F492018

General Info

Members Datasets Scaffolds Average Seq Length
1233 260 1233 302

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0031391|Ga0466967_0031391_2055_2969
Length 297
Sequence MPVETIDRLAEELKAESARVRADVDNFFARLLAPTGDSRERLYEAMRHAAIGGGKRLRPLLTIAASRLFAIDAERALRVGCAIEAVHVYSLIHDDLPCMDNADLRRGKLTVHKAFGEAEAVLAGDSLHALAFDILAHAATHDDPFVRNELVLELARAAGPQGMAGGQMMDLAAEAITRLQQLKTGALIEYSVEAACIMAKLPTEARTPYRGYARAIGLAFQIADDLIDHSGDAAAAGKPTGRDANAGKATFVSLLGEERARQQADFLVDQAIEHLSGHGSEADLLRAIARFAIERDH

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
184 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
185 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
186 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
187 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
204 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
205 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
206 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
207 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
208 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
209 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
210 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
215 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
216 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
217 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
225 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
226 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
227 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
230 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
231 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
249 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
250 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
251 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
257 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
258 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
259 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
260 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 5.19
Rhizosphere 94.16
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1003018 3300001915 Bacteria 4176
2 JGI24741J21665_1004177 3300001915 Bacteria 3258
3 JGI24740J21852_10001349 3300001979 Bacteria 11187
4 JGI24740J21852_10008408 3300001979 Bacteria 4112
5 JGI24739J22299_10004194 3300001989 Bacteria 5515
6 JGI24739J22299_10007463 3300001989 Bacteria 4101
7 JGI24737J22298_10000104 3300001990 Bacteria 25388
8 JGI24737J22298_10000336 3300001990 Bacteria 15727
9 JGI24737J22298_10007128 3300001990 Bacteria 3787
10 JGI24737J22298_10039754 3300001990 Bacteria 1445
11 JGI24735J21928_10001242 3300002067 Bacteria 9053
12 JGI24735J21928_10009681 3300002067 Bacteria 3087
13 JGI24735J21928_10035649 3300002067 Bacteria 1461
14 JGI24738J21930_10000383 3300002075 Bacteria 12309
15 JGI24744J21845_10000207 3300002077 Bacteria 9153
16 Ga0070658_10000154 3300005327 Bacteria 60560
17 Ga0070658_10007616 3300005327 Bacteria 8731
