261 Bacteria 623596
194 Ga0209130_1022427 3300025284 Bacteria 1409
195 Ga0209675_1002532 3300025291 Bacteria 9297
196 Ga0209676_1000016 3300025292 Bacteria 655561
197 Ga0209676_1000021 3300025292 Bacteria 609534
198 Ga0209676_1000033 3300025292 Bacteria 463236
199 Ga0209676_1022616 3300025292 Bacteria 2078
200 Ga0209050_1000009 3300025298 Bacteria 1047265
201 Ga0209050_1000036 3300025298 Bacteria 423070
202 Ga0209050_1000595 3300025298 Bacteria 57712
203 Ga0209051_1000008 3300025303 Bacteria 706935
204 Ga0209051_1000043 3300025303 Bacteria 305473
205 Ga0209051_1000407 3300025303 Bacteria 59487
206 Ga0209257_1000098 3300025304 Bacteria 256390
207 Ga0209257_1014823 3300025304 Bacteria 3308
208 Ga0209257_1031961 3300025304 Bacteria 1675
209 Ga0207656_10000293 3300025321 Bacteria 17271
210 Ga0207696_1000045 3300025711 Bacteria 296484
211 Ga0207696_1000101 3300025711 Bacteria 170899
212 Ga0207696_1004427 3300025711 Bacteria 6057
213 Ga0207696_1021804 3300025711 Bacteria 2046
214 Ga0207696_1023426 3300025711 Bacteria 1947
215 Ga0207696_1029694 3300025711 Bacteria 1667
216 Ga0207696_1076456 3300025711 Bacteria 927
217 Ga0207655_1000019 3300025728 Bacteria 536324
218 Ga0207655_1000337 3300025728 Bacteria 68266
219 Ga0207655_1001070 3300025728 Bacteria 27170
220 Ga0207655_1004518 3300025728 Bacteria 9838
221 Ga0207655_1008174 3300025728 Bacteria 6681
222 Ga0207655_1009296 3300025728 Bacteria 6120
223 Ga0207655_1010611 3300025728 Bacteria 5570
224 Ga0207655_1014895 3300025728 Bacteria 4358
225 Ga0207655_1020507 3300025728 Bacteria 3394
226 Ga0207655_1021617 3300025728 Bacteria 3258
227 Ga0207655_1024802 3300025728 Bacteria 2929
228 Ga0207655_1028229 3300025728 Bacteria 2651
229 Ga0207655_1155576 3300025728 Bacteria 719
230 Ga0207713_1000030 3300025735 Bacteria 284027
231 Ga0207713_1000150 3300025735 Bacteria 105170
232 Ga0207713_1001217 3300025735 Bacteria 21481
233 Ga0207713_1002539 3300025735 Bacteria 13202
234 Ga0207713_1003187 3300025735 Bacteria 11340
235 Ga0207713_1009720 3300025735 Bacteria 5389
236 Ga0207713_1010908 3300025735 Bacteria 4989
237 Ga0207713_1015010 3300025735 Bacteria 3994
238 Ga0207713_1103409 3300025735 Bacteria 979
239 Ga0207713_1155567 3300025735 Bacteria 734
240 Ga0207671_10000287 3300025914 Bacteria 74587
241 Ga0207649_10000068 3300025920 Bacteria 91623
242 Ga0207681_10012718 3300025923 Bacteria 5198
243 Ga0207650_10000174 3300025925 Bacteria 75634
244 Ga0207650_10000405 3300025925 Bacteria 38683
245 Ga0207706_10027125 3300025933 Bacteria 5123
246 Ga0207686_10279286 3300025934 Bacteria 1232
247 Ga0207686_10662983 3300025934 Bacteria 826
248 Ga0207709_10000053 3300025935 Bacteria 225514
249 Ga0207709_10001997 3300025935 Bacteria 13245
250 Ga0207709_10259055 3300025935 Bacteria 1274
251 Ga0207679_10000018 3300025945 Bacteria 238375
252 Ga0207712_11179674 3300025961 Bacteria 683
253 Ga0207640_10436920 3300025981 Bacteria 1075
254 Ga0207639_10005291 3300026041 Bacteria 8709
255 Ga0209281_1000018 3300027111 Bacteria 579091
256 Ga0209281_1000174 3300027111 Bacteria 151659
257 Ga0209281_1007040 3300027111 Bacteria 2851
258 Ga0209973_1009174 3300027252 Bacteria 1145
259 Ga0209996_1001433 3300027395 Bacteria 2877
260 Ga0209984_1002443 3300027424 Bacteria 2076
261 Ga0209968_1011170 3300027526 Bacteria 1388
262 Ga0209999_1041556 3300027543 Bacteria 862
263 Ga0210002_1042986 3300027617 Bacteria 769
264 Ga0209983_1001930 3300027665 Bacteria 4596
265 Ga0209282_1020576 3300027666 Bacteria 4179
266 Ga0209971_1004024 3300027682 Bacteria 3474
267 Ga0207428_10016748 3300027907 Bacteria 6303
268 Ga0207428_10034107 3300027907 Bacteria 4174
269 Ga0207428_10049806 3300027907 Bacteria 3354
270 Ga0207428_10313871 3300027907 Bacteria 1159
271 Ga0307511_10122554 3300030521 Bacteria 1601
272 Ga0307511_10223593 3300030521 Bacteria 942
273 Ga0316177_1130413 3300030731 Bacteria 992
274 Ga0314311_1092402 3300030733 Bacteria 6451
275 Ga0316183_1023970 3300030742 Bacteria 3795
276 Ga0316181_1134508 3300030744 Bacteria 2112
277 Ga0316182_1273877 3300030745 Bacteria 1064
278 Ga0307408_100035752 3300031548 Bacteria 3488
279 Ga0307408_100770846 3300031548 Bacteria 870
280 Ga0307405_10002888 3300031731 Bacteria 7734
281 Ga0307405_10075341 3300031731 Bacteria 2185
282 Ga0307413_10034240 3300031824 Bacteria 2901
283 Ga0307413_10537800 3300031824 Bacteria 945
284 Ga0307410_11658515 3300031852 Bacteria 566
285 Ga0307406_10005725 3300031901 Bacteria 6804
286 Ga0307412_10015329 3300031911 Bacteria 4541
287 Ga0307409_100042016 3300031995 Bacteria 3420
288 Ga0307416_100553357 3300032002 Bacteria 1224
289 Ga0307414_10005562 3300032004 Bacteria 6951
290 Ga0307414_10317162 3300032004 Bacteria 1325
291 Ga0307414_10405551 3300032004 Bacteria 1185
292 Ga0307414_10667585 3300032004 Bacteria 938
293 Ga0307414_11948460 3300032004 Bacteria 548
294 Ga0307411_10026265 3300032005 Bacteria 3504
295 Ga0307411_10113942 3300032005 Bacteria 1941
296 Ga0307510_10042593 3300033180 Bacteria 4946
297 Ga0237819_01731 3300038705 Bacteria 5188
298 Ga0439436_0002308 3300041404 Bacteria 5724
299 Ga0439438_001957 3300041405 Bacteria 8998
300 Ga0439438_002727 3300041405 Bacteria 7416
301 Ga0439438_003107 3300041405 Bacteria 6829
302 Ga0439438_006132 3300041405 Bacteria 4293
303 Ga0439438_009657 3300041405 Bacteria 3108
304 Ga0439438_010066 3300041405 Bacteria 3019
305 Ga0439438_012149 3300041405 Bacteria 2652
306 Ga0439438_025751 3300041405 Bacteria 1599
307 Ga0439447_001168 3300041407 Bacteria 9567
308 Ga0439447_001200 3300041407 Bacteria 9444
309 Ga0439447_002577 3300041407 Bacteria 6586
310 Ga0439447_004106 3300041407 Bacteria 5072
311 Ga0439447_007315 3300041407 Bacteria 3517
312 Ga0439447_007389 3300041407 Bacteria 3494
313 Ga0439447_024940 3300041407 Bacteria 1544
314 Ga0439447_066057 3300041407 Bacteria 845
315 Ga0439453_0118321 3300041408 Bacteria 605
316 Ga0439466_0003521 3300041411 Bacteria 6058
317 Ga0439466_0003625 3300041411 Bacteria 5959
318 Ga0439466_0007541 3300041411 Bacteria 4115
319 Ga0439466_0012205 3300041411 Bacteria 3170
320 Ga0439466_0013506 3300041411 Bacteria 2988
321 Ga0439466_0014044 3300041411 Bacteria 2922
322 Ga0439466_0031227 3300041411 Bacteria 1823
323 Ga0439466_0046387 3300041411 Bacteria 1435
324 Ga0439466_0082304 3300041411 Bacteria 1014
325 Ga0439466_0158325 3300041411 Bacteria 693
326 Ga0439465_0016937 3300041413 Bacteria 2274
327 Ga0451841_1129590 3300041498 Bacteria 580
328 Ga0439431_0027336 3300041997 Bacteria 1401
329 Ga0439431_0031989 3300041997 Bacteria 1310
330 Ga0439437_001530 3300042000 Bacteria 2433
331 Ga0439432_000221 3300042006 Bacteria 20475
332 Ga0439432_002029 3300042006 Bacteria 7662
333 Ga0439432_002162 3300042006 Bacteria 7418
334 Ga0439432_004560 3300042006 Bacteria 5056
335 Ga0439432_008649 3300042006 Bacteria 3571
336 Ga0439432_021318 3300042006 Bacteria 2149
337 Ga0439432_042238 3300042006 Bacteria 1441
338 Ga0439432_212400 3300042006 Bacteria 559
339 Ga0439451_002269 3300042009 Bacteria 3873
340 Ga0439451_003957 3300042009 Bacteria 3011
341 Ga0439451_014900 3300042009 Bacteria 1568
342 Ga0439451_043076 3300042009 Bacteria 905
343 Ga0439451_052473 3300042009 Bacteria 816
344 Ga0439452_001336 3300042010 Bacteria 10293
345 Ga0439452_001645 3300042010 Bacteria 8822
346 Ga0439452_001829 3300042010 Bacteria 8255
347 Ga0439452_002038 3300042010 Bacteria 7698
348 Ga0439452_009381 3300042010 Bacteria 2884
349 Ga0439452_012733 3300042010 Bacteria 2380
350 Ga0439452_019054 3300042010 Bacteria 1819
351 Ga0439452_031519 3300042010 Bacteria 1300
352 Ga0439452_038804 3300042010 Bacteria 1129
353 Ga0439452_111834 3300042010 Bacteria 583
354 Ga0439455_0009878 3300042012 Bacteria 2083
355 Ga0439456_014477 3300042013 Bacteria 1645
356 Ga0439456_026414 3300042013 Bacteria 1235
357 Ga0439456_041021 3300042013 Bacteria 1003
358 Ga0439456_041604 3300042013 Bacteria 996
359 Ga0439456_067960 3300042013 Bacteria 788
360 Ga0439456_115794 3300042013 Bacteria 612
361 Ga0439463_000685 3300042016 Bacteria 9419
362 Ga0439463_002704 3300042016 Bacteria 4487
363 Ga0439463_042225 3300042016 Bacteria 1159
364 Ga0439463_194838 3300042016 Bacteria 526
365 Ga0450911_000001 3300042115 Bacteria 311012
366 Ga0450911_002493 3300042115 Bacteria 3595
367 Ga0450911_027641 3300042115 Bacteria 735
368 Ga0450917_001875 3300042120 Bacteria 1493
369 Ga0450919_027712 3300042121 Bacteria 645
370 Ga0450920_000665 3300042122 Bacteria 5487
371 Ga0450922_000171 3300042124 Bacteria 6681
372 Ga0450922_004241 3300042124 Bacteria 1318
373 Ga0450922_018578 3300042124 Bacteria 706
374 Ga0450923_042746 3300042125 Bacteria 957
375 Ga0450891_001832 3300042129 Bacteria 2185
376 Ga0450902_002811 3300042137 Bacteria 2493
377 Ga0450902_003679 3300042137 Bacteria 2253
378 Ga0450902_006763 3300042137 Bacteria 1761
379 Ga0450902_017166 3300042137 Bacteria 1181
380 Ga0450903_001475 3300042138 Bacteria 4382
381 Ga0450903_007378 3300042138 Bacteria 1811
382 Ga0450903_009656 3300042138 Bacteria 1570
383 Ga0450903_037582 3300042138 Bacteria 720
384 Ga0450904_000013 3300042139 Bacteria 41827
385 Ga0450904_001580 3300042139 Bacteria 3099
386 Ga0450905_001551 3300042142 Bacteria 2934
387 Ga0450905_012348 3300042142 Bacteria 1202
388 Ga0450906_001615 3300042145 Bacteria 4942
389 Ga0450906_003073 3300042145 Bacteria 3616
390 Ga0450907_000141 3300042146 Bacteria 27526
391 Ga0450907_015898 3300042146 Bacteria 1255
392 Ga0450907_046959 3300042146 Bacteria 742
393 Ga0450910_005462 3300042147 Bacteria 1734
394 Ga0450910_028114 3300042147 Bacteria 874
395 Ga0439446_0002949 3300042156 Bacteria 4160
396 Ga0439446_0020995 3300042156 Bacteria 1843
397 Ga0450908_002630 3300042184 Bacteria 3522
398 Ga0450908_015523 3300042184 Bacteria 1364
399 Ga0450909_013668 3300042185 Bacteria 1194
400 Ga0450909_017845 3300042185 Bacteria 1052
401 Ga0450909_065048 3300042185 Bacteria 579
402 Ga0439434_0009926 3300042435 Bacteria 2802
403 Ga0439459_0073899 3300042438 Bacteria 793
404 Ga0439464_0000553 3300042439 Bacteria 7773
405 Ga0439464_0001317 3300042439 Bacteria 5790
406 Ga0439464_0010620 3300042439 Bacteria 2431
407 Ga0439464_0067337 3300042439 Bacteria 1055
408 Ga0439460_0012892 3300042461 Bacteria 2177
409 Ga0450916_044058 3300042530 Bacteria 686
410 Ga0450893_0000927 3300042532 Bacteria 4398
411 Ga0450901_004466 3300042533 Bacteria 1449
412 Ga0450901_010845 3300042533 Bacteria 945
413 Ga0439440_0002059 3300042993 Bacteria 3751
414 Ga0495617_000345 3300046452 Bacteria 25597
415 Ga0495617_005322 3300046452 Bacteria 4579
416 Ga0495617_025647 3300046452 Bacteria 1986
417 Ga0495617_043372 3300046452 Bacteria 1501
418 Ga0495617_056964 3300046452 Bacteria 1295
419 Ga0495617_136067 3300046452 Bacteria 786
420 Ga0495617_144765 3300046452 Bacteria 757
421 Ga0495617_240028 3300046452 Bacteria 560
422 Ga0495627_000013 3300046453 Bacteria 332765
423 Ga0495627_000515 3300046453 Bacteria 32034
424 Ga0495627_002477 3300046453 Bacteria 8850
425 Ga0495627_011679 3300046453 Bacteria 3143
426 Ga0495627_016219 3300046453 Bacteria 2555
427 Ga0495627_016690 3300046453 Bacteria 2508
428 Ga0495627_019374 3300046453 Bacteria 2282
429 Ga0495627_022975 3300046453 Bacteria 2047
430 Ga0495627_129405 3300046453 Bacteria 710
431 Ga0495627_219590 3300046453 Bacteria 522
432 Ga0495603_0014388 3300046455 Bacteria 4785
433 Ga0495603_0043524 3300046455 Bacteria 2680
434 Ga0495603_0075049 3300046455 Bacteria 1985
435 Ga0495590_0000407 3300046457 Bacteria 21710
436 Ga0495590_0001249 3300046457 Bacteria 11083
437 Ga0495590_0021035 3300046457 Bacteria 2314
438 Ga0495590_0189453 3300046457 Bacteria 753
439 Ga0495590_0284124 3300046457 Bacteria 620
440 Ga0495591_000020 3300046458 Bacteria 217845
441 Ga0495591_001051 3300046458 Bacteria 18560
442 Ga0495591_001253 3300046458 Bacteria 16253
443 Ga0495591_001297 3300046458 Bacteria 15823
444 Ga0495591_002664 3300046458 Bacteria 9722
445 Ga0495591_002875 3300046458 Bacteria 9244
446 Ga0495591_008226 3300046458 Bacteria 4298
447 Ga0495591_010124 3300046458 Bacteria 3683
448 Ga0495591_011472 3300046458 Bacteria 3356
449 Ga0495591_017039 3300046458 Bacteria 2507
450 Ga0495591_017690 3300046458 Bacteria 2439
451 Ga0495591_067006 3300046458 Bacteria 940
452 Ga0495591_076017 3300046458 Bacteria 863
453 Ga0495638_0001706 3300046460 Bacteria 19330
454 Ga0495638_0016733 3300046460 Bacteria 4902
455 Ga0495638_0017330 3300046460 Bacteria 4805
456 Ga0495638_0017833 3300046460 Bacteria 4725
457 Ga0495638_0064240 3300046460 Bacteria 2261
458 Ga0495638_0076010 3300046460 Bacteria 2046
459 Ga0495638_0222308 3300046460 Bacteria 1055
460 Ga0495638_0295197 3300046460 Bacteria 875
461 Ga0495638_0655906 3300046460 Bacteria 509
462 Ga0495653_0001863 3300046463 Bacteria 16657
463 Ga0495653_0009503 3300046463 Bacteria 7956
464 Ga0495653_0011533 3300046463 Bacteria 7217
465 Ga0495653_0037547 3300046463 Bacteria 3804
466 Ga0495653_0104430 3300046463 Bacteria 2047
467 Ga0495650_0000221 3300046471 Bacteria 118284
468 Ga0495650_0005660 3300046471 Bacteria 8023
469 Ga0495650_0010351 3300046471 Bacteria 5211
470 Ga0495650_0011705 3300046471 Bacteria 4777
471 Ga0495650_0018333 3300046471 Bacteria 3480
472 Ga0495650_0023129 3300046471 Bacteria 2965
473 Ga0495650_0064442 3300046471 Bacteria 1457
474 Ga0495650_0131253 3300046471 Bacteria 913
475 Ga0495605_0000032 3300046474 Bacteria 210550
476 Ga0495605_0000047 3300046474 Bacteria 171270
477 Ga0495605_0000525 3300046474 Bacteria 32358
478 Ga0495605_0001124 3300046474 Bacteria 17808
479 Ga0495605_0002483 3300046474 Bacteria 11408
480 Ga0495605_0006439 3300046474 Bacteria 6748
481 Ga0495605_0008789 3300046474 Bacteria 5700
482 Ga0495605_0020475 3300046474 Bacteria 3514
483 Ga0495605_0033135 3300046474 Bacteria 2625
484 Ga0495605_0044971 3300046474 Bacteria 2179
485 Ga0495605_0047485 3300046474 Bacteria 2106
486 Ga0495605_0057111 3300046474 Bacteria 1880
487 Ga0495605_0077969 3300046474 Bacteria 1553
488 Ga0495605_0096412 3300046474 Bacteria 1364
489 Ga0495605_0105752 3300046474 Bacteria 1289
490 Ga0495605_0204128 3300046474 Bacteria 860
491 Ga0495605_0281135 3300046474 Bacteria 707
492 Ga0495605_0290274 3300046474 Bacteria 693
493 Ga0495605_0460213 3300046474 Bacteria 523
494 Ga0495605_0488815 3300046474 Bacteria 504
495 Ga0495605_0490933 3300046474 Bacteria 502
496 Ga0495584_0004829 3300046491 Bacteria 7199