18 Ga0070658_10018026 3300005327 Bacteria 5646
19 Ga0070658_10031224 3300005327 Bacteria 4277
20 Ga0070658_10065514 3300005327 Bacteria 2965
21 Ga0070658_10079969 3300005327 Bacteria 2684
22 Ga0070658_10135521 3300005327 Bacteria 2054
23 Ga0070658_10160331 3300005327 Bacteria 1887
24 Ga0070658_10198579 3300005327 Bacteria 1692
25 Ga0070658_10219002 3300005327 Bacteria 1609
26 Ga0070658_10267382 3300005327 Bacteria 1453
27 Ga0070658_10531185 3300005327 Bacteria 1017
28 Ga0070676_10000859 3300005328 Bacteria 14958
29 Ga0070676_10000958 3300005328 Bacteria 14349
30 Ga0070676_10161015 3300005328 Bacteria 1444
31 Ga0070683_100006563 3300005329 Bacteria 9770
32 Ga0070683_100015278 3300005329 Bacteria 6741
33 Ga0070683_100149316 3300005329 Bacteria 2216
34 Ga0070683_100220777 3300005329 Bacteria 1801
35 Ga0070683_100279139 3300005329 Bacteria 1589
36 Ga0070690_100026517 3300005330 Bacteria 3575
37 Ga0070690_100072043 3300005330 Bacteria 2246
38 Ga0070690_100259441 3300005330 Bacteria 1232
39 Ga0070690_100300768 3300005330 Bacteria 1150
40 Ga0070670_100015694 3300005331 Bacteria 6501
41 Ga0070670_100025000 3300005331 Bacteria 5138
42 Ga0070670_100060663 3300005331 Bacteria 3247
43 Ga0070670_100212640 3300005331 Bacteria 1681
44 Ga0070670_100302445 3300005331 Bacteria 1399
45 Ga0070677_10035868 3300005333 Bacteria 1925
46 Ga0070677_10053565 3300005333 Bacteria 1641
47 Ga0070677_10059980 3300005333 Bacteria 1566
48 Ga0068869_100000775 3300005334 Bacteria 18199
49 Ga0070666_10004574 3300005335 Bacteria 8436
50 Ga0070666_10010482 3300005335 Bacteria 5799
51 Ga0070666_10038984 3300005335 Bacteria 3164
52 Ga0070666_10068344 3300005335 Bacteria 2414
53 Ga0070666_10183802 3300005335 Bacteria 1467
54 Ga0070680_100000628 3300005336 Bacteria 24555
55 Ga0070680_100000647 3300005336 Bacteria 24195
56 Ga0070680_100009749 3300005336 Bacteria 7392
57 Ga0070680_100010145 3300005336 Bacteria 7262
58 Ga0070680_100036669 3300005336 Bacteria 3962
59 Ga0070680_100118928 3300005336 Bacteria 2204
60 Ga0070680_100338369 3300005336 Bacteria 1279
61 Ga0070682_100050091 3300005337 Bacteria 2606
62 Ga0068868_100001843 3300005338 Bacteria 14558
63 Ga0068868_100004431 3300005338 Bacteria 9849
64 Ga0070660_100000284 3300005339 Bacteria 33712
65 Ga0070660_100000869 3300005339 Bacteria 20155
66 Ga0070660_100003772 3300005339 Bacteria 10473
67 Ga0070660_100010071 3300005339 Bacteria 6668
68 Ga0070660_100015745 3300005339 Bacteria 5469
69 Ga0070660_100035397 3300005339 Bacteria 3779
70 Ga0070660_100054576 3300005339 Bacteria 3086
71 Ga0070660_100134410 3300005339 Bacteria 1981
72 Ga0070660_100179233 3300005339 Bacteria 1714
73 Ga0070660_100190256 3300005339 Bacteria 1662
74 Ga0070660_100216532 3300005339 Bacteria 1556
75 Ga0070660_100387780 3300005339 Bacteria 1154
76 Ga0070689_100013624 3300005340 Bacteria 5889
77 Ga0070691_10000763 3300005341 Bacteria 12747
78 Ga0070661_100000195 3300005344 Bacteria 50203
79 Ga0070661_100015407 3300005344 Bacteria 5396
80 Ga0070661_100020750 3300005344 Bacteria 4686
81 Ga0070661_100022812 3300005344 Bacteria 4482
82 Ga0070661_100024157 3300005344 Bacteria 4359
83 Ga0070661_100041711 3300005344 Bacteria 3349
84 Ga0070661_100056132 3300005344 Bacteria 2885
85 Ga0070661_100066999 3300005344 Bacteria 2638
86 Ga0070661_100165099 3300005344 Bacteria 1679
87 Ga0070661_100241427 3300005344 Bacteria 1391
88 Ga0070661_100277185 3300005344 Bacteria 1300
89 Ga0070661_100317332 3300005344 Bacteria 1216
90 Ga0070661_100478110 3300005344 Bacteria 994
91 Ga0070692_10006130 3300005345 Bacteria 5195
92 Ga0070692_10028975 3300005345 Bacteria 2757
93 Ga0070692_10040297 3300005345 Bacteria 2388
94 Ga0070668_100001286 3300005347 Bacteria 17955
95 Ga0070668_100021509 3300005347 Bacteria 4873
96 Ga0070668_100134118 3300005347 Bacteria 1990
97 Ga0070668_100160389 3300005347 Bacteria 1824
98 Ga0070669_100000196 3300005353 Bacteria 53682
99 Ga0070669_100026244 3300005353 Bacteria 4190
100 Ga0070669_100120814 3300005353 Bacteria 1999
101 Ga0070675_100177780 3300005354 Bacteria 1839
102 Ga0070675_100219931 3300005354 Bacteria 1654
103 Ga0070671_100004097 3300005355 Bacteria 11508
104 Ga0070671_100004402 3300005355 Bacteria 11135
105 Ga0070671_100020224 3300005355 Bacteria 5426
106 Ga0070671_100028487 3300005355 Bacteria 4599
107 Ga0070671_100043806 3300005355 Bacteria 3719
108 Ga0070671_100077647 3300005355 Bacteria 2775
109 Ga0070671_100111200 3300005355 Bacteria 2301
110 Ga0070671_100399666 3300005355 Bacteria 1175
111 Ga0070674_100017838 3300005356 Bacteria 4473
112 Ga0070674_100240936 3300005356 Bacteria 1416
113 Ga0070674_100295993 3300005356 Bacteria 1288
114 Ga0070673_100004026 3300005364 Bacteria 9252
115 Ga0070673_100018613 3300005364 Bacteria 4967
116 Ga0070673_100020191 3300005364 Bacteria 4801
117 Ga0070673_100024623 3300005364 Bacteria 4417
118 Ga0070673_100025378 3300005364 Bacteria 4361
119 Ga0070673_100025930 3300005364 Bacteria 4322
120 Ga0070673_100038050 3300005364 Bacteria 3671
121 Ga0070673_100177809 3300005364 Bacteria 1820
122 Ga0070673_100221283 3300005364 Bacteria 1638
123 Ga0070673_100244115 3300005364 Bacteria 1563
124 Ga0070673_100268375 3300005364 Bacteria 1493
125 Ga0070659_100002125 3300005366 Bacteria 14119
126 Ga0070659_100003347 3300005366 Bacteria 11401
127 Ga0070659_100005974 3300005366 Bacteria 8778
128 Ga0070659_100011358 3300005366 Bacteria 6585
129 Ga0070659_100011981 3300005366 Bacteria 6419
130 Ga0070659_100035537 3300005366 Bacteria 3880
131 Ga0070659_100043883 3300005366 Bacteria 3498
132 Ga0070659_100052732 3300005366 Bacteria 3199
133 Ga0070659_100079588 3300005366 Bacteria 2616
134 Ga0070659_100080865 3300005366 Bacteria 2595
135 Ga0070659_100087371 3300005366 Bacteria 2496
136 Ga0070659_100108950 3300005366 Bacteria 2235
137 Ga0070659_100112485 3300005366 Bacteria 2199
138 Ga0070659_100125137 3300005366 Bacteria 2085
139 Ga0070659_100137347 3300005366 Bacteria 1988
140 Ga0070659_100237364 3300005366 Bacteria 1508
141 Ga0070667_100007016 3300005367 Bacteria 9364