497 Ga0495584_0004946 3300046491 Bacteria 7106
498 Ga0495584_0005292 3300046491 Bacteria 6836
499 Ga0495584_0007295 3300046491 Bacteria 5767
500 Ga0495584_0015934 3300046491 Bacteria 3835
501 Ga0495584_0023984 3300046491 Bacteria 3092
502 Ga0495584_0024705 3300046491 Bacteria 3046
503 Ga0495584_0047415 3300046491 Bacteria 2166
504 Ga0495584_0092177 3300046491 Bacteria 1528
505 Ga0495584_0170503 3300046491 Bacteria 1106
506 Ga0495584_0223314 3300046491 Bacteria 957
507 Ga0495585_0000816 3300046492 Bacteria 26990
508 Ga0495585_0007295 3300046492 Bacteria 6786
509 Ga0495585_0007718 3300046492 Bacteria 6558
510 Ga0495585_0024144 3300046492 Bacteria 3487
511 Ga0495585_0040411 3300046492 Bacteria 2618
512 Ga0495585_0043876 3300046492 Bacteria 2499
513 Ga0495585_0094257 3300046492 Bacteria 1609
514 Ga0495585_0143985 3300046492 Bacteria 1246
515 Ga0495594_0000964 3300046499 Bacteria 14958
516 Ga0495594_0085325 3300046499 Bacteria 1766
517 Ga0495594_0218208 3300046499 Bacteria 1087
518 Ga0495596_0018515 3300046500 Bacteria 2868
519 Ga0495596_0051855 3300046500 Bacteria 1606
520 Ga0495607_0000307 3300046501 Bacteria 51080
521 Ga0495607_0000888 3300046501 Bacteria 27904
522 Ga0495607_0001496 3300046501 Bacteria 20713
523 Ga0495607_0001899 3300046501 Bacteria 17718
524 Ga0495607_0002088 3300046501 Bacteria 16692
525 Ga0495607_0003469 3300046501 Bacteria 12075
526 Ga0495607_0011080 3300046501 Bacteria 6019
527 Ga0495607_0011595 3300046501 Bacteria 5861
528 Ga0495607_0026374 3300046501 Bacteria 3605
529 Ga0495607_0027857 3300046501 Bacteria 3488
530 Ga0495607_0034286 3300046501 Bacteria 3080
531 Ga0495607_0036468 3300046501 Bacteria 2962
532 Ga0495607_0042670 3300046501 Bacteria 2687
533 Ga0495607_0043682 3300046501 Bacteria 2648
534 Ga0495607_0049787 3300046501 Bacteria 2441
535 Ga0495607_0053686 3300046501 Bacteria 2326
536 Ga0495607_0055029 3300046501 Bacteria 2290
537 Ga0495607_0079730 3300046501 Bacteria 1802
538 Ga0495607_0119336 3300046501 Bacteria 1387
539 Ga0495607_0134561 3300046501 Bacteria 1281
540 Ga0495607_0160735 3300046501 Bacteria 1142
541 Ga0495607_0246787 3300046501 Bacteria 861
542 Ga0495607_0285744 3300046501 Bacteria 781
543 Ga0495607_0312860 3300046501 Bacteria 735
544 Ga0495607_0392143 3300046501 Bacteria 633
545 Ga0495583_0000052 3300046506 Bacteria 211902
546 Ga0495583_0001185 3300046506 Bacteria 28074
547 Ga0495583_0001288 3300046506 Bacteria 26166
548 Ga0495583_0003027 3300046506 Bacteria 13395
549 Ga0495583_0003309 3300046506 Bacteria 12486
550 Ga0495583_0006885 3300046506 Bacteria 7313
551 Ga0495583_0009851 3300046506 Bacteria 5656
552 Ga0495583_0012088 3300046506 Bacteria 4914
553 Ga0495583_0058584 3300046506 Bacteria 1728
554 Ga0495583_0128725 3300046506 Bacteria 1060
555 Ga0495606_0000669 3300046507 Bacteria 53621
556 Ga0495606_0000698 3300046507 Bacteria 52041
557 Ga0495606_0002877 3300046507 Bacteria 19029
558 Ga0495606_0004097 3300046507 Bacteria 14808
559 Ga0495606_0009421 3300046507 Bacteria 8266
560 Ga0495606_0025593 3300046507 Bacteria 4222
561 Ga0495606_0042510 3300046507 Bacteria 3038
562 Ga0495606_0051258 3300046507 Bacteria 2693
563 Ga0495606_0057228 3300046507 Bacteria 2511
564 Ga0495606_0078829 3300046507 Bacteria 2053
565 Ga0495606_0121457 3300046507 Bacteria 1563
566 Ga0495606_0140381 3300046507 Bacteria 1427
567 Ga0495606_0204340 3300046507 Bacteria 1123
568 Ga0495606_0239986 3300046507 Bacteria 1011
569 Ga0495610_0008157 3300046512 Bacteria 6837
570 Ga0495610_0009933 3300046512 Bacteria 5953
571 Ga0495610_0011085 3300046512 Bacteria 5536
572 Ga0495610_0016728 3300046512 Bacteria 4210
573 Ga0495610_0018130 3300046512 Bacteria 3984
574 Ga0495610_0019983 3300046512 Bacteria 3731
575 Ga0495610_0022969 3300046512 Bacteria 3398
576 Ga0495610_0039219 3300046512 Bacteria 2397
577 Ga0495610_0043634 3300046512 Bacteria 2233
578 Ga0495610_0071414 3300046512 Bacteria 1618
579 Ga0495616_0004718 3300046513 Bacteria 8542
580 Ga0495616_0014914 3300046513 Bacteria 4335
581 Ga0495616_0039394 3300046513 Bacteria 2420
582 Ga0495616_0045237 3300046513 Bacteria 2229
583 Ga0495616_0149604 3300046513 Bacteria 1057
584 Ga0495616_0207586 3300046513 Bacteria 858
585 Ga0495620_0000019 3300046515 Bacteria 150014
586 Ga0495620_0002079 3300046515 Bacteria 11642
587 Ga0495620_0003560 3300046515 Bacteria 8904
588 Ga0495620_0003930 3300046515 Bacteria 8466
589 Ga0495620_0004911 3300046515 Bacteria 7501
590 Ga0495620_0009877 3300046515 Bacteria 5054
591 Ga0495620_0034175 3300046515 Bacteria 2300
592 Ga0495620_0054930 3300046515 Bacteria 1680
593 Ga0495620_0155932 3300046515 Bacteria 888
594 Ga0495628_0853643 3300046516 Bacteria 634
595 Ga0495630_0103393 3300046517 Bacteria 2155
596 Ga0495630_0135343 3300046517 Bacteria 1872
597 Ga0495630_0301436 3300046517 Bacteria 1224
598 Ga0495631_0001595 3300046518 Bacteria 13584
599 Ga0495631_0003133 3300046518 Bacteria 9117
600 Ga0495631_0004610 3300046518 Bacteria 7297
601 Ga0495631_0012360 3300046518 Bacteria 4172
602 Ga0495631_0024408 3300046518 Bacteria 2791
603 Ga0495631_0030286 3300046518 Bacteria 2455
604 Ga0495631_0047306 3300046518 Bacteria 1889
605 Ga0495631_0175573 3300046518 Bacteria 918
606 Ga0495631_0277975 3300046518 Bacteria 713
607 Ga0495632_0000867 3300046519 Bacteria 26585
608 Ga0495632_0006130 3300046519 Bacteria 7791
609 Ga0495632_0006981 3300046519 Bacteria 7166
610 Ga0495632_0007851 3300046519 Bacteria 6638
611 Ga0495632_0010370 3300046519 Bacteria 5524
612 Ga0495632_0012404 3300046519 Bacteria 4918
613 Ga0495632_0021400 3300046519 Bacteria 3485
614 Ga0495632_0038866 3300046519 Bacteria 2406
615 Ga0495632_0054897 3300046519 Bacteria 1951
616 Ga0495632_0056635 3300046519 Bacteria 1916
617 Ga0495632_0059273 3300046519 Bacteria 1863
618 Ga0495632_0085924 3300046519 Bacteria 1496
619 Ga0495632_0237222 3300046519 Bacteria 821
620 Ga0495632_0471166 3300046519 Bacteria 543
621 Ga0495637_0000023 3300046520 Bacteria 172407
622 Ga0495637_0000546 3300046520 Bacteria 27049
623 Ga0495637_0005605 3300046520 Bacteria 6374
624 Ga0495637_0011553 3300046520 Bacteria 4241
625 Ga0495637_0013587 3300046520 Bacteria 3861
626 Ga0495637_0015066 3300046520 Bacteria 3634
627 Ga0495637_0015151 3300046520 Bacteria 3621
628 Ga0495637_0016164 3300046520 Bacteria 3490
629 Ga0495637_0029129 3300046520 Bacteria 2459
630 Ga0495637_0042635 3300046520 Bacteria 1940
631 Ga0495637_0044103 3300046520 Bacteria 1900
632 Ga0495637_0048706 3300046520 Bacteria 1783
633 Ga0495637_0066593 3300046520 Bacteria 1463
634 Ga0495637_0066869 3300046520 Bacteria 1460
635 Ga0495637_0070580 3300046520 Bacteria 1411
636 Ga0495637_0091323 3300046520 Bacteria 1200
637 Ga0495637_0101046 3300046520 Bacteria 1126
638 Ga0495637_0130973 3300046520 Bacteria 958
639 Ga0495637_0143858 3300046520 Bacteria 903
640 Ga0495643_0004890 3300046522 Bacteria 9221
641 Ga0495643_0014229 3300046522 Bacteria 4738
642 Ga0495643_0030455 3300046522 Bacteria 3012
643 Ga0495643_0074948 3300046522 Bacteria 1771
644 Ga0495643_0080477 3300046522 Bacteria 1695
645 Ga0495643_0106502 3300046522 Bacteria 1430
646 Ga0495643_0124477 3300046522 Bacteria 1299
647 Ga0495643_0156469 3300046522 Bacteria 1124
648 Ga0495643_0198434 3300046522 Bacteria 964
649 Ga0495643_0249213 3300046522 Bacteria 829
650 Ga0495643_0289421 3300046522 Bacteria 750
651 Ga0495643_0379628 3300046522 Bacteria 627
652 Ga0495644_0003325 3300046523 Bacteria 6356
653 Ga0495644_0067435 3300046523 Bacteria 1344
654 Ga0495644_0176274 3300046523 Bacteria 821
655 Ga0495644_0401425 3300046523 Bacteria 543
656 Ga0495648_0002803 3300046524 Bacteria 15688
657 Ga0495648_0003237 3300046524 Bacteria 14438
658 Ga0495648_0006229 3300046524 Bacteria 9762
659 Ga0495648_0008767 3300046524 Bacteria 7916
660 Ga0495648_0012794 3300046524 Bacteria 6231
661 Ga0495648_0027655 3300046524 Bacteria 3792
662 Ga0495648_0036639 3300046524 Bacteria 3160
663 Ga0495648_0051414 3300046524 Bacteria 2511
664 Ga0495648_0051615 3300046524 Bacteria 2505
665 Ga0495648_0062503 3300046524 Bacteria 2204
666 Ga0495648_0105954 3300046524 Bacteria 1540
667 Ga0495648_0122100 3300046524 Bacteria 1398
668 Ga0495648_0171523 3300046524 Bacteria 1111
669 Ga0495648_0193086 3300046524 Bacteria 1025
670 Ga0495666_0018221 3300046526 Bacteria 3497
671 Ga0495666_0532493 3300046526 Bacteria 524
672 Ga0495642_0001384 3300046528 Bacteria 10855
673 Ga0495642_0003792 3300046528 Bacteria 5919
674 Ga0495654_0000784 3300046530 Bacteria 24497
675 Ga0495654_0001351 3300046530 Bacteria 17056
676 Ga0495654_0001730 3300046530 Bacteria 14663
677 Ga0495654_0002404 3300046530 Bacteria 12075
678 Ga0495654_0007339 3300046530 Bacteria 6169
679 Ga0495654_0007972 3300046530 Bacteria 5881
680 Ga0495654_0011513 3300046530 Bacteria 4782
681 Ga0495654_0011693 3300046530 Bacteria 4742
682 Ga0495654_0013416 3300046530 Bacteria 4386
683 Ga0495654_0021368 3300046530 Bacteria 3367
684 Ga0495654_0028240 3300046530 Bacteria 2869
685 Ga0495654_0051346 3300046530 Bacteria 2012
686 Ga0495654_0069414 3300046530 Bacteria 1673
687 Ga0495654_0088238 3300046530 Bacteria 1442
688 Ga0495654_0160961 3300046530 Bacteria 985
689 Ga0495654_0436540 3300046530 Bacteria 516
690 Ga0495609_0000032 3300046538 Bacteria 211021
691 Ga0495609_0000382 3300046538 Bacteria 37599
692 Ga0495609_0000807 3300046538 Bacteria 23434
693 Ga0495609_0002842 3300046538 Bacteria 10359
694 Ga0495609_0010529 3300046538 Bacteria 4434
695 Ga0495609_0030820 3300046538 Bacteria 2441
696 Ga0495609_0032378 3300046538 Bacteria 2374
697 Ga0495609_0038569 3300046538 Bacteria 2153
698 Ga0495609_0039190 3300046538 Bacteria 2134
699 Ga0495609_0081320 3300046538 Bacteria 1416
700 Ga0495609_0089196 3300046538 Bacteria 1341
701 Ga0495609_0142674 3300046538 Bacteria 1021
702 Ga0495609_0463732 3300046538 Bacteria 502
703 Ga0495597_0000004 3300046542 Bacteria 307496
704 Ga0495597_0002903 3300046542 Bacteria 10426
705 Ga0495597_0004663 3300046542 Bacteria 7454
706 Ga0495597_0014599 3300046542 Bacteria 3737
707 Ga0495597_0015825 3300046542 Bacteria 3569
708 Ga0495597_0015984 3300046542 Bacteria 3548
709 Ga0495597_0016157 3300046542 Bacteria 3528
710 Ga0495597_0074979 3300046542 Bacteria 1452
711 Ga0495597_0085190 3300046542 Bacteria 1347
712 Ga0495597_0174376 3300046542 Bacteria 871
713 Ga0495597_0178997 3300046542 Bacteria 857
714 Ga0495597_0202312 3300046542 Bacteria 795
715 Ga0495645_0260605 3300046543 Bacteria 1148
716 Ga0495645_0677434 3300046543 Bacteria 628
717 Ga0495622_0003035 3300046557 Bacteria 7965
718 Ga0495622_0007144 3300046557 Bacteria 5189
719 Ga0495622_0014421 3300046557 Bacteria 3669
720 Ga0495622_0016658 3300046557 Bacteria 3423
721 Ga0495622_0042822 3300046557 Bacteria 2105
722 Ga0495622_0046066 3300046557 Bacteria 2026
723 Ga0495622_0053658 3300046557 Bacteria 1870
724 Ga0495633_0000040 3300046558 Bacteria 177876
725 Ga0495633_0009956 3300046558 Bacteria 5219
726 Ga0495633_0021631 3300046558 Bacteria 3214
727 Ga0495633_0109450 3300046558 Bacteria 1281
728 Ga0495633_0359058 3300046558 Bacteria 660
729 Ga0495668_0012999 3300046616 Bacteria 4926
730 Ga0495668_0045577 3300046616 Bacteria 2438
731 Ga0495668_0060256 3300046616 Bacteria 2094
732 Ga0495668_0061005 3300046616 Bacteria 2080
733 Ga0495668_0142717 3300046616 Bacteria 1310
734 Ga0495668_0549199 3300046616 Bacteria 637
735 Ga0495634_0005604 3300046642 Bacteria 9626
736 Ga0495611_0000589 3300046648 Bacteria 20938
737 Ga0495611_0004298 3300046648 Bacteria 6186
738 Ga0495611_0007814 3300046648 Bacteria 4540
739 Ga0495611_0261548 3300046648 Bacteria 801
740 Ga0495625_0000010 3300046660 Bacteria 381775
741 Ga0495625_0018258 3300046660 Bacteria 5481
742 Ga0495625_0038836 3300046660 Bacteria 3480
743 Ga0495625_0058557 3300046660 Bacteria 2737
744 Ga0495625_0058870 3300046660 Bacteria 2727
745 Ga0495625_0106245 3300046660 Bacteria 1922
746 Ga0495625_0214390 3300046660 Bacteria 1264
747 Ga0495635_0007473 3300046663 Bacteria 7627
748 Ga0495659_0015676 3300046664 Bacteria 2493
749 Ga0495661_0000020 3300046665 Bacteria 196901
750 Ga0495661_0000037 3300046665 Bacteria 164234
751 Ga0495661_0000095 3300046665 Bacteria 109100
752 Ga0495661_0000208 3300046665 Bacteria 67762
753 Ga0495661_0002196 3300046665 Bacteria 15222
754 Ga0495661_0003095 3300046665 Bacteria 12492
755 Ga0495661_0029738 3300046665 Bacteria 3484
756 Ga0495661_0039047 3300046665 Bacteria 2952
757 Ga0495661_0059224 3300046665 Bacteria 2280
758 Ga0495661_0063119 3300046665 Bacteria 2191
759 Ga0495661_0067592 3300046665 Bacteria 2099
760 Ga0495661_0119376 3300046665 Bacteria 1458
761 Ga0495661_0245484 3300046665 Bacteria 916
762 Ga0495588_0538143 3300046674 Bacteria 612
763 Ga0495623_0021747 3300046679 Bacteria 4143
764 Ga0495623_0063065 3300046679 Bacteria 2321
765 Ga0495646_0004545 3300046680 Bacteria 8739
766 Ga0495646_0269496 3300046680 Bacteria 907
767 Ga0495669_0004912 3300046684 Bacteria 5550
768 Ga0495613_0039865 3300046689 Bacteria 3480
769 Ga0495670_0002237 3300046691 Bacteria 9558
770 Ga0495670_0017224 3300046691 Bacteria 3555
771 Ga0495670_0031511 3300046691 Bacteria 2635
772 Ga0495670_0071587 3300046691 Bacteria 1755
773 Ga0495670_0085906 3300046691 Bacteria 1606
774 Ga0495670_0087525 3300046691 Bacteria 1591
775 Ga0495670_0296484 3300046691 Bacteria 866
776 Ga0495670_0584722 3300046691 Bacteria 608
777 Ga0495671_0002417 3300046692 Bacteria 11813
778 Ga0495671_0006661 3300046692 Bacteria 6656
779 Ga0495671_0007745 3300046692 Bacteria 6086
780 Ga0495671_0009549 3300046692 Bacteria 5415
781 Ga0495671_0012911 3300046692 Bacteria 4547
782 Ga0495671_0013658 3300046692 Bacteria 4389
783 Ga0495671_0015385 3300046692 Bacteria 4099
784 Ga0495671_0015940 3300046692 Bacteria 4022
785 Ga0495671_0023109 3300046692 Bacteria 3250
786 Ga0495671_0035567 3300046692 Bacteria 2528
787 Ga0495671_0037044 3300046692 Bacteria 2468
788 Ga0495671_0044765 3300046692 Bacteria 2217
789 Ga0495671_0047244 3300046692 Bacteria 2151
790 Ga0495671_0068470 3300046692 Bacteria 1745
791 Ga0495671_0174216 3300046692 Bacteria 1045
792 Ga0495671_0186794 3300046692 Bacteria 1006
793 Ga0495671_0202090 3300046692 Bacteria 963
794 Ga0495671_0342924 3300046692 Bacteria 717
795 Ga0495671_0609496 3300046692 Bacteria 519
796 Ga0495649_0000953 3300046694 Bacteria 22833
797 Ga0495649_0002103 3300046694 Bacteria 14280
798 Ga0495649_0002258 3300046694 Bacteria 13696