142 Ga0070667_100022481 3300005367 Bacteria 5230
143 Ga0070667_100038048 3300005367 Bacteria 4034
144 Ga0070667_100043386 3300005367 Bacteria 3774
145 Ga0070667_100172242 3300005367 Bacteria 1911
146 Ga0070667_100197410 3300005367 Bacteria 1784
147 Ga0070667_100237995 3300005367 Bacteria 1625
148 Ga0070667_100263655 3300005367 Bacteria 1543
149 Ga0070667_100457402 3300005367 Bacteria 1167
150 Ga0070709_10037136 3300005434 Bacteria 2973
151 Ga0070714_100031841 3300005435 Bacteria 4402
152 Ga0070714_100046761 3300005435 Bacteria 3673
153 Ga0070714_100332891 3300005435 Bacteria 1422
154 Ga0070713_100014363 3300005436 Bacteria 5878
155 Ga0070713_100049574 3300005436 Bacteria 3464
156 Ga0070694_100051216 3300005444 Bacteria 2786
157 Ga0070694_100214030 3300005444 Bacteria 1443
158 Ga0070663_100000199 3300005455 Bacteria 29919
159 Ga0070663_100024339 3300005455 Bacteria 4073
160 Ga0070663_100052497 3300005455 Bacteria 2907
161 Ga0070663_100082163 3300005455 Bacteria 2370
162 Ga0070663_100107220 3300005455 Bacteria 2094
163 Ga0070663_100126214 3300005455 Bacteria 1938
164 Ga0070663_100171858 3300005455 Bacteria 1676
165 Ga0070678_100001565 3300005456 Bacteria 12250
166 Ga0070678_100008600 3300005456 Bacteria 6119
167 Ga0070678_100019238 3300005456 Bacteria 4447
168 Ga0070678_100027353 3300005456 Bacteria 3871
169 Ga0070678_100107505 3300005456 Bacteria 2176
170 Ga0070662_100000049 3300005457 Bacteria 64630
171 Ga0070662_100000507 3300005457 Bacteria 23349
172 Ga0070662_100005871 3300005457 Bacteria 7879
173 Ga0070662_100027358 3300005457 Bacteria 3957
174 Ga0070662_100044799 3300005457 Bacteria 3171
175 Ga0070662_100046556 3300005457 Bacteria 3116
176 Ga0070662_100047746 3300005457 Bacteria 3081
177 Ga0070662_100048090 3300005457 Bacteria 3072
178 Ga0070662_100070464 3300005457 Bacteria 2576
179 Ga0070662_100075820 3300005457 Bacteria 2491
180 Ga0070662_100103914 3300005457 Bacteria 2155
181 Ga0070662_100177115 3300005457 Bacteria 1679
182 Ga0070681_10025826 3300005458 Bacteria 5906
183 Ga0070681_10065822 3300005458 Bacteria 3593
184 Ga0070681_10069647 3300005458 Bacteria 3484
185 Ga0070681_10447469 3300005458 Bacteria 1204
186 Ga0070681_10499187 3300005458 Bacteria 1130
187 Ga0070681_10522468 3300005458 Bacteria 1100
188 Ga0068867_100009423 3300005459 Bacteria 6887
189 Ga0068867_100012048 3300005459 Bacteria 6107
190 Ga0068867_100029493 3300005459 Bacteria 3953
191 Ga0068867_100068890 3300005459 Bacteria 2641
192 Ga0070679_100005648 3300005530 Bacteria 11594
193 Ga0070679_100033561 3300005530 Bacteria 5082
194 Ga0070679_100153616 3300005530 Bacteria 2278
195 Ga0070679_100290609 3300005530 Bacteria 1586
196 Ga0070679_100372499 3300005530 Bacteria 1375
197 Ga0070679_100431076 3300005530 Bacteria 1264
198 Ga0070679_100598637 3300005530 Bacteria 1046
199 Ga0070684_100002165 3300005535 Bacteria 14498
200 Ga0070684_100004255 3300005535 Bacteria 10845
201 Ga0070684_100036973 3300005535 Bacteria 4186
202 Ga0070684_100156893 3300005535 Bacteria 2064