799 Ga0495649_0002986 3300046694 Bacteria 11622
800 Ga0495649_0009685 3300046694 Bacteria 5709
801 Ga0495649_0011065 3300046694 Bacteria 5313
802 Ga0495649_0041888 3300046694 Bacteria 2503
803 Ga0495649_0072621 3300046694 Bacteria 1844
804 Ga0495649_0104174 3300046694 Bacteria 1506
805 Ga0495649_0152929 3300046694 Bacteria 1211
806 Ga0495649_0257811 3300046694 Bacteria 894
807 Ga0495649_0280949 3300046694 Bacteria 850
808 Ga0495649_0294823 3300046694 Bacteria 826
809 Ga0495649_0322026 3300046694 Bacteria 784
810 Ga0495649_0420409 3300046694 Bacteria 669
811 Ga0495589_0000618 3300046794 Bacteria 23818
812 Ga0495589_0005488 3300046794 Bacteria 6689
813 Ga0495589_0011437 3300046794 Bacteria 4607
814 Ga0495589_0014865 3300046794 Bacteria 4004
815 Ga0495589_0027550 3300046794 Bacteria 2872
816 Ga0495589_0036200 3300046794 Bacteria 2474
817 Ga0495660_0000768 3300046810 Bacteria 24134
818 Ga0495660_0000771 3300046810 Bacteria 24010
819 Ga0495660_0001378 3300046810 Bacteria 16697
820 Ga0495660_0004723 3300046810 Bacteria 8222
821 Ga0495660_0014143 3300046810 Bacteria 4620
822 Ga0495660_0014871 3300046810 Bacteria 4500
823 Ga0495660_0015205 3300046810 Bacteria 4447
824 Ga0495660_0015618 3300046810 Bacteria 4387
825 Ga0495660_0016909 3300046810 Bacteria 4201
826 Ga0495660_0023372 3300046810 Bacteria 3525
827 Ga0495660_0025680 3300046810 Bacteria 3344
828 Ga0495660_0030921 3300046810 Bacteria 3013
829 Ga0495660_0048115 3300046810 Bacteria 2332
830 Ga0495660_0049343 3300046810 Bacteria 2298
831 Ga0495660_0055028 3300046810 Bacteria 2155
832 Ga0495660_0094356 3300046810 Bacteria 1549
833 Ga0495660_0360870 3300046810 Bacteria 644
834 Ga0495660_0450211 3300046810 Bacteria 556
835 Ga0495581_0016703 3300047315 Bacteria 4266
836 Ga0495604_0005474 3300047317 Bacteria 10069
837 Ga0495604_0332902 3300047317 Bacteria 1012
838 Ga0495636_0002017 3300047318 Bacteria 7781
839 Ga0495636_0076264 3300047318 Bacteria 1437
840 Ga0495636_0361412 3300047318 Bacteria 686
841 Ga0495674_0057529 3300047319 Bacteria 3403
842 Ga0495672_0001771 3300047320 Bacteria 20762
843 Ga0495672_0003431 3300047320 Bacteria 13579
844 Ga0495672_0005720 3300047320 Bacteria 9789
845 Ga0495672_0006315 3300047320 Bacteria 9214
846 Ga0495672_0012012 3300047320 Bacteria 6065
847 Ga0495672_0020829 3300047320 Bacteria 4288
848 Ga0495672_0023525 3300047320 Bacteria 3986
849 Ga0495672_0026101 3300047320 Bacteria 3731
850 Ga0495672_0030856 3300047320 Bacteria 3353
851 Ga0495672_0036156 3300047320 Bacteria 3035
852 Ga0495672_0048921 3300047320 Bacteria 2505
853 Ga0495672_0095014 3300047320 Bacteria 1628
854 Ga0495672_0102384 3300047320 Bacteria 1550
855 Ga0495672_0127767 3300047320 Bacteria 1341
856 Ga0495676_0000002 3300047321 Bacteria 373918
857 Ga0495676_0042527 3300047321 Bacteria 3728
858 Ga0495680_0033240 3300047322 Bacteria 4177
859 Ga0495680_0050082 3300047322 Bacteria 3267
860 Ga0495680_0076006 3300047322 Bacteria 2547
861 Ga0495683_0000011 3300047323 Bacteria 212053
862 Ga0495683_0000089 3300047323 Bacteria 92081
863 Ga0495683_0000519 3300047323 Bacteria 29556
864 Ga0495683_0006147 3300047323 Bacteria 6582
865 Ga0495683_0032444 3300047323 Bacteria 2660
866 Ga0495683_0046212 3300047323 Bacteria 2185
867 Ga0495683_0319425 3300047323 Bacteria 662
868 Ga0495683_0375692 3300047323 Bacteria 595
869 Ga0495687_001197 3300047443 Bacteria 24833
870 Ga0495687_008493 3300047443 Bacteria 5874
871 Ga0495687_132992 3300047443 Bacteria 877
872 Ga0495675_0187607 3300047444 Bacteria 1263
873 Ga0495677_0219662 3300047445 Bacteria 740
874 Ga0495679_000126 3300047446 Bacteria 68027
875 Ga0495679_000621 3300047446 Bacteria 23962
876 Ga0495679_001367 3300047446 Bacteria 14010
877 Ga0495679_009776 3300047446 Bacteria 3812
878 Ga0495679_010978 3300047446 Bacteria 3523
879 Ga0495679_017869 3300047446 Bacteria 2529
880 Ga0495679_074556 3300047446 Bacteria 971
881 Ga0495673_0000563 3300047469 Bacteria 37758
882 Ga0495673_0001975 3300047469 Bacteria 15152
883 Ga0495673_0002348 3300047469 Bacteria 13445
884 Ga0495673_0002520 3300047469 Bacteria 12793
885 Ga0495673_0003010 3300047469 Bacteria 11347
886 Ga0495673_0003566 3300047469 Bacteria 10226
887 Ga0495673_0006797 3300047469 Bacteria 6680
888 Ga0495673_0007690 3300047469 Bacteria 6157
889 Ga0495673_0007822 3300047469 Bacteria 6085
890 Ga0495673_0012794 3300047469 Bacteria 4430
891 Ga0495673_0013648 3300047469 Bacteria 4254
892 Ga0495673_0016425 3300047469 Bacteria 3784
893 Ga0495673_0021703 3300047469 Bacteria 3164
894 Ga0495673_0035945 3300047469 Bacteria 2277
895 Ga0495673_0037347 3300047469 Bacteria 2218
896 Ga0495673_0083411 3300047469 Bacteria 1319
897 Ga0495673_0085618 3300047469 Bacteria 1297
898 Ga0495681_0000621 3300047470 Bacteria 26997
899 Ga0495681_0002330 3300047470 Bacteria 13648
900 Ga0495681_0006679 3300047470 Bacteria 7532
901 Ga0495681_0007930 3300047470 Bacteria 6707
902 Ga0495681_0010809 3300047470 Bacteria 5497
903 Ga0495681_0013817 3300047470 Bacteria 4667
904 Ga0495681_0024793 3300047470 Bacteria 3148
905 Ga0495681_0025808 3300047470 Bacteria 3070
906 Ga0495681_0026289 3300047470 Bacteria 3033
907 Ga0495681_0040419 3300047470 Bacteria 2270
908 Ga0495681_0060219 3300047470 Bacteria 1752
909 Ga0495681_0140931 3300047470 Bacteria 1018
910 Ga0495684_0057665 3300047471 Bacteria 2959
911 Ga0495686_0009309 3300047472 Bacteria 7087
912 Ga0495686_0011662 3300047472 Bacteria 6187
913 Ga0495686_0019342 3300047472 Bacteria 4550
914 Ga0495686_0028247 3300047472 Bacteria 3653
915 Ga0495686_0058119 3300047472 Bacteria 2411
916 Ga0495593_0015578 3300047673 Bacteria 4302
917 Ga0495602_0058351 3300048088 Bacteria 3378
918 Ga0495626_0000007 3300048091 Bacteria 276374
919 Ga0495626_0000781 3300048091 Bacteria 28964
920 Ga0495626_0001420 3300048091 Bacteria 19099
921 Ga0495626_0008419 3300048091 Bacteria 5656
922 Ga0495626_0014922 3300048091 Bacteria 3988
923 Ga0495626_0029367 3300048091 Bacteria 2661
924 Ga0495626_0038983 3300048091 Bacteria 2249
925 Ga0495626_0070542 3300048091 Bacteria 1571
926 Ga0495626_0080914 3300048091 Bacteria 1443
927 Ga0495626_0146617 3300048091 Bacteria 997
928 Ga0496102_0006862 3300048905 Bacteria 9717
929 Ga0496103_0003992 3300048906 Bacteria 8965
930 Ga0496110_0854144 3300048913 Bacteria 815
931 Ga0496110_1223307 3300048913 Bacteria 660
932 Ga0496111_0180419 3300048914 Bacteria 1569
933 Ga0496111_0800673 3300048914 Bacteria 682
934 Ga0496112_0261879 3300048915 Bacteria 1678
935 Ga0496112_0336917 3300048915 Bacteria 1452
936 Ga0496112_1564363 3300048915 Bacteria 573
937 Ga0496115_1448611 3300048918 Bacteria 505
938 Ga0496116_0000085 3300048919 Bacteria 219553
939 Ga0496116_0015452 3300048919 Bacteria 6034
940 Ga0496116_0026674 3300048919 Bacteria 4217
941 Ga0496116_0044766 3300048919 Bacteria 3003
942 Ga0496116_0136720 3300048919 Bacteria 1386
943 Ga0496116_0204606 3300048919 Bacteria 1029
944 Ga0496117_0001083 3300048920 Bacteria 41245
945 Ga0496117_0008157 3300048920 Bacteria 10003
946 Ga0496117_0023516 3300048920 Bacteria 4905
947 Ga0496117_0037465 3300048920 Bacteria 3612
948 Ga0496117_0042455 3300048920 Bacteria 3318
949 Ga0496117_0063805 3300048920 Bacteria 2516
950 Ga0496117_0209027 3300048920 Bacteria 1096
951 Ga0496117_0255767 3300048920 Bacteria 952
952 Ga0496118_0010079 3300048921 Bacteria 9402
953 Ga0496118_0013576 3300048921 Bacteria 7688
954 Ga0496118_0017227 3300048921 Bacteria 6586
955 Ga0496118_0034320 3300048921 Bacteria 4142
956 Ga0496118_0064986 3300048921 Bacteria 2673
957 Ga0496118_0077732 3300048921 Bacteria 2352
958 Ga0496119_0023660 3300048922 Bacteria 4346
959 Ga0496119_0128944 3300048922 Bacteria 1380
960 Ga0496119_0162752 3300048922 Bacteria 1184
961 Ga0496120_0007999 3300048923 Bacteria 7780
962 Ga0496120_0014080 3300048923 Bacteria 5343
963 Ga0496120_0023314 3300048923 Bacteria 3875
964 Ga0496121_0000505 3300048924 Bacteria 74599
965 Ga0496121_0006247 3300048924 Bacteria 14916
966 Ga0496121_0010756 3300048924 Bacteria 10257
967 Ga0496121_0023128 3300048924 Bacteria 5999
968 Ga0496121_0106897 3300048924 Bacteria 2144
969 Ga0496121_0272838 3300048924 Bacteria 1161
970 Ga0496121_0486139 3300048924 Bacteria 787
971 Ga0496122_0001761 3300048925 Bacteria 33221
972 Ga0496122_0016161 3300048925 Bacteria 7088
973 Ga0496122_0034212 3300048925 Bacteria 4162
974 Ga0496122_0048132 3300048925 Bacteria 3283
975 Ga0496122_0085139 3300048925 Bacteria 2182
976 Ga0496123_0000087 3300048926 Bacteria 182994
977 Ga0496123_0006202 3300048926 Bacteria 11667
978 Ga0496123_0023965 3300048926 Bacteria 4656
979 Ga0496123_0029384 3300048926 Bacteria 4047
980 Ga0496123_0029506 3300048926 Bacteria 4035
981 Ga0496124_0000807 3300048927 Bacteria 50885
982 Ga0496124_0010005 3300048927 Bacteria 9683
983 Ga0496124_0019173 3300048927 Bacteria 6381
984 Ga0496124_0033056 3300048927 Bacteria 4555
985 Ga0496124_0079625 3300048927 Bacteria 2697
986 Ga0496124_0083036 3300048927 Bacteria 2629
987 Ga0496124_0105664 3300048927 Bacteria 2274
988 Ga0496124_0154721 3300048927 Bacteria 1794
989 Ga0496124_0231892 3300048927 Bacteria 1379
990 Ga0496124_0233131 3300048927 Bacteria 1375
991 Ga0496125_0009460 3300048928 Bacteria 10007
992 Ga0496125_0037515 3300048928 Bacteria 4211
993 Ga0496125_0045252 3300048928 Bacteria 3707
994 Ga0496125_0048393 3300048928 Bacteria 3546
995 Ga0496125_0053638 3300048928 Bacteria 3303
996 Ga0496126_0065462 3300048929 Bacteria 3252
997 Ga0495678_000033 3300049459 Bacteria 211804
998 Ga0495678_000787 3300049459 Bacteria 28437
999 Ga0495678_003644 3300049459 Bacteria 9359
1000 Ga0495678_005114 3300049459 Bacteria 7363
1001 Ga0495678_007928 3300049459 Bacteria 5443
1002 Ga0495678_007950 3300049459 Bacteria 5432
1003 Ga0495678_008634 3300049459 Bacteria 5123
1004 Ga0495678_011151 3300049459 Bacteria 4320
1005 Ga0495678_021969 3300049459 Bacteria 2798
1006 Ga0495678_025493 3300049459 Bacteria 2537
1007 Ga0495678_026553 3300049459 Bacteria 2469
1008 Ga0495678_040255 3300049459 Bacteria 1879
1009 Ga0495678_053273 3300049459 Bacteria 1554
1010 Ga0495678_135496 3300049459 Bacteria 811
1011 Ga0495678_225402 3300049459 Bacteria 567
1012 Ga0495682_0000213 3300049460 Bacteria 46502
1013 Ga0495682_0001185 3300049460 Bacteria 14849
1014 Ga0495682_0001329 3300049460 Bacteria 13707
1015 Ga0495682_0013257 3300049460 Bacteria 3141
1016 Ga0495682_0250408 3300049460 Bacteria 626
1017 Ga0495682_0369401 3300049460 Bacteria 505
1018 Ga0501032_0008112 3300049569 Bacteria 7657
1019 Ga0501032_0549392 3300049569 Bacteria 736
1020 Ga0501033_0169268 3300049570 Bacteria 1570
1021 Ga0501034_0063993 3300049571 Bacteria 3692
1022 Ga0501034_0393148 3300049571 Bacteria 1310
1023 Ga0501039_0887325 3300049575 Bacteria 694
1024 Ga0501035_0330596 3300049822 Bacteria 1279
1025 Ga0501226_000014 3300049853 Bacteria 166091
1026 nmdc:mga00v17_36416_c1 3300050491 Bacteria 2932
1027 nmdc:mga00v17_528181_c1 3300050491 Bacteria 764
1028 nmdc:mga08x19_186197_c1 3300050514 Bacteria 1419
1029 nmdc:mga08x19_26948_c1 3300050514 Bacteria 3591
1030 Ga0500572_008391 3300053111 Bacteria 2413
1031 Ga0500618_003789 3300053125 Bacteria 5052
1032 Ga0500618_125766 3300053125 Bacteria 581
1033 Ga0500573_0039775 3300053140 Bacteria 2716
1034 Ga0500577_0107555 3300053142 Bacteria 1147
1035 Ga0500586_028477 3300053145 Bacteria 1825
1036 Ga0500634_0001481 3300053161 Bacteria 9165

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046557 Ga0495622_0042822 Ga0495622_0042822_487_801 90
2 3300049569 Ga0501032_0549392 Ga0501032_0549392_337_651 98
3 3300049570 Ga0501033_0169268 Ga0501033_0169268_108_422 98
4 3300049822 Ga0501035_0330596 Ga0501035_0330596_699_1013 98
5 iso_pu_bacteria 8056125926 8056130207 98
6 3300027907 Ga0207428_10034107 Ga0207428_100341071 99
7 3300050514 nmdc:mga08x19_186197_c1 nmdc:mga08x19_186197_c1_862_1224 99
8 iso_pu_bacteria 2808606379 2808939202 99
9 iso_pu_bacteria 2842805378 2842809562 99
10 iso_pu_bacteria 640427133 640488501 99
11 iso_pu_bacteria 651053060 651176538 99
12 iso_pu_bacteria 2728369097 2729148331 100
13 iso_pu_bacteria 2811994881 2812365905 100
14 iso_pu_bacteria 2923519811 2923519926 100
15 3300006058 Ga0075432_10419162 Ga0075432_104191621 101
16 3300031824 Ga0307413_10034240 Ga0307413_100342404 101
17 3300032004 Ga0307414_10317162 Ga0307414_103171622 101
18 3300041404 Ga0439436_0002308 Ga0439436_0002308_3559_3897 101
19 3300041405 Ga0439438_001957 Ga0439438_001957_3559_3897 101
20 3300041407 Ga0439447_001168 Ga0439447_001168_47_385 101
21 3300041411 Ga0439466_0003521 Ga0439466_0003521_996_1334 101
22 3300041411 Ga0439466_0013506 Ga0439466_0013506_175_513 101
23 3300041997 Ga0439431_0027336 Ga0439431_0027336_516_854 101
24 3300042006 Ga0439432_002029 Ga0439432_002029_6793_7131 101
25 3300042006 Ga0439432_042238 Ga0439432_042238_211_549 101
26 3300042010 Ga0439452_001645 Ga0439452_001645_3574_3912 101
27 3300042185 Ga0450909_013668 Ga0450909_013668_346_684 101
28 3300042435 Ga0439434_0009926 Ga0439434_0009926_858_1196 101
29 3300046501 Ga0495607_0036468 Ga0495607_0036468_2562_2870 101
30 3300046692 Ga0495671_0012911 Ga0495671_0012911_55_363 101
31 iso_pu_bacteria 8011350971 8011354398 101
32 iso_pu_bacteria 8052494512 8052498459 101
33 3300027252 Ga0209973_1009174 Ga0209973_10091743 102
34 3300027395 Ga0209996_1001433 Ga0209996_10014332 102
35 3300027424 Ga0209984_1002443 Ga0209984_10024433 102
36 3300027526 Ga0209968_1011170 Ga0209968_10111702 102
37 3300027617 Ga0210002_1042986 Ga0210002_10429862 102
38 3300027665 Ga0209983_1001930 Ga0209983_10019307 102
39 3300027682 Ga0209971_1004024 Ga0209971_10040244 102
40 3300032002 Ga0307416_100553357 Ga0307416_1005533572 102
41 3300032004 Ga0307414_10405551 Ga0307414_104055512 102
42 3300042185 Ga0450909_065048 Ga0450909_065048_222_548 102
43 3300046455 Ga0495603_0014388 Ga0495603_0014388_1596_1931 102
44 3300046492 Ga0495585_0007718 Ga0495585_0007718_5984_6316 102
45 3300046501 Ga0495607_0003469 Ga0495607_0003469_6304_6639 102
46 3300046520 Ga0495637_0066869 Ga0495637_0066869_455_781 102
47 3300046520 Ga0495637_0091323 Ga0495637_0091323_594_929 102
48 3300046665 Ga0495661_0000095 Ga0495661_0000095_69451_69783 102
49 3300046692 Ga0495671_0186794 Ga0495671_0186794_55_381 102
50 3300046694 Ga0495649_0002258 Ga0495649_0002258_1688_2023 102
51 3300047323 Ga0495683_0000089 Ga0495683_0000089_16692_17027 102
52 3300053125 Ga0500618_003789 Ga0500618_003789_3675_3992 102
53 iso_pu_bacteria 2599185155 2599330481 102
54 iso_pu_bacteria 2738541271 2738691748 102
55 iso_pu_bacteria 2738543016 2739267522 102
56 iso_pu_bacteria 2808606373 2808904055 102
57 iso_pu_bacteria 2826581358 2826585241 102
58 iso_pu_bacteria 2842815866 2842818848 102
59 iso_pu_bacteria 2842849001 2842853558 102
60 iso_pu_bacteria 2990196909 2990198887 102
61 3300003781 Ga0055536_1000165 Ga0055536_100016548 103
62 3300003791 Ga0055530_10001115 Ga0055530_1000111518 103
63 3300003792 Ga0055540_1001167 Ga0055540_10011674 103
64 3300013104 Ga0157370_10006411 Ga0157370_100064114 103
65 3300013104 Ga0157370_10253639 Ga0157370_102536392 103
66 3300025284 Ga0209130_1022427 Ga0209130_10224273 103
67 3300025292 Ga0209676_1000021 Ga0209676_1000021215 103
68 3300025298 Ga0209050_1000595 Ga0209050_100059549 103
69 3300025303 Ga0209051_1000407 Ga0209051_100040712 103
70 3300025304 Ga0209257_1031961 Ga0209257_10319612 103
71 3300046507 Ga0495606_0000669 Ga0495606_0000669_40355_40687 103
72 3300046522 Ga0495643_0004890 Ga0495643_0004890_2857_3189 103
73 3300046692 Ga0495671_0342924 Ga0495671_0342924_319_651 103
74 3300046694 Ga0495649_0002986 Ga0495649_0002986_9590_9922 103
75 3300046694 Ga0495649_0041888 Ga0495649_0041888_577_909 103
76 3300049459 Ga0495678_011151 Ga0495678_011151_742_1074 103
77 3300049571 Ga0501034_0063993 Ga0501034_0063993_42_371 103
78 iso_pu_bacteria 2600254954 2600446761 103
79 iso_pu_bacteria 2600255283 2601625172 103
80 iso_pu_bacteria 2600255389 2602010701 103
81 iso_pu_bacteria 2823421272 2823423263 103
82 iso_pu_bacteria 2842854478 2842854557 103
83 iso_pu_bacteria 2919501602 2919505382 103
84 iso_pu_bacteria 2926063275 2926067059 103
85 iso_pu_bacteria 8034962539 8034963820 103
86 iso_pu_bacteria 8056143049 8056147357 103
87 3300006186 Ga0075369_10578558 Ga0075369_105785581 104
88 3300009011 Ga0105251_10000093 Ga0105251_100000931 104
89 3300009092 Ga0105250_10000074 Ga0105250_1000007420 104
90 3300013102 Ga0157371_10000546 Ga0157371_1000054615 104
91 3300025711 Ga0207696_1000045 Ga0207696_1000045301 104
92 3300025735 Ga0207713_1000030 Ga0207713_1000030288 104
93 3300027907 Ga0207428_10016748 Ga0207428_100167483 104
94 3300042156 Ga0439446_0002949 Ga0439446_0002949_3328_3660 104
95 3300046452 Ga0495617_240028 Ga0495617_240028_73_390 104
96 3300046453 Ga0495627_000515 Ga0495627_000515_17517_17834 104
97 3300046471 Ga0495650_0005660 Ga0495650_0005660_4246_4563 104
98 3300046471 Ga0495650_0018333 Ga0495650_0018333_1410_1727 104
99 3300046506 Ga0495583_0001185 Ga0495583_0001185_22582_22899 104
100 3300046512 Ga0495610_0022969 Ga0495610_0022969_1897_2214 104
101 3300046518 Ga0495631_0003133 Ga0495631_0003133_3499_3816 104
102 3300046519 Ga0495632_0010370 Ga0495632_0010370_228_545 104
103 3300046519 Ga0495632_0012404 Ga0495632_0012404_1035_1352 104
104 3300046530 Ga0495654_0001351 Ga0495654_0001351_10556_10873 104
105 3300046543 Ga0495645_0677434 Ga0495645_0677434_216_533 104
106 3300046665 Ga0495661_0000208 Ga0495661_0000208_57270_57587 104
107 3300046692 Ga0495671_0007745 Ga0495671_0007745_1815_2132 104
108 3300046692 Ga0495671_0609496 Ga0495671_0609496_10_327 104
109 3300046810 Ga0495660_0055028 Ga0495660_0055028_455_772 104
110 3300047320 Ga0495672_0003431 Ga0495672_0003431_4881_5198 104
111 3300047469 Ga0495673_0083411 Ga0495673_0083411_762_1079 104
112 3300049460 Ga0495682_0000213 Ga0495682_0000213_20339_20656 104
113 iso_pu_bacteria 3007315729 3007318959 104
114 3300005288 Ga0065714_10080800 Ga0065714_100808003 105
115 3300005290 Ga0065712_10068150 Ga0065712_100681502 105
116 3300009011 Ga0105251_10045755 Ga0105251_100457552 105
117 3300009036 Ga0105244_10000425 Ga0105244_100004258 105
118 3300009036 Ga0105244_10022723 Ga0105244_100227231 105
119 3300014497 Ga0182008_10005526 Ga0182008_100055265 105
120 3300015265 Ga0182005_1006110 Ga0182005_10061102 105
121 3300017792 Ga0163161_10821983 Ga0163161_108219831 105
122 3300025728 Ga0207655_1009296 Ga0207655_10092964 105
123 3300025735 Ga0207713_1103409 Ga0207713_11034092 105
124 3300041408 Ga0439453_0118321 Ga0439453_0118321_113_457 105
125 3300041411 Ga0439466_0031227 Ga0439466_0031227_939_1262 105
126 3300041997 Ga0439431_0031989 Ga0439431_0031989_339_683 105
127 3300042000 Ga0439437_001530 Ga0439437_001530_2052_2396 105
128 3300042006 Ga0439432_002162 Ga0439432_002162_5658_5996 105
129 3300042012 Ga0439455_0009878 Ga0439455_0009878_284_628 105
130 3300042013 Ga0439456_041604 Ga0439456_041604_600_944 105
131 3300042016 Ga0439463_000685 Ga0439463_000685_4187_4504 105
132 3300042115 Ga0450911_000001 Ga0450911_000001_216021_216365 105
133 3300042120 Ga0450917_001875 Ga0450917_001875_892_1236 105
134 3300042138 Ga0450903_007378 Ga0450903_007378_549_893 105
135 3300042139 Ga0450904_000013 Ga0450904_000013_33744_34088 105
136 3300042142 Ga0450905_001551 Ga0450905_001551_865_1203 105
137 3300042156 Ga0439446_0020995 Ga0439446_0020995_1151_1495 105
138 3300042438 Ga0439459_0073899 Ga0439459_0073899_138_482 105
139 3300042439 Ga0439464_0000553 Ga0439464_0000553_5146_5487 105
140 3300042530 Ga0450916_044058 Ga0450916_044058_16_360 105
141 3300042532 Ga0450893_0000927 Ga0450893_0000927_3464_3808 105
142 3300042533 Ga0450901_010845 Ga0450901_010845_149_493 105
143 3300046452 Ga0495617_136067 Ga0495617_136067_125_445 105
144 3300046453 Ga0495627_000013 Ga0495627_000013_221938_222261 105
145 3300046453 Ga0495627_016690 Ga0495627_016690_590_913 105
146 3300046453 Ga0495627_022975 Ga0495627_022975_393_713 105
147 3300046458 Ga0495591_000020 Ga0495591_000020_150531_150854 105
148 3300046458 Ga0495591_001051 Ga0495591_001051_7255_7575 105
149 3300046458 Ga0495591_001253 Ga0495591_001253_5495_5812 105
150 3300046460 Ga0495638_0076010 Ga0495638_0076010_329_649 105
151 3300046463 Ga0495653_0001863 Ga0495653_0001863_5233_5616 105
152 3300046471 Ga0495650_0023129 Ga0495650_0023129_1896_2219 105
153 3300046474 Ga0495605_0000032 Ga0495605_0000032_140468_140791 105
154 3300046474 Ga0495605_0000047 Ga0495605_0000047_85090_85410 105
155 3300046474 Ga0495605_0000525 Ga0495605_0000525_22169_22486 105
156 3300046474 Ga0495605_0002483 Ga0495605_0002483_10936_11259 105
157 3300046474 Ga0495605_0008789 Ga0495605_0008789_427_747 105
158 3300046474 Ga0495605_0044971 Ga0495605_0044971_1826_2149 105
159 3300046474 Ga0495605_0105752 Ga0495605_0105752_842_1165 105
160 3300046474 Ga0495605_0460213 Ga0495605_0460213_119_439 105
161 3300046474 Ga0495605_0490933 Ga0495605_0490933_21_341 105
162 3300046499 Ga0495594_0000964 Ga0495594_0000964_5255_5578 105
163 3300046501 Ga0495607_0000307 Ga0495607_0000307_43714_44037 105
164 3300046501 Ga0495607_0001899 Ga0495607_0001899_7523_7840 105
165 3300046501 Ga0495607_0002088 Ga0495607_0002088_11765_12088 105
166 3300046501 Ga0495607_0011080 Ga0495607_0011080_372_692 105
167 3300046501 Ga0495607_0027857 Ga0495607_0027857_823_1143 105
168 3300046501 Ga0495607_0079730 Ga0495607_0079730_1007_1327 105
169 3300046501 Ga0495607_0119336 Ga0495607_0119336_564_887 105
170 3300046501 Ga0495607_0160735 Ga0495607_0160735_639_959 105
171 3300046501 Ga0495607_0285744 Ga0495607_0285744_121_441 105
172 3300046501 Ga0495607_0392143 Ga0495607_0392143_287_610 105
173 3300046506 Ga0495583_0000052 Ga0495583_0000052_141828_142151 105
174 3300046506 Ga0495583_0009851 Ga0495583_0009851_3885_4205 105
175 3300046506 Ga0495583_0012088 Ga0495583_0012088_3454_3771 105
176 3300046507 Ga0495606_0000698 Ga0495606_0000698_40494_40877 105
177 3300046507 Ga0495606_0002877 Ga0495606_0002877_10466_10783 105
178 3300046507 Ga0495606_0042510 Ga0495606_0042510_1307_1627 105
179 3300046507 Ga0495606_0121457 Ga0495606_0121457_60_380 105
180 3300046507 Ga0495606_0239986 Ga0495606_0239986_126_449 105
181 3300046512 Ga0495610_0018130 Ga0495610_0018130_1992_2315 105
182 3300046513 Ga0495616_0149604 Ga0495616_0149604_496_879 105
183 3300046515 Ga0495620_0000019 Ga0495620_0000019_141154_141477 105
184 3300046515 Ga0495620_0003560 Ga0495620_0003560_1408_1725 105
185 3300046515 Ga0495620_0054930 Ga0495620_0054930_570_887 105
186 3300046518 Ga0495631_0012360 Ga0495631_0012360_3569_3892 105
187 3300046520 Ga0495637_0000023 Ga0495637_0000023_2953_3273 105
188 3300046520 Ga0495637_0048706 Ga0495637_0048706_738_1061 105
189 3300046520 Ga0495637_0070580 Ga0495637_0070580_751_1134 105
190 3300046520 Ga0495637_0130973 Ga0495637_0130973_544_867 105
191 3300046524 Ga0495648_0012794 Ga0495648_0012794_5802_6125 105
192 3300046530 Ga0495654_0001730 Ga0495654_0001730_1522_1845 105
193 3300046538 Ga0495609_0000032 Ga0495609_0000032_69734_70057 105
194 3300046538 Ga0495609_0000807 Ga0495609_0000807_12892_13212 105
195 3300046538 Ga0495609_0010529 Ga0495609_0010529_1438_1758 105
196 3300046542 Ga0495597_0000004 Ga0495597_0000004_217378_217701 105
197 3300046542 Ga0495597_0002903 Ga0495597_0002903_6758_7081 105
198 3300046543 Ga0495645_0260605 Ga0495645_0260605_449_769 105
199 3300046557 Ga0495622_0014421 Ga0495622_0014421_2980_3300 105
200 3300046558 Ga0495633_0000040 Ga0495633_0000040_36067_36390 105
201 3300046616 Ga0495668_0060256 Ga0495668_0060256_224_547 105
202 3300046616 Ga0495668_0061005 Ga0495668_0061005_1464_1781 105
203 3300046648 Ga0495611_0007814 Ga0495611_0007814_1294_1617 105
204 3300046660 Ga0495625_0214390 Ga0495625_0214390_342_665 105
205 3300046665 Ga0495661_0000037 Ga0495661_0000037_139890_140213 105
206 3300046665 Ga0495661_0119376 Ga0495661_0119376_891_1208 105
207 3300046674 Ga0495588_0538143 Ga0495588_0538143_174_497 105
208 3300046691 Ga0495670_0085906 Ga0495670_0085906_639_959 105
209 3300046691 Ga0495670_0087525 Ga0495670_0087525_1008_1331 105
210 3300046692 Ga0495671_0013658 Ga0495671_0013658_3654_3977 105
211 3300046794 Ga0495589_0000618 Ga0495589_0000618_22218_22541 105
212 3300046810 Ga0495660_0000768 Ga0495660_0000768_6323_6646 105
213 3300046810 Ga0495660_0000771 Ga0495660_0000771_245_568 105
214 3300046810 Ga0495660_0001378 Ga0495660_0001378_7024_7347 105
215 3300047320 Ga0495672_0005720 Ga0495672_0005720_5663_5986 105
216 3300047320 Ga0495672_0036156 Ga0495672_0036156_177_500 105
217 3300047321 Ga0495676_0000002 Ga0495676_0000002_107167_107487 105
218 3300047323 Ga0495683_0000011 Ga0495683_0000011_141993_142316 105
219 3300047446 Ga0495679_001367 Ga0495679_001367_12680_13003 105
220 3300047469 Ga0495673_0000563 Ga0495673_0000563_15381_15701 105
221 3300047469 Ga0495673_0003010 Ga0495673_0003010_1948_2271 105
222 3300047469 Ga0495673_0012794 Ga0495673_0012794_3543_3860 105
223 3300047469 Ga0495673_0085618 Ga0495673_0085618_392_709 105
224 3300047470 Ga0495681_0026289 Ga0495681_0026289_844_1167 105
225 3300047472 Ga0495686_0009309 Ga0495686_0009309_3477_3797 105
226 3300048913 Ga0496110_1223307 Ga0496110_1223307_206_523 105
227 3300048914 Ga0496111_0800673 Ga0496111_0800673_248_565 105
228 3300048915 Ga0496112_0336917 Ga0496112_0336917_911_1228 105
229 3300048915 Ga0496112_1564363 Ga0496112_1564363_105_425 105
230 3300048919 Ga0496116_0044766 Ga0496116_0044766_2358_2675 105
231 3300048920 Ga0496117_0063805 Ga0496117_0063805_617_937 105
232 3300048920 Ga0496117_0209027 Ga0496117_0209027_73_390 105
233 3300048921 Ga0496118_0064986 Ga0496118_0064986_1035_1352 105
234 3300048924 Ga0496121_0006247 Ga0496121_0006247_6551_6871 105
235 3300048924 Ga0496121_0010756 Ga0496121_0010756_2462_2779 105
236 3300048924 Ga0496121_0486139 Ga0496121_0486139_250_567 105
237 3300048925 Ga0496122_0001761 Ga0496122_0001761_10875_11195 105
238 3300048925 Ga0496122_0034212 Ga0496122_0034212_1803_2126 105
239 3300048925 Ga0496122_0048132 Ga0496122_0048132_2099_2416 105
240 3300048926 Ga0496123_0000087 Ga0496123_0000087_281_601 105
241 3300048926 Ga0496123_0023965 Ga0496123_0023965_3627_3944 105
242 3300048926 Ga0496123_0029506 Ga0496123_0029506_1910_2233 105
243 3300048927 Ga0496124_0000807 Ga0496124_0000807_26417_26737 105
244 3300048927 Ga0496124_0019173 Ga0496124_0019173_5427_5744 105
245 3300048927 Ga0496124_0079625 Ga0496124_0079625_662_979 105
246 3300048927 Ga0496124_0083036 Ga0496124_0083036_310_633 105
247 3300048927 Ga0496124_0233131 Ga0496124_0233131_147_488 105
248 3300049459 Ga0495678_000033 Ga0495678_000033_70321_70644 105
249 3300049459 Ga0495678_007950 Ga0495678_007950_3372_3755 105
250 3300049460 Ga0495682_0001185 Ga0495682_0001185_7395_7712 105
251 3300049569 Ga0501032_0008112 Ga0501032_0008112_2557_2892 105
252 3300049571 Ga0501034_0393148 Ga0501034_0393148_635_970 105
253 3300049575 Ga0501039_0887325 Ga0501039_0887325_297_632 105
254 3300049853 Ga0501226_000014 Ga0501226_000014_58146_58490 105
255 3300053125 Ga0500618_125766 Ga0500618_125766_179_502 105
256 3300053140 Ga0500573_0039775 Ga0500573_0039775_678_1001 105
257 3300053142 Ga0500577_0107555 Ga0500577_0107555_340_660 105
258 3300053145 Ga0500586_028477 Ga0500586_028477_192_515 105
259 iso_pu_bacteria 2511231004 2511252476 105
260 iso_pu_bacteria 2511231006 2511263682 105
261 iso_pu_bacteria 2511231007 2511272399 105
262 iso_pu_bacteria 2511231011 2511293831 105
263 iso_pu_bacteria 2511231016 2511329364 105
264 iso_pu_bacteria 2511231031 2511416304 105
265 iso_pu_bacteria 2511231156 2511823584 105
266 iso_pu_bacteria 2512047018 2512324903 105
267 iso_pu_bacteria 2554235341 2555668658 105
268 iso_pu_bacteria 2582580891 2583791029 105
269 iso_pu_bacteria 2597489887 2597856826 105
270 iso_pu_bacteria 2597489888 2597863037 105
271 iso_pu_bacteria 2597489889 2597868829 105
272 iso_pu_bacteria 2599185160 2599357029 105
273 iso_pu_bacteria 2599185161 2599362184 105
274 iso_pu_bacteria 2599185162 2599368504 105
275 iso_pu_bacteria 2599185163 2599375293 105
276 iso_pu_bacteria 2599185164 2599382134 105
277 iso_pu_bacteria 2599185165 2599388581 105
278 iso_pu_bacteria 2599185166 2599394151 105
279 iso_pu_bacteria 2599185167 2599401619 105
280 iso_pu_bacteria 2599185168 2599405916 105
281 iso_pu_bacteria 2599185179 2599451840 105
282 iso_pu_bacteria 2599185181 2599464466 105
283 iso_pu_bacteria 2599185182 2599468790 105
284 iso_pu_bacteria 2599185185 2599483849 105
285 iso_pu_bacteria 2599185186 2599493489 105
286 iso_pu_bacteria 2599185188 2599504073 105
287 iso_pu_bacteria 2599185189 2599509610 105
288 iso_pu_bacteria 2599185190 2599514863 105
289 iso_pu_bacteria 2599185191 2599520961 105
290 iso_pu_bacteria 2599185212 2599611730 105