203 Ga0068853_100000098 3300005539 Bacteria 59230
204 Ga0068853_100004186 3300005539 Bacteria 11126
205 Ga0068853_100035156 3300005539 Bacteria 4255
206 Ga0068853_100066503 3300005539 Bacteria 3130
207 Ga0068853_100098251 3300005539 Bacteria 2585
208 Ga0068853_100143516 3300005539 Bacteria 2144
209 Ga0068853_100428416 3300005539 Bacteria 1241
210 Ga0070672_100002144 3300005543 Bacteria 12458
211 Ga0070672_100006310 3300005543 Bacteria 7951
212 Ga0070672_100011514 3300005543 Bacteria 6170
213 Ga0070672_100141267 3300005543 Bacteria 1986
214 Ga0070672_100192696 3300005543 Bacteria 1702
215 Ga0070686_100046913 3300005544 Bacteria 2729
216 Ga0070695_100011571 3300005545 Bacteria 5279
217 Ga0070696_100003877 3300005546 Bacteria 9991
218 Ga0070696_100006531 3300005546 Bacteria 7787
219 Ga0070693_100001644 3300005547 Bacteria 10121
220 Ga0070693_100096568 3300005547 Bacteria 1792
221 Ga0070693_100119430 3300005547 Bacteria 1633
222 Ga0070693_100121626 3300005547 Bacteria 1620
223 Ga0070665_100002247 3300005548 Bacteria 21484
224 Ga0070665_100006682 3300005548 Bacteria 11728
225 Ga0070665_100007505 3300005548 Bacteria 11088
226 Ga0070665_100007683 3300005548 Bacteria 10953
227 Ga0070665_100685811 3300005548 Bacteria 1037
228 Ga0068855_100000546 3300005563 Bacteria 46150
229 Ga0068855_100018927 3300005563 Bacteria 8277
230 Ga0068855_100023345 3300005563 Bacteria 7407
231 Ga0068855_100063965 3300005563 Bacteria 4291
232 Ga0068855_100128428 3300005563 Bacteria 2896
233 Ga0068855_100169119 3300005563 Bacteria 2476
234 Ga0068855_100216320 3300005563 Bacteria 2151
235 Ga0068855_100228774 3300005563 Bacteria 2083
236 Ga0068855_100244327 3300005563 Bacteria 2004
237 Ga0068855_100296782 3300005563 Bacteria 1790
238 Ga0068855_100365624 3300005563 Bacteria 1587
239 Ga0068855_100433868 3300005563 Bacteria 1436
240 Ga0068855_100526004 3300005563 Bacteria 1282
241 Ga0070664_100000162 3300005564 Bacteria 46036
242 Ga0070664_100002252 3300005564 Bacteria 15524
243 Ga0070664_100003267 3300005564 Bacteria 13100
244 Ga0070664_100017302 3300005564 Bacteria 5919
245 Ga0070664_100017785 3300005564 Bacteria 5839
246 Ga0070664_100025951 3300005564 Bacteria 4857
247 Ga0070664_100033729 3300005564 Bacteria 4290
248 Ga0070664_100042269 3300005564 Bacteria 3848
249 Ga0070664_100081692 3300005564 Bacteria 2786
250 Ga0070664_100159111 3300005564 Bacteria 1997
251 Ga0070664_100205049 3300005564 Bacteria 1761
252 Ga0068857_100002224 3300005577 Bacteria 15802
253 Ga0068857_100007467 3300005577 Bacteria 9410
254 Ga0068857_100015202 3300005577 Bacteria 6716
255 Ga0068857_100022989 3300005577 Bacteria 5483
256 Ga0068857_100036242 3300005577 Bacteria 4371
257 Ga0068857_100168918 3300005577 Bacteria 1987
258 Ga0068854_100005206 3300005578 Bacteria 8205
259 Ga0068854_100029180 3300005578 Bacteria 3817
260 Ga0068854_100047339 3300005578 Bacteria 3064
261 Ga0068854_100092246 3300005578 Bacteria 2256
262 Ga0068854_100270349 3300005578 Bacteria 1364
263 Ga0068854_100504332 3300005578 Bacteria 1019