291 iso_pu_bacteria 2599185248 2599770173 105
292 iso_pu_bacteria 2599185257 2599801495 105
293 iso_pu_bacteria 2599185289 2599887627 105
294 iso_pu_bacteria 2599185290 2599894340 105
295 iso_pu_bacteria 2599185291 2599899894 105
296 iso_pu_bacteria 2599185300 2599932034 105
297 iso_pu_bacteria 2599185302 2599941900 105
298 iso_pu_bacteria 2599185304 2599952580 105
299 iso_pu_bacteria 2599185305 2599960471 105
300 iso_pu_bacteria 2599185306 2599965379 105
301 iso_pu_bacteria 2599185308 2599978482 105
302 iso_pu_bacteria 2599185309 2599982064 105
303 iso_pu_bacteria 2599185310 2599987974 105
304 iso_pu_bacteria 2599185311 2599995675 105
305 iso_pu_bacteria 2599185312 2599998136 105
306 iso_pu_bacteria 2599185313 2600008613 105
307 iso_pu_bacteria 2599185314 2600010611 105
308 iso_pu_bacteria 2599185315 2600017489 105
309 iso_pu_bacteria 2599185316 2600025505 105
310 iso_pu_bacteria 2599185317 2600027742 105
311 iso_pu_bacteria 2599185318 2600034508 105
312 iso_pu_bacteria 2599185319 2600041651 105
313 iso_pu_bacteria 2599185320 2600046302 105
314 iso_pu_bacteria 2599185321 2600052313 105
315 iso_pu_bacteria 2599185322 2600057678 105
316 iso_pu_bacteria 2599185323 2600065115 105
317 iso_pu_bacteria 2599185324 2600073741 105
318 iso_pu_bacteria 2599185325 2600078789 105
319 iso_pu_bacteria 2599185356 2600216743 105
320 iso_pu_bacteria 2600254930 2600356549 105
321 iso_pu_bacteria 2600254931 2600365796 105
322 iso_pu_bacteria 2600255296 2601694254 105
323 iso_pu_bacteria 2600255313 2601776660 105
324 iso_pu_bacteria 2600255318 2601795482 105
325 iso_pu_bacteria 2603880185 2606075551 105
326 iso_pu_bacteria 2603880199 2606128537 105
327 iso_pu_bacteria 2606217733 2608380337 105
328 iso_pu_bacteria 2619619299 2621300889 105
329 iso_pu_bacteria 2623620443 2624479419 105
330 iso_pu_bacteria 2643221571 2643871627 105
331 iso_pu_bacteria 2643221589 2643952554 105
332 iso_pu_bacteria 2643221602 2644022316 105
333 iso_pu_bacteria 2643221633 2644187173 105
334 iso_pu_bacteria 2643221650 2644281732 105
335 iso_pu_bacteria 2643221713 2644623138 105
336 iso_pu_bacteria 2651869719 2652544728 105
337 iso_pu_bacteria 2667528170 2671090288 105
338 iso_pu_bacteria 2667528171 2671098823 105
339 iso_pu_bacteria 2667528176 2671125906 105
340 iso_pu_bacteria 2671180172 2671768444 105
341 iso_pu_bacteria 2675903420 2677896875 105
342 iso_pu_bacteria 2675903515 2678262504 105
343 iso_pu_bacteria 2713897148 2715753816 105
344 iso_pu_bacteria 2713897149 2715757685 105
345 iso_pu_bacteria 2721755607 2723247854 105
346 iso_pu_bacteria 2738541265 2738670486 105
347 iso_pu_bacteria 2738541282 2738748879 105
348 iso_pu_bacteria 2738541303 2738857921 105
349 iso_pu_bacteria 2738543025 2739316039 105
350 iso_pu_bacteria 2740892503 2743736254 105
351 iso_pu_bacteria 2744054620 2745008846 105
352 iso_pu_bacteria 2773857670 2774122857 105
353 iso_pu_bacteria 2773857673 2774137576 105
354 iso_pu_bacteria 2784132063 2784265675 105
355 iso_pu_bacteria 2784132072 2784315215 105
356 iso_pu_bacteria 2791355520 2794596311 105
357 iso_pu_bacteria 2808606361 2808856127 105
358 iso_pu_bacteria 2808606376 2808923595 105
359 iso_pu_bacteria 2808606377 2808927347 105
360 iso_pu_bacteria 2808606378 2808936122 105
361 iso_pu_bacteria 2808606380 2808945642 105
362 iso_pu_bacteria 2808606381 2808950114 105
363 iso_pu_bacteria 2808606382 2808957670 105
364 iso_pu_bacteria 2808606383 2808964632 105
365 iso_pu_bacteria 2808606385 2808979425 105
366 iso_pu_bacteria 2808606388 2808995349 105
367 iso_pu_bacteria 2808606389 2808999520 105
368 iso_pu_bacteria 2816332298 2817489810 105
369 iso_pu_bacteria 2818991464 2819703944 105
370 iso_pu_bacteria 2825651385 2825653138 105
371 iso_pu_bacteria 2834028612 2834029687 105
372 iso_pu_bacteria 2842826826 2842831952 105
373 iso_pu_bacteria 2842832357 2842832711 105
374 iso_pu_bacteria 2842837860 2842841536 105
375 iso_pu_bacteria 2842843487 2842848205 105
376 iso_pu_bacteria 2844665904 2844669158 105
377 iso_pu_bacteria 2852612431 2852618432 105
378 iso_pu_bacteria 2852657418 2852658901 105
379 iso_pu_bacteria 2852667396 2852673432 105
380 iso_pu_bacteria 2860339153 2860340038 105
381 iso_pu_bacteria 2860867994 2860869683 105
382 iso_pu_bacteria 2878029506 2878031422 105
383 iso_pu_bacteria 2880230671 2880232290 105
384 iso_pu_bacteria 2904518522 2904521817 105
385 iso_pu_bacteria 2908446538 2908448601 105
386 iso_pu_bacteria 2913036834 2913038476 105
387 iso_pu_bacteria 2917070673 2917072430 105
388 iso_pu_bacteria 2919481497 2919481760 105
389 iso_pu_bacteria 2919487758 2919491332 105
390 iso_pu_bacteria 2923153595 2923155268 105
391 iso_pu_bacteria 2923586266 2923587403 105
392 iso_pu_bacteria 2929144301 2929145935 105
393 iso_pu_bacteria 2929189879 2929191655 105
394 iso_pu_bacteria 2931369376 2931370725 105
395 iso_pu_bacteria 2931390751 2931392755 105
396 iso_pu_bacteria 2931396565 2931400069 105
397 iso_pu_bacteria 2935353572 2935354594 105
398 iso_pu_bacteria 2939636861 2939639758 105
399 iso_pu_bacteria 2945928738 2945928911 105
400 iso_pu_bacteria 2945961074 2945965194 105
401 iso_pu_bacteria 2946027586 2946029938 105
402 iso_pu_bacteria 2947233263 2947236509 105
403 iso_pu_bacteria 2969304461 2969306205 105
404 iso_pu_bacteria 2974289157 2974292141 105
405 iso_pu_bacteria 2988728565 2988733471 105
406 iso_pu_bacteria 2998139840 2998141602 105
407 iso_pu_bacteria 3007395558 3007400809 105
408 iso_pu_bacteria 3007419365 3007421270 105
409 iso_pu_bacteria 3007511990 3007512985 105
410 iso_pu_bacteria 3007614139 3007617607 105
411 iso_pu_bacteria 3007718800 3007723345 105
412 iso_pu_bacteria 3007866637 3007870429 105
413 iso_pu_bacteria 637000220 637319017 105
414 iso_pu_bacteria 8015687852 8015689489 105
415 iso_pu_bacteria 8019769354 8019774108 105
416 iso_pu_bacteria 8054285046 8054288636 105
417 iso_pu_bacteria 8054347763 8054352116 105
418 iso_pu_bacteria 8054503363 8054505257 105
419 iso_pu_bacteria 8055817908 8055819800 105
420 iso_pu_bacteria 8056125926 8056130202 105
421 iso_pu_bacteria 8056131705 8056133584 105
422 iso_pu_bacteria 8056148874 8056150489 105
423 iso_pu_bacteria 8056155041 8056156251 105
424 iso_pu_bacteria 8056161164 8056165005 105
425 iso_pu_bacteria 8056172158 8056175574 105
426 iso_pu_bacteria 8056177738 8056181114 105
427 iso_pu_bacteria 8057798959 8057799050 105
428 3300006058 Ga0075432_10344045 Ga0075432_103440452 106
429 3300006914 Ga0075436_101107710 Ga0075436_1011077102 106
430 3300009011 Ga0105251_10142509 Ga0105251_101425092 106
431 3300009011 Ga0105251_10652946 Ga0105251_106529462 106
432 3300009036 Ga0105244_10009403 Ga0105244_100094032 106
433 3300009036 Ga0105244_10014015 Ga0105244_100140154 106
434 3300025728 Ga0207655_1004518 Ga0207655_10045187 106
435 3300025728 Ga0207655_1010611 Ga0207655_10106112 106
436 3300042010 Ga0439452_031519 Ga0439452_031519_81_419 106
437 3300042439 Ga0439464_0001317 Ga0439464_0001317_5438_5776 106
438 3300046457 Ga0495590_0284124 Ga0495590_0284124_165_491 106
439 3300046458 Ga0495591_001297 Ga0495591_001297_3068_3394 106
440 3300046458 Ga0495591_011472 Ga0495591_011472_90_416 106
441 3300046471 Ga0495650_0000221 Ga0495650_0000221_14533_14859 106
442 3300046474 Ga0495605_0006439 Ga0495605_0006439_5321_5647 106
443 3300046474 Ga0495605_0077969 Ga0495605_0077969_71_397 106
444 3300046491 Ga0495584_0004829 Ga0495584_0004829_1200_1526 106
445 3300046491 Ga0495584_0004946 Ga0495584_0004946_1978_2304 106
446 3300046492 Ga0495585_0143985 Ga0495585_0143985_396_722 106
447 3300046500 Ga0495596_0051855 Ga0495596_0051855_183_509 106
448 3300046501 Ga0495607_0001496 Ga0495607_0001496_20021_20347 106
449 3300046501 Ga0495607_0011595 Ga0495607_0011595_5461_5787 106
450 3300046506 Ga0495583_0001288 Ga0495583_0001288_21954_22280 106
451 3300046506 Ga0495583_0006885 Ga0495583_0006885_3354_3680 106
452 3300046507 Ga0495606_0204340 Ga0495606_0204340_744_1070 106
453 3300046518 Ga0495631_0004610 Ga0495631_0004610_60_386 106
454 3300046519 Ga0495632_0000867 Ga0495632_0000867_20073_20399 106
455 3300046519 Ga0495632_0021400 Ga0495632_0021400_3085_3411 106
456 3300046519 Ga0495632_0056635 Ga0495632_0056635_1069_1395 106
457 3300046520 Ga0495637_0000546 Ga0495637_0000546_12634_12960 106
458 3300046520 Ga0495637_0015151 Ga0495637_0015151_1851_2177 106
459 3300046520 Ga0495637_0042635 Ga0495637_0042635_255_581 106
460 3300046522 Ga0495643_0106502 Ga0495643_0106502_177_503 106
461 3300046522 Ga0495643_0124477 Ga0495643_0124477_47_373 106
462 3300046522 Ga0495643_0289421 Ga0495643_0289421_238_564 106
463 3300046523 Ga0495644_0003325 Ga0495644_0003325_2784_3110 106
464 3300046524 Ga0495648_0002803 Ga0495648_0002803_5019_5345 106
465 3300046528 Ga0495642_0003792 Ga0495642_0003792_1481_1807 106
466 3300046530 Ga0495654_0007339 Ga0495654_0007339_4454_4780 106
467 3300046530 Ga0495654_0088238 Ga0495654_0088238_727_1053 106
468 3300046530 Ga0495654_0160961 Ga0495654_0160961_318_644 106
469 3300046538 Ga0495609_0000382 Ga0495609_0000382_24837_25163 106
470 3300046538 Ga0495609_0089196 Ga0495609_0089196_945_1271 106
471 3300046542 Ga0495597_0202312 Ga0495597_0202312_276_602 106
472 3300046616 Ga0495668_0012999 Ga0495668_0012999_54_380 106
473 3300046616 Ga0495668_0142717 Ga0495668_0142717_446_772 106
474 3300046616 Ga0495668_0549199 Ga0495668_0549199_300_626 106
475 3300046648 Ga0495611_0000589 Ga0495611_0000589_19230_19556 106
476 3300046660 Ga0495625_0000010 Ga0495625_0000010_272270_272596 106
477 3300046665 Ga0495661_0000020 Ga0495661_0000020_10996_11322 106
478 3300046665 Ga0495661_0039047 Ga0495661_0039047_93_419 106
479 3300046665 Ga0495661_0067592 Ga0495661_0067592_11_337 106
480 3300046691 Ga0495670_0296484 Ga0495670_0296484_270_596 106
481 3300046692 Ga0495671_0002417 Ga0495671_0002417_8513_8839 106
482 3300046692 Ga0495671_0047244 Ga0495671_0047244_1681_2007 106
483 3300046694 Ga0495649_0000953 Ga0495649_0000953_6036_6362 106
484 3300046794 Ga0495589_0036200 Ga0495589_0036200_1231_1557 106
485 3300046810 Ga0495660_0014143 Ga0495660_0014143_922_1248 106
486 3300047318 Ga0495636_0076264 Ga0495636_0076264_64_390 106
487 3300047320 Ga0495672_0030856 Ga0495672_0030856_2115_2441 106
488 3300047320 Ga0495672_0048921 Ga0495672_0048921_183_509 106
489 3300047320 Ga0495672_0127767 Ga0495672_0127767_71_397 106
490 3300047323 Ga0495683_0006147 Ga0495683_0006147_3626_3952 106
491 3300047446 Ga0495679_000126 Ga0495679_000126_63_389 106
492 3300047469 Ga0495673_0002520 Ga0495673_0002520_7201_7527 106
493 3300047469 Ga0495673_0003566 Ga0495673_0003566_6569_6895 106
494 3300047469 Ga0495673_0007822 Ga0495673_0007822_5189_5515 106
495 3300047469 Ga0495673_0035945 Ga0495673_0035945_1390_1716 106
496 3300047470 Ga0495681_0024793 Ga0495681_0024793_1041_1367 106
497 3300047472 Ga0495686_0019342 Ga0495686_0019342_3158_3484 106
498 3300048091 Ga0495626_0000007 Ga0495626_0000007_110521_110847 106
499 3300048091 Ga0495626_0008419 Ga0495626_0008419_3620_3946 106
500 3300049459 Ga0495678_000787 Ga0495678_000787_14087_14413 106
501 3300049459 Ga0495678_005114 Ga0495678_005114_3457_3783 106
502 3300049459 Ga0495678_007928 Ga0495678_007928_3336_3662 106
503 3300049459 Ga0495678_021969 Ga0495678_021969_1421_1747 106
504 3300009011 Ga0105251_10000060 Ga0105251_1000006074 107
505 3300013102 Ga0157371_11452969 Ga0157371_114529692 107
506 3300013105 Ga0157369_10955212 Ga0157369_109552122 107
507 3300015261 Ga0182006_1100196 Ga0182006_11001962 107
508 3300025735 Ga0207713_1000150 Ga0207713_100015026 107
509 3300031548 Ga0307408_100035752 Ga0307408_1000357522 107
510 3300031731 Ga0307405_10075341 Ga0307405_100753412 107
511 3300031824 Ga0307413_10537800 Ga0307413_105378002 107
512 3300031852 Ga0307410_11658515 Ga0307410_116585151 107
513 3300031911 Ga0307412_10015329 Ga0307412_100153292 107
514 3300032004 Ga0307414_10667585 Ga0307414_106675852 107
515 3300032005 Ga0307411_10113942 Ga0307411_101139422 107
516 3300042137 Ga0450902_006763 Ga0450902_006763_866_1195 107
517 3300042439 Ga0439464_0010620 Ga0439464_0010620_392_733 107
518 3300042461 Ga0439460_0012892 Ga0439460_0012892_1726_2055 107
519 3300046474 Ga0495605_0488815 Ga0495605_0488815_89_412 107
520 3300027543 Ga0209999_1041556 Ga0209999_10415562 108
521 3300042137 Ga0450902_002811 Ga0450902_002811_1818_2150 108
522 3300042138 Ga0450903_009656 Ga0450903_009656_312_644 108
523 3300042439 Ga0439464_0067337 Ga0439464_0067337_139_465 108
524 3300046558 Ga0495633_0109450 Ga0495633_0109450_220_546 108
525 3300047320 Ga0495672_0020829 Ga0495672_0020829_1260_1586 108
526 3300047470 Ga0495681_0002330 Ga0495681_0002330_10788_11114 108
527 2124908027 MRS2a_Contig_746 MRS2a_00603890 109
528 2162886007 SwRhRL2b_contig_936219 SwRhRL2b_0886.00006900 109
529 3300002705 JGI25156J39149_1025463 JGI25156J39149_10254632 109
530 3300002737 JGI25162J39368_1000037 JGI25162J39368_100003740 109
531 3300002737 JGI25162J39368_1000212 JGI25162J39368_100021216 109
532 3300002771 JGI25163J39215_1000442 JGI25163J39215_10004429 109
533 3300002771 JGI25163J39215_1000503 JGI25163J39215_10005035 109
534 3300002772 JGI25164J39214_1000020 JGI25164J39214_100002040 109
535 3300002772 JGI25164J39214_1000051 JGI25164J39214_100005149 109
536 3300003214 JGI25165J46597_1000077 JGI25165J46597_100007740 109
537 3300003214 JGI25165J46597_1000091 JGI25165J46597_100009149 109
538 3300003323 rootH1_10334418 rootH1_103344182 109
539 3300003751 Ga0055538_1000090 Ga0055538_100009017 109
540 3300003752 Ga0055539_1000134 Ga0055539_100013417 109
541 3300003756 Ga0055533_1000138 Ga0055533_100013865 109
542 3300003758 Ga0055532_1000142 Ga0055532_100014217 109
543 3300003759 Ga0055525_1000183 Ga0055525_100018317 109
544 3300003781 Ga0055536_1000886 Ga0055536_100088620 109
545 3300003784 Ga0055534_1047226 Ga0055534_10472262 109
546 3300003791 Ga0055530_10000158 Ga0055530_1000015811 109
547 3300003792 Ga0055540_1000182 Ga0055540_100018211 109
548 3300003841 Ga0055541_1000089 Ga0055541_100008917 109
549 3300005288 Ga0065714_10002255 Ga0065714_1000225534 109
550 3300005288 Ga0065714_10002585 Ga0065714_1000258520 109
551 3300005288 Ga0065714_10009355 Ga0065714_100093552 109
552 3300005288 Ga0065714_10040982 Ga0065714_100409822 109
553 3300005288 Ga0065714_10090909 Ga0065714_100909092 109
554 3300005288 Ga0065714_10347257 Ga0065714_103472572 109
555 3300005289 Ga0065704_10070596 Ga0065704_100705968 109
556 3300005289 Ga0065704_10114457 Ga0065704_101144572 109
557 3300005289 Ga0065704_10520469 Ga0065704_105204692 109
558 3300005289 Ga0065704_10576452 Ga0065704_105764522 109
559 3300005293 Ga0065715_10755421 Ga0065715_107554212 109
560 3300005331 Ga0070670_100001221 Ga0070670_10000122121 109
561 3300005331 Ga0070670_100053848 Ga0070670_1000538481 109
562 3300005344 Ga0070661_100000029 Ga0070661_10000002929 109
563 3300005353 Ga0070669_100000316 Ga0070669_1000003168 109
564 3300005457 Ga0070662_100016721 Ga0070662_1000167212 109
565 3300005539 Ga0068853_100008519 Ga0068853_10000851910 109
566 3300005564 Ga0070664_100000046 Ga0070664_10000004645 109
567 3300005834 Ga0068851_10000050 Ga0068851_1000005044 109
568 3300006051 Ga0075364_10231658 Ga0075364_102316582 109
569 3300006051 Ga0075364_10324408 Ga0075364_103244082 109
570 3300006051 Ga0075364_10514232 Ga0075364_105142321 109
571 3300006058 Ga0075432_10017532 Ga0075432_100175322 109
572 3300006058 Ga0075432_10086986 Ga0075432_100869862 109
573 3300006058 Ga0075432_10108892 Ga0075432_101088922 109
574 3300006177 Ga0075362_10098343 Ga0075362_100983432 109
575 3300006177 Ga0075362_10397381 Ga0075362_103973812 109
576 3300006186 Ga0075369_10478098 Ga0075369_104780982 109
577 3300006353 Ga0075370_10932662 Ga0075370_109326621 109
578 3300006914 Ga0075436_100043124 Ga0075436_1000431243 109
579 3300006914 Ga0075436_100593592 Ga0075436_1005935921 109
580 3300006946 Ga0079104_1000545 Ga0079104_100054514 109
581 3300006946 Ga0079104_1000574 Ga0079104_100057416 109
582 3300006948 Ga0099826_10002700 Ga0099826_100027009 109
583 3300009011 Ga0105251_10002821 Ga0105251_1000282111 109
584 3300009011 Ga0105251_10009019 Ga0105251_100090192 109
585 3300009011 Ga0105251_10011769 Ga0105251_100117695 109
586 3300009011 Ga0105251_10175261 Ga0105251_101752611 109
587 3300009011 Ga0105251_10356462 Ga0105251_103564621 109
588 3300009036 Ga0105244_10006180 Ga0105244_100061804 109
589 3300009036 Ga0105244_10013620 Ga0105244_100136202 109
590 3300009036 Ga0105244_10024831 Ga0105244_100248312 109
591 3300009036 Ga0105244_10041755 Ga0105244_100417553 109
592 3300009036 Ga0105244_10044688 Ga0105244_100446881 109
593 3300009036 Ga0105244_10204121 Ga0105244_102041212 109
594 3300009036 Ga0105244_10226688 Ga0105244_102266882 109
595 3300009036 Ga0105244_10226689 Ga0105244_102266892 109
596 3300009092 Ga0105250_10000443 Ga0105250_1000044324 109
597 3300009092 Ga0105250_10006271 Ga0105250_100062717 109
598 3300009092 Ga0105250_10006633 Ga0105250_100066335 109
599 3300009092 Ga0105250_10050006 Ga0105250_100500062 109
600 3300009092 Ga0105250_10093600 Ga0105250_100936002 109
601 3300009148 Ga0105243_10000158 Ga0105243_1000015836 109
602 3300009148 Ga0105243_10000686 Ga0105243_1000068614 109
603 3300009148 Ga0105243_10074167 Ga0105243_100741672 109
604 3300009148 Ga0105243_10343313 Ga0105243_103433131 109
605 3300009176 Ga0105242_10000360 Ga0105242_1000036013 109
606 3300009176 Ga0105242_10517950 Ga0105242_105179501 109
607 3300009177 Ga0105248_10321002 Ga0105248_103210022 109
608 3300009545 Ga0105237_10001262 Ga0105237_100012621 109
609 3300009545 Ga0105237_10189228 Ga0105237_101892282 109
610 3300009551 Ga0105238_11390581 Ga0105238_113905812 109
611 3300009553 Ga0105249_11200704 Ga0105249_112007042 109
612 3300011119 Ga0105246_10000222 Ga0105246_1000022226 109
613 3300011119 Ga0105246_10000876 Ga0105246_100008769 109
614 3300011119 Ga0105246_10008949 Ga0105246_100089496 109
615 3300011119 Ga0105246_10011023 Ga0105246_100110232 109
616 3300012498 Ga0157345_1000204 Ga0157345_10002044 109
617 3300012502 Ga0157347_1021565 Ga0157347_10215652 109
618 3300013100 Ga0157373_10005441 Ga0157373_100054419 109
619 3300013100 Ga0157373_10012648 Ga0157373_100126484 109
620 3300013100 Ga0157373_10018039 Ga0157373_100180394 109
621 3300013100 Ga0157373_10018658 Ga0157373_100186583 109
622 3300013100 Ga0157373_10020190 Ga0157373_100201905 109
623 3300013100 Ga0157373_10022401 Ga0157373_100224015 109
624 3300013102 Ga0157371_10000513 Ga0157371_1000051340 109
625 3300013102 Ga0157371_10006014 Ga0157371_100060144 109
626 3300013102 Ga0157371_10010699 Ga0157371_100106995 109
627 3300013104 Ga0157370_10098872 Ga0157370_100988722 109
628 3300013104 Ga0157370_10214040 Ga0157370_102140402 109
629 3300013104 Ga0157370_10257479 Ga0157370_102574792 109
630 3300013104 Ga0157370_10539341 Ga0157370_105393412 109
631 3300013104 Ga0157370_10861112 Ga0157370_108611121 109
632 3300013105 Ga0157369_10003927 Ga0157369_1000392718 109
633 3300013105 Ga0157369_10027328 Ga0157369_100273284 109
634 3300013105 Ga0157369_10063255 Ga0157369_100632554 109
635 3300013105 Ga0157369_10104912 Ga0157369_101049122 109
636 3300013105 Ga0157369_10620541 Ga0157369_106205411 109
637 3300013105 Ga0157369_11069945 Ga0157369_110699452 109
638 3300013105 Ga0157369_11503589 Ga0157369_115035891 109
639 3300013105 Ga0157369_11765104 Ga0157369_117651042 109
640 3300013105 Ga0157369_12427419 Ga0157369_124274192 109
641 3300013306 Ga0163162_10009243 Ga0163162_100092438 109
642 3300013306 Ga0163162_10064941 Ga0163162_100649416 109
643 3300013306 Ga0163162_10472413 Ga0163162_104724132 109
644 3300013307 Ga0157372_10024791 Ga0157372_100247914 109
645 3300013308 Ga0157375_10034168 Ga0157375_100341685 109
646 3300013308 Ga0157375_10064541 Ga0157375_100645412 109
647 3300013308 Ga0157375_10090283 Ga0157375_100902833 109
648 3300013308 Ga0157375_10176459 Ga0157375_101764593 109
649 3300013308 Ga0157375_11404586 Ga0157375_114045861 109
650 3300014497 Ga0182008_10000040 Ga0182008_1000004036 109
651 3300014497 Ga0182008_10007769 Ga0182008_100077692 109
652 3300014497 Ga0182008_10037856 Ga0182008_100378562 109
653 3300015261 Ga0182006_1000780 Ga0182006_10007803 109
654 3300015261 Ga0182006_1006561 Ga0182006_10065614 109
655 3300015261 Ga0182006_1009115 Ga0182006_10091152 109
656 3300015261 Ga0182006_1009778 Ga0182006_10097782 109
657 3300015261 Ga0182006_1010411 Ga0182006_10104114 109
658 3300015261 Ga0182006_1165468 Ga0182006_11654681 109
659 3300015261 Ga0182006_1192034 Ga0182006_11920341 109
660 3300015262 Ga0182007_10010626 Ga0182007_100106262 109
661 3300015265 Ga0182005_1007572 Ga0182005_10075723 109
662 3300015265 Ga0182005_1040982 Ga0182005_10409822 109
663 3300017792 Ga0163161_10016933 Ga0163161_100169334 109
664 3300017792 Ga0163161_10024761 Ga0163161_100247613 109
665 3300017792 Ga0163161_10048839 Ga0163161_100488392 109
666 3300017792 Ga0163161_10061578 Ga0163161_100615782 109
667 3300017792 Ga0163161_10070786 Ga0163161_100707862 109
668 3300017792 Ga0163161_10173224 Ga0163161_101732242 109
669 3300017792 Ga0163161_10305602 Ga0163161_103056021 109
670 3300017792 Ga0163161_10438064 Ga0163161_104380642 109
671 3300017792 Ga0163161_10609746 Ga0163161_106097462 109
672 3300017792 Ga0163161_10951329 Ga0163161_109513292 109
673 3300025206 Ga0209435_101205 Ga0209435_1012052 109
674 3300025207 Ga0209760_100022 Ga0209760_100022125 109
675 3300025207 Ga0209760_100053 Ga0209760_10005323 109
676 3300025224 Ga0209784_100040 Ga0209784_100040164 109
677 3300025225 Ga0209566_100051 Ga0209566_100051164 109
678 3300025226 Ga0209674_100072 Ga0209674_100072164 109
679 3300025229 Ga0209147_100067 Ga0209147_100067164 109
680 3300025230 Ga0209563_100073 Ga0209563_100073164 109
681 3300025231 Ga0207427_100001 Ga0207427_100001915 109
682 3300025231 Ga0207427_100047 Ga0207427_100047125 109
683 3300025233 Ga0209437_100003 Ga0209437_100003457 109
684 3300025233 Ga0209437_100009 Ga0209437_100009125 109
685 3300025242 Ga0209258_100490 Ga0209258_10049017 109
686 3300025246 Ga0209646_1000383 Ga0209646_100038314 109
687 3300025253 Ga0209677_100121 Ga0209677_10012117 109
688 3300025256 Ga0209759_1004999 Ga0209759_10049993 109
689 3300025256 Ga0209759_1038855 Ga0209759_10388552 109
690 3300025261 Ga0209233_1000007 Ga0209233_1000007915 109
691 3300025261 Ga0209233_1000032 Ga0209233_1000032125 109
692 3300025291 Ga0209675_1002532 Ga0209675_10025326 109
693 3300025292 Ga0209676_1000016 Ga0209676_1000016520 109
694 3300025292 Ga0209676_1000033 Ga0209676_1000033342 109
695 3300025292 Ga0209676_1022616 Ga0209676_10226162 109
696 3300025298 Ga0209050_1000009 Ga0209050_1000009255 109
697 3300025298 Ga0209050_1000036 Ga0209050_100003638 109
698 3300025303 Ga0209051_1000008 Ga0209051_100000812 109
699 3300025303 Ga0209051_1000043 Ga0209051_1000043110 109
700 3300025304 Ga0209257_1000098 Ga0209257_1000098203 109
701 3300025304 Ga0209257_1014823 Ga0209257_10148232 109
702 3300025321 Ga0207656_10000293 Ga0207656_1000029311 109
703 3300025711 Ga0207696_1000101 Ga0207696_100010143 109
704 3300025711 Ga0207696_1004427 Ga0207696_10044272 109
705 3300025711 Ga0207696_1021804 Ga0207696_10218041 109
706 3300025711 Ga0207696_1023426 Ga0207696_10234261 109
707 3300025711 Ga0207696_1029694 Ga0207696_10296942 109
708 3300025711 Ga0207696_1076456 Ga0207696_10764562 109
709 3300025728 Ga0207655_1000019 Ga0207655_1000019298 109
710 3300025728 Ga0207655_1000337 Ga0207655_100033728 109
711 3300025728 Ga0207655_1001070 Ga0207655_10010708 109
712 3300025728 Ga0207655_1008174 Ga0207655_10081744 109
713 3300025728 Ga0207655_1014895 Ga0207655_10148952 109
714 3300025728 Ga0207655_1020507 Ga0207655_10205072 109
715 3300025728 Ga0207655_1021617 Ga0207655_10216172 109
716 3300025728 Ga0207655_1024802 Ga0207655_10248024 109
717 3300025728 Ga0207655_1028229 Ga0207655_10282293 109
718 3300025728 Ga0207655_1155576 Ga0207655_11555762 109
719 3300025735 Ga0207713_1001217 Ga0207713_10012178 109
720 3300025735 Ga0207713_1002539 Ga0207713_10025395 109
721 3300025735 Ga0207713_1003187 Ga0207713_10031879 109
722 3300025735 Ga0207713_1009720 Ga0207713_10097202 109
723 3300025735 Ga0207713_1010908 Ga0207713_10109083 109
724 3300025735 Ga0207713_1015010 Ga0207713_10150102 109
725 3300025735 Ga0207713_1155567 Ga0207713_11555672 109
726 3300025914 Ga0207671_10000287 Ga0207671_1000028771 109
727 3300025920 Ga0207649_10000068 Ga0207649_1000006832 109
728 3300025923 Ga0207681_10012718 Ga0207681_100127184 109
729 3300025925 Ga0207650_10000174 Ga0207650_1000017435 109
730 3300025925 Ga0207650_10000405 Ga0207650_1000040543 109
731 3300025933 Ga0207706_10027125 Ga0207706_100271252 109
732 3300025934 Ga0207686_10279286 Ga0207686_102792862 109
733 3300025934 Ga0207686_10662983 Ga0207686_106629832 109
734 3300025935 Ga0207709_10000053 Ga0207709_10000053116 109
735 3300025935 Ga0207709_10001997 Ga0207709_1000199714 109
736 3300025935 Ga0207709_10259055 Ga0207709_102590552 109
737 3300025945 Ga0207679_10000018 Ga0207679_1000001869 109
738 3300025961 Ga0207712_11179674 Ga0207712_111796742 109
739 3300025981 Ga0207640_10436920 Ga0207640_104369202 109
740 3300026041 Ga0207639_10005291 Ga0207639_1000529110 109
741 3300027111 Ga0209281_1000018 Ga0209281_1000018441 109
742 3300027111 Ga0209281_1000174 Ga0209281_100017445 109
743 3300027111 Ga0209281_1007040 Ga0209281_10070402 109
744 3300027666 Ga0209282_1020576 Ga0209282_10205764 109
745 3300027907 Ga0207428_10016748 Ga0207428_100167488 109
746 3300027907 Ga0207428_10034107 Ga0207428_100341073 109
747 3300027907 Ga0207428_10049806 Ga0207428_100498064 109
748 3300027907 Ga0207428_10313871 Ga0207428_103138712 109
749 3300030521 Ga0307511_10122554 Ga0307511_101225542 109
750 3300030521 Ga0307511_10223593 Ga0307511_102235932 109
751 3300030731 Ga0316177_1130413 Ga0316177_11304131 109
752 3300030733 Ga0314311_1092402 Ga0314311_10924022 109
753 3300030742 Ga0316183_1023970 Ga0316183_10239703 109
754 3300030744 Ga0316181_1134508 Ga0316181_11345082 109
755 3300030745 Ga0316182_1273877 Ga0316182_12738772 109
756 3300031548 Ga0307408_100770846 Ga0307408_1007708462 109
757 3300031731 Ga0307405_10002888 Ga0307405_1000288810 109
758 3300031901 Ga0307406_10005725 Ga0307406_100057258 109
759 3300031995 Ga0307409_100042016 Ga0307409_1000420162 109
760 3300032004 Ga0307414_10005562 Ga0307414_100055621 109
761 3300032004 Ga0307414_11948460 Ga0307414_119484601 109
762 3300032005 Ga0307411_10026265 Ga0307411_100262654 109
763 3300033180 Ga0307510_10042593 Ga0307510_100425934 109
764 3300038705 Ga0237819_01731 Ga0237819_01731_136_465 109
765 3300041405 Ga0439438_002727 Ga0439438_002727_3624_3953 109
766 3300041405 Ga0439438_003107 Ga0439438_003107_5897_6226 109
767 3300041405 Ga0439438_006132 Ga0439438_006132_2649_2978 109
768 3300041405 Ga0439438_009657 Ga0439438_009657_215_544 109
769 3300041405 Ga0439438_010066 Ga0439438_010066_1719_2048 109
770 3300041405 Ga0439438_012149 Ga0439438_012149_1320_1649 109
771 3300041405 Ga0439438_025751 Ga0439438_025751_951_1280 109
772 3300041407 Ga0439447_001200 Ga0439447_001200_5907_6236 109
773 3300041407 Ga0439447_002577 Ga0439447_002577_3913_4242 109
774 3300041407 Ga0439447_004106 Ga0439447_004106_2683_3012 109
775 3300041407 Ga0439447_007315 Ga0439447_007315_2170_2499 109
776 3300041407 Ga0439447_007389 Ga0439447_007389_2812_3168 109
777 3300041407 Ga0439447_024940 Ga0439447_024940_826_1155 109
778 3300041407 Ga0439447_066057 Ga0439447_066057_394_723 109
779 3300041411 Ga0439466_0003625 Ga0439466_0003625_5037_5366 109
780 3300041411 Ga0439466_0007541 Ga0439466_0007541_772_1101 109
781 3300041411 Ga0439466_0012205 Ga0439466_0012205_1167_1496 109
782 3300041411 Ga0439466_0014044 Ga0439466_0014044_1990_2319 109
783 3300041411 Ga0439466_0046387 Ga0439466_0046387_14_343 109
784 3300041411 Ga0439466_0082304 Ga0439466_0082304_409_738 109
785 3300041411 Ga0439466_0158325 Ga0439466_0158325_15_344 109
786 3300041413 Ga0439465_0016937 Ga0439465_0016937_719_1075 109
787 3300041498 Ga0451841_1129590 Ga0451841_1129590_195_524 109
788 3300042006 Ga0439432_000221 Ga0439432_000221_18452_18781 109
789 3300042006 Ga0439432_002029 Ga0439432_002029_2423_2752 109
790 3300042006 Ga0439432_004560 Ga0439432_004560_3668_3997 109
791 3300042006 Ga0439432_008649 Ga0439432_008649_2940_3296 109
792 3300042006 Ga0439432_021318 Ga0439432_021318_688_1017 109
793 3300042006 Ga0439432_212400 Ga0439432_212400_182_511 109
794 3300042009 Ga0439451_002269 Ga0439451_002269_3208_3543 109
795 3300042009 Ga0439451_003957 Ga0439451_003957_890_1219 109
796 3300042009 Ga0439451_014900 Ga0439451_014900_356_685 109
797 3300042009 Ga0439451_043076 Ga0439451_043076_266_595 109
798 3300042009 Ga0439451_052473 Ga0439451_052473_132_461 109
799 3300042010 Ga0439452_001336 Ga0439452_001336_9590_9946 109
800 3300042010 Ga0439452_001829 Ga0439452_001829_5894_6223 109
801 3300042010 Ga0439452_002038 Ga0439452_002038_4344_4673 109
802 3300042010 Ga0439452_009381 Ga0439452_009381_2493_2822 109
803 3300042010 Ga0439452_012733 Ga0439452_012733_616_945 109
804 3300042010 Ga0439452_019054 Ga0439452_019054_905_1234 109
805 3300042010 Ga0439452_038804 Ga0439452_038804_614_955 109
806 3300042010 Ga0439452_111834 Ga0439452_111834_26_355 109
807 3300042013 Ga0439456_014477 Ga0439456_014477_245_574 109
808 3300042013 Ga0439456_026414 Ga0439456_026414_711_1040 109
809 3300042013 Ga0439456_041021 Ga0439456_041021_199_528 109
810 3300042013 Ga0439456_067960 Ga0439456_067960_32_361 109
811 3300042013 Ga0439456_115794 Ga0439456_115794_120_449 109
812 3300042016 Ga0439463_002704 Ga0439463_002704_731_1060 109
813 3300042016 Ga0439463_042225 Ga0439463_042225_663_992 109
814 3300042016 Ga0439463_194838 Ga0439463_194838_24_353 109
815 3300042115 Ga0450911_002493 Ga0450911_002493_276_605 109
816 3300042115 Ga0450911_027641 Ga0450911_027641_133_462 109
817 3300042121 Ga0450919_027712 Ga0450919_027712_217_573 109
818 3300042122 Ga0450920_000665 Ga0450920_000665_877_1206 109
819 3300042124 Ga0450922_000171 Ga0450922_000171_2599_2928 109
820 3300042124 Ga0450922_004241 Ga0450922_004241_615_944 109
821 3300042124 Ga0450922_018578 Ga0450922_018578_311_667 109
822 3300042125 Ga0450923_042746 Ga0450923_042746_347_676 109
823 3300042129 Ga0450891_001832 Ga0450891_001832_526_855 109
824 3300042137 Ga0450902_003679 Ga0450902_003679_1684_2013 109
825 3300042137 Ga0450902_017166 Ga0450902_017166_790_1119 109
826 3300042138 Ga0450903_001475 Ga0450903_001475_1912_2241 109
827 3300042138 Ga0450903_037582 Ga0450903_037582_233_562 109
828 3300042139 Ga0450904_001580 Ga0450904_001580_2160_2489 109
829 3300042142 Ga0450905_012348 Ga0450905_012348_146_475 109
830 3300042145 Ga0450906_001615 Ga0450906_001615_4277_4606 109
831 3300042145 Ga0450906_003073 Ga0450906_003073_981_1310 109
832 3300042146 Ga0450907_000141 Ga0450907_000141_21572_21901 109
833 3300042146 Ga0450907_015898 Ga0450907_015898_276_605 109
834 3300042146 Ga0450907_046959 Ga0450907_046959_353_682 109
835 3300042147 Ga0450910_005462 Ga0450910_005462_57_386 109
836 3300042147 Ga0450910_028114 Ga0450910_028114_372_701 109
837 3300042184 Ga0450908_002630 Ga0450908_002630_291_620 109
838 3300042184 Ga0450908_015523 Ga0450908_015523_982_1311 109
839 3300042185 Ga0450909_017845 Ga0450909_017845_603_932 109
840 3300042533 Ga0450901_004466 Ga0450901_004466_689_1018 109
841 3300042993 Ga0439440_0002059 Ga0439440_0002059_2391_2720 109
842 3300046452 Ga0495617_000345 Ga0495617_000345_5367_5696 109
843 3300046452 Ga0495617_005322 Ga0495617_005322_2448_2777 109
844 3300046452 Ga0495617_025647 Ga0495617_025647_1233_1562 109
845 3300046452 Ga0495617_043372 Ga0495617_043372_470_799 109
846 3300046452 Ga0495617_056964 Ga0495617_056964_233_562 109
847 3300046452 Ga0495617_144765 Ga0495617_144765_20_349 109
848 3300046453 Ga0495627_002477 Ga0495627_002477_2742_3071 109
849 3300046453 Ga0495627_011679 Ga0495627_011679_1547_1876 109
850 3300046453 Ga0495627_016219 Ga0495627_016219_1746_2075 109
851 3300046453 Ga0495627_019374 Ga0495627_019374_1547_1876 109
852 3300046453 Ga0495627_129405 Ga0495627_129405_55_384 109
853 3300046453 Ga0495627_219590 Ga0495627_219590_68_397 109
854 3300046455 Ga0495603_0043524 Ga0495603_0043524_621_950 109
855 3300046455 Ga0495603_0075049 Ga0495603_0075049_1254_1583 109
856 3300046457 Ga0495590_0000407 Ga0495590_0000407_19264_19593 109
857 3300046457 Ga0495590_0001249 Ga0495590_0001249_5423_5752 109
858 3300046457 Ga0495590_0021035 Ga0495590_0021035_1484_1813 109
859 3300046457 Ga0495590_0189453 Ga0495590_0189453_190_519 109
860 3300046458 Ga0495591_002664 Ga0495591_002664_6708_7037 109
861 3300046458 Ga0495591_002875 Ga0495591_002875_4968_5297 109
862 3300046458 Ga0495591_008226 Ga0495591_008226_575_904 109
863 3300046458 Ga0495591_010124 Ga0495591_010124_2604_2933 109
864 3300046458 Ga0495591_017039 Ga0495591_017039_1670_1999 109
865 3300046458 Ga0495591_017690 Ga0495591_017690_321_650 109
866 3300046458 Ga0495591_067006 Ga0495591_067006_50_379 109
867 3300046458 Ga0495591_076017 Ga0495591_076017_335_664 109
868 3300046460 Ga0495638_0001706 Ga0495638_0001706_18304_18633 109
869 3300046460 Ga0495638_0016733 Ga0495638_0016733_2515_2844 109
870 3300046460 Ga0495638_0017330 Ga0495638_0017330_3837_4166 109
871 3300046460 Ga0495638_0017833 Ga0495638_0017833_2324_2653 109
872 3300046460 Ga0495638_0064240 Ga0495638_0064240_95_424 109
873 3300046460 Ga0495638_0222308 Ga0495638_0222308_471_800 109
874 3300046460 Ga0495638_0295197 Ga0495638_0295197_534_863 109
875 3300046460 Ga0495638_0655906 Ga0495638_0655906_28_357 109
876 3300046463 Ga0495653_0009503 Ga0495653_0009503_619_948 109
877 3300046463 Ga0495653_0011533 Ga0495653_0011533_1786_2115 109
878 3300046463 Ga0495653_0037547 Ga0495653_0037547_2901_3230 109
879 3300046463 Ga0495653_0104430 Ga0495653_0104430_1150_1479 109
880 3300046471 Ga0495650_0010351 Ga0495650_0010351_2608_2937 109
881 3300046471 Ga0495650_0011705 Ga0495650_0011705_3005_3334 109
882 3300046471 Ga0495650_0064442 Ga0495650_0064442_575_904 109
883 3300046471 Ga0495650_0131253 Ga0495650_0131253_339_668 109
884 3300046474 Ga0495605_0001124 Ga0495605_0001124_13317_13646 109
885 3300046474 Ga0495605_0020475 Ga0495605_0020475_1260_1589 109
886 3300046474 Ga0495605_0033135 Ga0495605_0033135_524_853 109
887 3300046474 Ga0495605_0047485 Ga0495605_0047485_642_971 109
888 3300046474 Ga0495605_0057111 Ga0495605_0057111_503_832 109
889 3300046474 Ga0495605_0096412 Ga0495605_0096412_498_827 109
890 3300046474 Ga0495605_0204128 Ga0495605_0204128_49_378 109
891 3300046474 Ga0495605_0281135 Ga0495605_0281135_204_533 109
892 3300046474 Ga0495605_0290274 Ga0495605_0290274_281_610 109
893 3300046491 Ga0495584_0005292 Ga0495584_0005292_2706_3035 109
894 3300046491 Ga0495584_0007295 Ga0495584_0007295_2662_2991 109
895 3300046491 Ga0495584_0015934 Ga0495584_0015934_1996_2325 109
896 3300046491 Ga0495584_0023984 Ga0495584_0023984_1729_2058 109
897 3300046491 Ga0495584_0024705 Ga0495584_0024705_1061_1390 109
898 3300046491 Ga0495584_0047415 Ga0495584_0047415_1788_2117 109
899 3300046491 Ga0495584_0092177 Ga0495584_0092177_1174_1503 109
900 3300046491 Ga0495584_0170503 Ga0495584_0170503_347_676 109
901 3300046491 Ga0495584_0223314 Ga0495584_0223314_477_806 109
902 3300046492 Ga0495585_0000816 Ga0495585_0000816_10869_11198 109
903 3300046492 Ga0495585_0007295 Ga0495585_0007295_3759_4088 109
904 3300046492 Ga0495585_0024144 Ga0495585_0024144_528_857 109
905 3300046492 Ga0495585_0040411 Ga0495585_0040411_1625_1954 109
906 3300046492 Ga0495585_0043876 Ga0495585_0043876_1746_2075 109
907 3300046492 Ga0495585_0094257 Ga0495585_0094257_561_890 109
908 3300046499 Ga0495594_0085325 Ga0495594_0085325_322_651 109
909 3300046499 Ga0495594_0218208 Ga0495594_0218208_367_696 109
910 3300046500 Ga0495596_0018515 Ga0495596_0018515_2447_2776 109
911 3300046501 Ga0495607_0000888 Ga0495607_0000888_22210_22539 109
912 3300046501 Ga0495607_0026374 Ga0495607_0026374_1862_2191 109
913 3300046501 Ga0495607_0034286 Ga0495607_0034286_1458_1787 109
914 3300046501 Ga0495607_0042670 Ga0495607_0042670_1730_2059 109
915 3300046501 Ga0495607_0043682 Ga0495607_0043682_1851_2180 109
916 3300046501 Ga0495607_0049787 Ga0495607_0049787_141_470 109
917 3300046501 Ga0495607_0053686 Ga0495607_0053686_1601_1930 109
918 3300046501 Ga0495607_0055029 Ga0495607_0055029_759_1088 109
919 3300046501 Ga0495607_0134561 Ga0495607_0134561_401_730 109
920 3300046501 Ga0495607_0246787 Ga0495607_0246787_69_398 109
921 3300046501 Ga0495607_0312860 Ga0495607_0312860_23_352 109
922 3300046506 Ga0495583_0003027 Ga0495583_0003027_2601_2930 109
923 3300046506 Ga0495583_0003309 Ga0495583_0003309_10488_10817 109
924 3300046506 Ga0495583_0058584 Ga0495583_0058584_140_469 109
925 3300046506 Ga0495583_0128725 Ga0495583_0128725_591_920 109
926 3300046507 Ga0495606_0004097 Ga0495606_0004097_9430_9759 109
927 3300046507 Ga0495606_0009421 Ga0495606_0009421_3373_3702 109
928 3300046507 Ga0495606_0025593 Ga0495606_0025593_1156_1485 109
929 3300046507 Ga0495606_0051258 Ga0495606_0051258_48_377 109
930 3300046507 Ga0495606_0057228 Ga0495606_0057228_1601_1930 109
931 3300046507 Ga0495606_0078829 Ga0495606_0078829_850_1179 109
932 3300046507 Ga0495606_0140381 Ga0495606_0140381_290_619 109
933 3300046512 Ga0495610_0008157 Ga0495610_0008157_3135_3464 109
934 3300046512 Ga0495610_0009933 Ga0495610_0009933_32_361 109
935 3300046512 Ga0495610_0011085 Ga0495610_0011085_1776_2105 109
936 3300046512 Ga0495610_0016728 Ga0495610_0016728_43_372 109
937 3300046512 Ga0495610_0019983 Ga0495610_0019983_548_877 109
938 3300046512 Ga0495610_0039219 Ga0495610_0039219_1049_1378 109
939 3300046512 Ga0495610_0043634 Ga0495610_0043634_1775_2104 109
940 3300046512 Ga0495610_0071414 Ga0495610_0071414_649_978 109
941 3300046513 Ga0495616_0004718 Ga0495616_0004718_6290_6619 109
942 3300046513 Ga0495616_0014914 Ga0495616_0014914_3409_3738 109
943 3300046513 Ga0495616_0039394 Ga0495616_0039394_1690_2019 109
944 3300046513 Ga0495616_0045237 Ga0495616_0045237_1739_2068 109
945 3300046513 Ga0495616_0207586 Ga0495616_0207586_168_497 109
946 3300046515 Ga0495620_0002079 Ga0495620_0002079_7330_7659 109
947 3300046515 Ga0495620_0003930 Ga0495620_0003930_5446_5775 109
948 3300046515 Ga0495620_0004911 Ga0495620_0004911_5602_5931 109
949 3300046515 Ga0495620_0009877 Ga0495620_0009877_3298_3627 109
950 3300046515 Ga0495620_0034175 Ga0495620_0034175_1571_1900 109
951 3300046515 Ga0495620_0155932 Ga0495620_0155932_432_761 109
952 3300046516 Ga0495628_0853643 Ga0495628_0853643_154_483 109
953 3300046517 Ga0495630_0103393 Ga0495630_0103393_1707_2036 109
954 3300046517 Ga0495630_0135343 Ga0495630_0135343_1043_1372 109
955 3300046517 Ga0495630_0301436 Ga0495630_0301436_140_469 109
956 3300046518 Ga0495631_0001595 Ga0495631_0001595_7260_7589 109
957 3300046518 Ga0495631_0024408 Ga0495631_0024408_731_1060 109
958 3300046518 Ga0495631_0030286 Ga0495631_0030286_1726_2055 109
959 3300046518 Ga0495631_0047306 Ga0495631_0047306_72_401 109
960 3300046518 Ga0495631_0175573 Ga0495631_0175573_428_757 109
961 3300046518 Ga0495631_0277975 Ga0495631_0277975_13_342 109
962 3300046519 Ga0495632_0006130 Ga0495632_0006130_4835_5164 109
963 3300046519 Ga0495632_0006981 Ga0495632_0006981_5038_5367 109
964 3300046519 Ga0495632_0007851 Ga0495632_0007851_4739_5068 109
965 3300046519 Ga0495632_0038866 Ga0495632_0038866_523_852 109
966 3300046519 Ga0495632_0054897 Ga0495632_0054897_52_381 109
967 3300046519 Ga0495632_0059273 Ga0495632_0059273_1198_1527 109
968 3300046519 Ga0495632_0085924 Ga0495632_0085924_731_1060 109
969 3300046519 Ga0495632_0237222 Ga0495632_0237222_401_730 109
970 3300046519 Ga0495632_0471166 Ga0495632_0471166_111_440 109
971 3300046520 Ga0495637_0005605 Ga0495637_0005605_2776_3105 109
972 3300046520 Ga0495637_0011553 Ga0495637_0011553_1596_1925 109
973 3300046520 Ga0495637_0013587 Ga0495637_0013587_2006_2335 109
974 3300046520 Ga0495637_0015066 Ga0495637_0015066_650_979 109
975 3300046520 Ga0495637_0016164 Ga0495637_0016164_1253_1582 109
976 3300046520 Ga0495637_0029129 Ga0495637_0029129_1551_1880 109
977 3300046520 Ga0495637_0044103 Ga0495637_0044103_530_859 109
978 3300046520 Ga0495637_0066593 Ga0495637_0066593_530_859 109
979 3300046520 Ga0495637_0101046 Ga0495637_0101046_365_694 109
980 3300046520 Ga0495637_0143858 Ga0495637_0143858_174_503 109
981 3300046522 Ga0495643_0014229 Ga0495643_0014229_3554_3883 109
982 3300046522 Ga0495643_0030455 Ga0495643_0030455_90_419 109
983 3300046522 Ga0495643_0074948 Ga0495643_0074948_501_830 109
984 3300046522 Ga0495643_0080477 Ga0495643_0080477_1352_1681 109
985 3300046522 Ga0495643_0156469 Ga0495643_0156469_530_859 109
986 3300046522 Ga0495643_0198434 Ga0495643_0198434_489_818 109
987 3300046522 Ga0495643_0249213 Ga0495643_0249213_15_344 109
988 3300046522 Ga0495643_0379628 Ga0495643_0379628_286_615 109
989 3300046523 Ga0495644_0067435 Ga0495644_0067435_150_479 109
990 3300046523 Ga0495644_0176274 Ga0495644_0176274_359_688 109
991 3300046523 Ga0495644_0401425 Ga0495644_0401425_118_447 109
992 3300046524 Ga0495648_0003237 Ga0495648_0003237_4222_4551 109
993 3300046524 Ga0495648_0006229 Ga0495648_0006229_3719_4048 109
994 3300046524 Ga0495648_0008767 Ga0495648_0008767_1896_2225 109
995 3300046524 Ga0495648_0027655 Ga0495648_0027655_2988_3317 109
996 3300046524 Ga0495648_0036639 Ga0495648_0036639_2121_2450 109
997 3300046524 Ga0495648_0051414 Ga0495648_0051414_310_639 109
998 3300046524 Ga0495648_0051615 Ga0495648_0051615_540_869 109
999 3300046524 Ga0495648_0062503 Ga0495648_0062503_305_634 109
1000 3300046524 Ga0495648_0105954 Ga0495648_0105954_883_1212 109
1001 3300046524 Ga0495648_0122100 Ga0495648_0122100_339_668 109
1002 3300046524 Ga0495648_0171523 Ga0495648_0171523_630_959 109
1003 3300046524 Ga0495648_0193086 Ga0495648_0193086_78_407 109
1004 3300046526 Ga0495666_0018221 Ga0495666_0018221_1883_2212 109
1005 3300046526 Ga0495666_0532493 Ga0495666_0532493_158_487 109
1006 3300046528 Ga0495642_0001384 Ga0495642_0001384_5828_6157 109
1007 3300046530 Ga0495654_0000784 Ga0495654_0000784_1669_1998 109
1008 3300046530 Ga0495654_0002404 Ga0495654_0002404_19_348 109
1009 3300046530 Ga0495654_0007972 Ga0495654_0007972_2514_2843 109
1010 3300046530 Ga0495654_0011513 Ga0495654_0011513_4127_4456 109
1011 3300046530 Ga0495654_0011693 Ga0495654_0011693_3409_3738 109
1012 3300046530 Ga0495654_0013416 Ga0495654_0013416_2380_2709 109
1013 3300046530 Ga0495654_0021368 Ga0495654_0021368_1666_1995 109
1014 3300046530 Ga0495654_0028240 Ga0495654_0028240_2228_2557 109
1015 3300046530 Ga0495654_0051346 Ga0495654_0051346_71_400 109
1016 3300046530 Ga0495654_0069414 Ga0495654_0069414_607_936 109
1017 3300046530 Ga0495654_0436540 Ga0495654_0436540_48_377 109
1018 3300046538 Ga0495609_0002842 Ga0495609_0002842_6920_7249 109
1019 3300046538 Ga0495609_0030820 Ga0495609_0030820_1226_1555 109
1020 3300046538 Ga0495609_0032378 Ga0495609_0032378_1391_1720 109
1021 3300046538 Ga0495609_0038569 Ga0495609_0038569_1534_1863 109
1022 3300046538 Ga0495609_0039190 Ga0495609_0039190_942_1271 109
1023 3300046538 Ga0495609_0081320 Ga0495609_0081320_926_1255 109
1024 3300046538 Ga0495609_0142674 Ga0495609_0142674_474_803 109
1025 3300046538 Ga0495609_0463732 Ga0495609_0463732_103_432 109
1026 3300046542 Ga0495597_0004663 Ga0495597_0004663_4573_4902 109
1027 3300046542 Ga0495597_0014599 Ga0495597_0014599_737_1066 109
1028 3300046542 Ga0495597_0015825 Ga0495597_0015825_2786_3115 109
1029 3300046542 Ga0495597_0015984 Ga0495597_0015984_774_1103 109
1030 3300046542 Ga0495597_0016157 Ga0495597_0016157_579_908 109
1031 3300046542 Ga0495597_0074979 Ga0495597_0074979_213_542 109
1032 3300046542 Ga0495597_0085190 Ga0495597_0085190_536_865 109
1033 3300046542 Ga0495597_0174376 Ga0495597_0174376_237_593 109
1034 3300046542 Ga0495597_0178997 Ga0495597_0178997_449_778 109
1035 3300046557 Ga0495622_0003035 Ga0495622_0003035_3371_3700 109
1036 3300046557 Ga0495622_0007144 Ga0495622_0007144_4325_4654 109
1037 3300046557 Ga0495622_0016658 Ga0495622_0016658_2599_2928 109
1038 3300046557 Ga0495622_0046066 Ga0495622_0046066_666_995 109
1039 3300046557 Ga0495622_0053658 Ga0495622_0053658_477_806 109
1040 3300046558 Ga0495633_0009956 Ga0495633_0009956_2497_2826 109
1041 3300046558 Ga0495633_0021631 Ga0495633_0021631_2423_2752 109
1042 3300046558 Ga0495633_0359058 Ga0495633_0359058_162_491 109
1043 3300046616 Ga0495668_0045577 Ga0495668_0045577_2068_2397 109
1044 3300046642 Ga0495634_0005604 Ga0495634_0005604_5862_6191 109
1045 3300046648 Ga0495611_0004298 Ga0495611_0004298_3072_3401 109
1046 3300046648 Ga0495611_0261548 Ga0495611_0261548_77_406 109
1047 3300046660 Ga0495625_0018258 Ga0495625_0018258_515_853 109
1048 3300046660 Ga0495625_0038836 Ga0495625_0038836_1658_1987 109
1049 3300046660 Ga0495625_0058557 Ga0495625_0058557_2376_2705 109
1050 3300046660 Ga0495625_0058870 Ga0495625_0058870_602_931 109
1051 3300046660 Ga0495625_0106245 Ga0495625_0106245_277_606 109
1052 3300046663 Ga0495635_0007473 Ga0495635_0007473_2663_2992 109
1053 3300046664 Ga0495659_0015676 Ga0495659_0015676_1878_2207 109
1054 3300046665 Ga0495661_0002196 Ga0495661_0002196_7194_7523 109
1055 3300046665 Ga0495661_0003095 Ga0495661_0003095_1437_1766 109
1056 3300046665 Ga0495661_0029738 Ga0495661_0029738_1907_2236 109
1057 3300046665 Ga0495661_0059224 Ga0495661_0059224_1555_1884 109
1058 3300046665 Ga0495661_0063119 Ga0495661_0063119_122_451 109
1059 3300046665 Ga0495661_0245484 Ga0495661_0245484_479_808 109
1060 3300046679 Ga0495623_0021747 Ga0495623_0021747_862_1191 109
1061 3300046679 Ga0495623_0063065 Ga0495623_0063065_1252_1581 109
1062 3300046680 Ga0495646_0004545 Ga0495646_0004545_2559_2888 109
1063 3300046680 Ga0495646_0269496 Ga0495646_0269496_485_814 109
1064 3300046684 Ga0495669_0004912 Ga0495669_0004912_2407_2736 109
1065 3300046689 Ga0495613_0039865 Ga0495613_0039865_536_865 109
1066 3300046691 Ga0495670_0002237 Ga0495670_0002237_5447_5776 109
1067 3300046691 Ga0495670_0017224 Ga0495670_0017224_2687_3016 109
1068 3300046691 Ga0495670_0031511 Ga0495670_0031511_611_940 109
1069 3300046691 Ga0495670_0071587 Ga0495670_0071587_998_1327 109
1070 3300046691 Ga0495670_0584722 Ga0495670_0584722_158_487 109
1071 3300046692 Ga0495671_0006661 Ga0495671_0006661_1189_1518 109
1072 3300046692 Ga0495671_0009549 Ga0495671_0009549_3426_3755 109
1073 3300046692 Ga0495671_0015385 Ga0495671_0015385_475_804 109
1074 3300046692 Ga0495671_0015940 Ga0495671_0015940_2603_2932 109
1075 3300046692 Ga0495671_0023109 Ga0495671_0023109_1190_1519 109
1076 3300046692 Ga0495671_0035567 Ga0495671_0035567_1793_2122 109
1077 3300046692 Ga0495671_0037044 Ga0495671_0037044_497_826 109
1078 3300046692 Ga0495671_0044765 Ga0495671_0044765_73_402 109
1079 3300046692 Ga0495671_0068470 Ga0495671_0068470_1381_1710 109
1080 3300046692 Ga0495671_0174216 Ga0495671_0174216_619_948 109
1081 3300046692 Ga0495671_0202090 Ga0495671_0202090_88_417 109
1082 3300046694 Ga0495649_0002103 Ga0495649_0002103_13631_13960 109
1083 3300046694 Ga0495649_0009685 Ga0495649_0009685_3863_4192 109
1084 3300046694 Ga0495649_0011065 Ga0495649_0011065_2421_2750 109
1085 3300046694 Ga0495649_0072621 Ga0495649_0072621_1364_1693 109
1086 3300046694 Ga0495649_0104174 Ga0495649_0104174_711_1040 109
1087 3300046694 Ga0495649_0152929 Ga0495649_0152929_526_855 109
1088 3300046694 Ga0495649_0257811 Ga0495649_0257811_64_393 109
1089 3300046694 Ga0495649_0280949 Ga0495649_0280949_444_773 109
1090 3300046694 Ga0495649_0294823 Ga0495649_0294823_105_434 109
1091 3300046694 Ga0495649_0322026 Ga0495649_0322026_378_707 109
1092 3300046694 Ga0495649_0420409 Ga0495649_0420409_87_416 109
1093 3300046794 Ga0495589_0005488 Ga0495589_0005488_1877_2206 109
1094 3300046794 Ga0495589_0011437 Ga0495589_0011437_3425_3754 109
1095 3300046794 Ga0495589_0014865 Ga0495589_0014865_3119_3448 109
1096 3300046794 Ga0495589_0027550 Ga0495589_0027550_436_765 109
1097 3300046810 Ga0495660_0004723 Ga0495660_0004723_7657_7986 109
1098 3300046810 Ga0495660_0014871 Ga0495660_0014871_561_890 109
1099 3300046810 Ga0495660_0015205 Ga0495660_0015205_2712_3041 109
1100 3300046810 Ga0495660_0015618 Ga0495660_0015618_2398_2727 109
1101 3300046810 Ga0495660_0016909 Ga0495660_0016909_696_1025 109
1102 3300046810 Ga0495660_0023372 Ga0495660_0023372_1025_1354 109
1103 3300046810 Ga0495660_0025680 Ga0495660_0025680_1718_2047 109
1104 3300046810 Ga0495660_0030921 Ga0495660_0030921_27_356 109
1105 3300046810 Ga0495660_0048115 Ga0495660_0048115_305_634 109
1106 3300046810 Ga0495660_0049343 Ga0495660_0049343_1512_1841 109
1107 3300046810 Ga0495660_0094356 Ga0495660_0094356_476_805 109
1108 3300046810 Ga0495660_0360870 Ga0495660_0360870_109_438 109
1109 3300046810 Ga0495660_0450211 Ga0495660_0450211_78_407 109
1110 3300047315 Ga0495581_0016703 Ga0495581_0016703_1956_2285 109
1111 3300047317 Ga0495604_0005474 Ga0495604_0005474_7174_7503 109
1112 3300047317 Ga0495604_0332902 Ga0495604_0332902_87_416 109
1113 3300047318 Ga0495636_0002017 Ga0495636_0002017_1967_2296 109
1114 3300047318 Ga0495636_0361412 Ga0495636_0361412_21_350 109
1115 3300047319 Ga0495674_0057529 Ga0495674_0057529_3004_3333 109
1116 3300047320 Ga0495672_0001771 Ga0495672_0001771_103_432 109
1117 3300047320 Ga0495672_0006315 Ga0495672_0006315_860_1189 109
1118 3300047320 Ga0495672_0012012 Ga0495672_0012012_3378_3707 109
1119 3300047320 Ga0495672_0023525 Ga0495672_0023525_2771_3100 109
1120 3300047320 Ga0495672_0026101 Ga0495672_0026101_2571_2900 109
1121 3300047320 Ga0495672_0095014 Ga0495672_0095014_887_1216 109
1122 3300047320 Ga0495672_0102384 Ga0495672_0102384_1044_1373 109
1123 3300047321 Ga0495676_0042527 Ga0495676_0042527_764_1093 109
1124 3300047322 Ga0495680_0033240 Ga0495680_0033240_805_1134 109
1125 3300047322 Ga0495680_0050082 Ga0495680_0050082_601_930 109
1126 3300047322 Ga0495680_0076006 Ga0495680_0076006_476_805 109
1127 3300047323 Ga0495683_0000519 Ga0495683_0000519_2985_3314 109
1128 3300047323 Ga0495683_0032444 Ga0495683_0032444_573_902 109
1129 3300047323 Ga0495683_0046212 Ga0495683_0046212_1757_2086 109
1130 3300047323 Ga0495683_0319425 Ga0495683_0319425_99_428 109
1131 3300047323 Ga0495683_0375692 Ga0495683_0375692_214_543 109
1132 3300047443 Ga0495687_001197 Ga0495687_001197_23441_23797 109
1133 3300047443 Ga0495687_008493 Ga0495687_008493_3403_3732 109
1134 3300047443 Ga0495687_132992 Ga0495687_132992_481_810 109
1135 3300047444 Ga0495675_0187607 Ga0495675_0187607_277_606 109
1136 3300047445 Ga0495677_0219662 Ga0495677_0219662_313_642 109
1137 3300047446 Ga0495679_000621 Ga0495679_000621_1446_1775 109
1138 3300047446 Ga0495679_009776 Ga0495679_009776_990_1319 109
1139 3300047446 Ga0495679_010978 Ga0495679_010978_2699_3028 109
1140 3300047446 Ga0495679_017869 Ga0495679_017869_494_823 109
1141 3300047446 Ga0495679_074556 Ga0495679_074556_134_463 109
1142 3300047469 Ga0495673_0001975 Ga0495673_0001975_5022_5351 109
1143 3300047469 Ga0495673_0002348 Ga0495673_0002348_1375_1704 109
1144 3300047469 Ga0495673_0006797 Ga0495673_0006797_3298_3627 109
1145 3300047469 Ga0495673_0007690 Ga0495673_0007690_2607_2936 109
1146 3300047469 Ga0495673_0013648 Ga0495673_0013648_523_852 109
1147 3300047469 Ga0495673_0016425 Ga0495673_0016425_1448_1777 109
1148 3300047469 Ga0495673_0021703 Ga0495673_0021703_2436_2765 109
1149 3300047469 Ga0495673_0037347 Ga0495673_0037347_224_553 109
1150 3300047470 Ga0495681_0000621 Ga0495681_0000621_5662_5991 109
1151 3300047470 Ga0495681_0006679 Ga0495681_0006679_6512_6841 109
1152 3300047470 Ga0495681_0007930 Ga0495681_0007930_3261_3590 109
1153 3300047470 Ga0495681_0010809 Ga0495681_0010809_3315_3644 109
1154 3300047470 Ga0495681_0013817 Ga0495681_0013817_1528_1857 109
1155 3300047470 Ga0495681_0025808 Ga0495681_0025808_2687_3016 109
1156 3300047470 Ga0495681_0040419 Ga0495681_0040419_94_423 109
1157 3300047470 Ga0495681_0060219 Ga0495681_0060219_741_1070 109
1158 3300047470 Ga0495681_0140931 Ga0495681_0140931_499_828 109
1159 3300047471 Ga0495684_0057665 Ga0495684_0057665_392_721 109
1160 3300047472 Ga0495686_0011662 Ga0495686_0011662_5400_5729 109
1161 3300047472 Ga0495686_0028247 Ga0495686_0028247_3233_3562 109
1162 3300047472 Ga0495686_0058119 Ga0495686_0058119_557_886 109
1163 3300047673 Ga0495593_0015578 Ga0495593_0015578_2467_2796 109
1164 3300048088 Ga0495602_0058351 Ga0495602_0058351_494_823 109
1165 3300048091 Ga0495626_0000781 Ga0495626_0000781_8229_8558 109
1166 3300048091 Ga0495626_0001420 Ga0495626_0001420_14638_14967 109
1167 3300048091 Ga0495626_0014922 Ga0495626_0014922_435_764 109
1168 3300048091 Ga0495626_0029367 Ga0495626_0029367_1760_2089 109
1169 3300048091 Ga0495626_0038983 Ga0495626_0038983_1497_1826 109
1170 3300048091 Ga0495626_0070542 Ga0495626_0070542_845_1174 109
1171 3300048091 Ga0495626_0080914 Ga0495626_0080914_562_891 109
1172 3300048091 Ga0495626_0146617 Ga0495626_0146617_103_432 109
1173 3300048905 Ga0496102_0006862 Ga0496102_0006862_5759_6088 109
1174 3300048906 Ga0496103_0003992 Ga0496103_0003992_5375_5704 109
1175 3300048913 Ga0496110_0854144 Ga0496110_0854144_314_643 109
1176 3300048914 Ga0496111_0180419 Ga0496111_0180419_999_1328 109
1177 3300048915 Ga0496112_0261879 Ga0496112_0261879_950_1279 109
1178 3300048918 Ga0496115_1448611 Ga0496115_1448611_41_370 109
1179 3300048919 Ga0496116_0000085 Ga0496116_0000085_183752_184081 109
1180 3300048919 Ga0496116_0015452 Ga0496116_0015452_2665_2994 109
1181 3300048919 Ga0496116_0026674 Ga0496116_0026674_684_1013 109
1182 3300048919 Ga0496116_0136720 Ga0496116_0136720_884_1213 109
1183 3300048919 Ga0496116_0204606 Ga0496116_0204606_146_475 109
1184 3300048920 Ga0496117_0001083 Ga0496117_0001083_25877_26206 109
1185 3300048920 Ga0496117_0008157 Ga0496117_0008157_6000_6329 109
1186 3300048920 Ga0496117_0023516 Ga0496117_0023516_3051_3380 109
1187 3300048920 Ga0496117_0037465 Ga0496117_0037465_1839_2168 109
1188 3300048920 Ga0496117_0042455 Ga0496117_0042455_54_383 109
1189 3300048920 Ga0496117_0255767 Ga0496117_0255767_124_453 109
1190 3300048921 Ga0496118_0010079 Ga0496118_0010079_212_541 109
1191 3300048921 Ga0496118_0013576 Ga0496118_0013576_7082_7411 109
1192 3300048921 Ga0496118_0017227 Ga0496118_0017227_3137_3466 109
1193 3300048921 Ga0496118_0034320 Ga0496118_0034320_1047_1376 109
1194 3300048921 Ga0496118_0077732 Ga0496118_0077732_1496_1825 109
1195 3300048922 Ga0496119_0023660 Ga0496119_0023660_3918_4247 109
1196 3300048922 Ga0496119_0128944 Ga0496119_0128944_898_1227 109
1197 3300048922 Ga0496119_0162752 Ga0496119_0162752_723_1052 109
1198 3300048923 Ga0496120_0007999 Ga0496120_0007999_4089_4418 109
1199 3300048923 Ga0496120_0014080 Ga0496120_0014080_1058_1387 109
1200 3300048923 Ga0496120_0023314 Ga0496120_0023314_1194_1523 109
1201 3300048924 Ga0496121_0000505 Ga0496121_0000505_38805_39134 109
1202 3300048924 Ga0496121_0023128 Ga0496121_0023128_3045_3374 109
1203 3300048924 Ga0496121_0106897 Ga0496121_0106897_125_454 109
1204 3300048924 Ga0496121_0272838 Ga0496121_0272838_149_478 109
1205 3300048925 Ga0496122_0016161 Ga0496122_0016161_3656_3985 109
1206 3300048925 Ga0496122_0085139 Ga0496122_0085139_981_1310 109
1207 3300048926 Ga0496123_0006202 Ga0496123_0006202_5282_5611 109
1208 3300048926 Ga0496123_0029384 Ga0496123_0029384_873_1202 109
1209 3300048927 Ga0496124_0010005 Ga0496124_0010005_3354_3683 109
1210 3300048927 Ga0496124_0033056 Ga0496124_0033056_1374_1703 109
1211 3300048927 Ga0496124_0105664 Ga0496124_0105664_752_1081 109
1212 3300048927 Ga0496124_0154721 Ga0496124_0154721_529_858 109
1213 3300048927 Ga0496124_0231892 Ga0496124_0231892_816_1145 109
1214 3300048928 Ga0496125_0009460 Ga0496125_0009460_3674_4003 109
1215 3300048928 Ga0496125_0037515 Ga0496125_0037515_3568_3897 109
1216 3300048928 Ga0496125_0045252 Ga0496125_0045252_1658_1987 109
1217 3300048928 Ga0496125_0048393 Ga0496125_0048393_233_562 109
1218 3300048928 Ga0496125_0053638 Ga0496125_0053638_2757_3086 109
1219 3300048929 Ga0496126_0065462 Ga0496126_0065462_2480_2809 109
1220 3300049459 Ga0495678_003644 Ga0495678_003644_5380_5709 109
1221 3300049459 Ga0495678_008634 Ga0495678_008634_15_344 109
1222 3300049459 Ga0495678_025493 Ga0495678_025493_1801_2130 109
1223 3300049459 Ga0495678_026553 Ga0495678_026553_773_1102 109
1224 3300049459 Ga0495678_040255 Ga0495678_040255_56_385 109
1225 3300049459 Ga0495678_053273 Ga0495678_053273_576_905 109
1226 3300049459 Ga0495678_135496 Ga0495678_135496_321_650 109
1227 3300049459 Ga0495678_225402 Ga0495678_225402_133_462 109
1228 3300049460 Ga0495682_0001329 Ga0495682_0001329_3592_3921 109
1229 3300049460 Ga0495682_0013257 Ga0495682_0013257_387_716 109
1230 3300049460 Ga0495682_0250408 Ga0495682_0250408_38_367 109
1231 3300049460 Ga0495682_0369401 Ga0495682_0369401_121_450 109
1232 3300050491 nmdc:mga00v17_36416_c1 nmdc:mga00v17_36416_c1_2540_2869 109
1233 3300050491 nmdc:mga00v17_528181_c1 nmdc:mga00v17_528181_c1_355_684 109
1234 3300050514 nmdc:mga08x19_26948_c1 nmdc:mga08x19_26948_c1_1549_1878 109
1235 3300053111 Ga0500572_008391 Ga0500572_008391_1690_2019 109
1236 3300053161 Ga0500634_0001481 Ga0500634_0001481_7563_7892 109

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01312

Bac_export_2

FlhB HrpN YscU SpaS Family

4

79

0.95

Feature Viewer

pLDDT pTM Quality
48.19 0.27 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map