264 Ga0068856_100000788 3300005614 Bacteria 34349
265 Ga0068856_100019423 3300005614 Bacteria 6595
266 Ga0068856_100038942 3300005614 Bacteria 4668
267 Ga0068856_100182927 3300005614 Bacteria 2109
268 Ga0068856_100290455 3300005614 Bacteria 1652
269 Ga0068856_100444945 3300005614 Bacteria 1316
270 Ga0068856_100485933 3300005614 Bacteria 1256
271 Ga0068856_100610398 3300005614 Bacteria 1112
272 Ga0068852_100000425 3300005616 Bacteria 28106
273 Ga0068852_100001147 3300005616 Bacteria 17520
274 Ga0068852_100013294 3300005616 Bacteria 6296
275 Ga0068852_100018142 3300005616 Bacteria 5539
276 Ga0068852_100021306 3300005616 Bacteria 5172
277 Ga0068852_100021530 3300005616 Bacteria 5150
278 Ga0068852_100043318 3300005616 Bacteria 3817
279 Ga0068852_100049064 3300005616 Bacteria 3610
280 Ga0068852_100051429 3300005616 Bacteria 3535
281 Ga0068852_100058518 3300005616 Bacteria 3339
282 Ga0068852_100076587 3300005616 Bacteria 2954
283 Ga0068852_100086011 3300005616 Bacteria 2802
284 Ga0068852_100129819 3300005616 Bacteria 2319
285 Ga0068852_100145153 3300005616 Bacteria 2200
286 Ga0068852_100146505 3300005616 Bacteria 2191
287 Ga0068852_100148421 3300005616 Bacteria 2177
288 Ga0068852_100190841 3300005616 Bacteria 1933
289 Ga0068852_100226645 3300005616 Bacteria 1780
290 Ga0068852_100279301 3300005616 Bacteria 1609
291 Ga0068852_100404077 3300005616 Bacteria 1344
292 Ga0068852_100565020 3300005616 Bacteria 1139
293 Ga0068859_100010318 3300005617 Bacteria 9402
294 Ga0068859_100014394 3300005617 Bacteria 7938
295 Ga0068859_100019422 3300005617 Bacteria 6825
296 Ga0068859_100021440 3300005617 Bacteria 6485
297 Ga0068859_100030677 3300005617 Bacteria 5395
298 Ga0068859_100222778 3300005617 Bacteria 1974
299 Ga0068859_100543092 3300005617 Bacteria 1257
300 Ga0068864_100000078 3300005618 Bacteria 103622
301 Ga0068864_100000153 3300005618 Bacteria 63892
302 Ga0068864_100003538 3300005618 Bacteria 12921
303 Ga0068864_100004670 3300005618 Bacteria 11238
304 Ga0068864_100007271 3300005618 Bacteria 9106
305 Ga0068864_100028517 3300005618 Bacteria 4720
306 Ga0068864_100028619 3300005618 Bacteria 4712
307 Ga0068864_100035617 3300005618 Bacteria 4238
308 Ga0068864_100070649 3300005618 Bacteria 3038
309 Ga0068864_100224095 3300005618 Bacteria 1736
310 Ga0068864_100314667 3300005618 Bacteria 1469
311 Ga0068866_10001322 3300005718 Bacteria 10746
312 Ga0068861_100029147 3300005719 Bacteria 4035
313 Ga0068851_10005074 3300005834 Bacteria 5973
314 Ga0068851_10027636 3300005834 Bacteria 2797
315 Ga0068851_10053047 3300005834 Bacteria 2063
316 Ga0068851_10080628 3300005834 Bacteria 1699
317 Ga0068851_10200024 3300005834 Bacteria 1115
318 Ga0068870_10139303 3300005840 Bacteria 1418
319 Ga0068863_100002169 3300005841 Bacteria 19450
320 Ga0068863_100002816 3300005841 Bacteria 17218
321 Ga0068863_100004752 3300005841 Bacteria 13382
322 Ga0068863_100016990 3300005841 Bacteria 6978
323 Ga0068863_100033633 3300005841 Bacteria 4884
324 Ga0068863_100076334 3300005841 Bacteria 3170
325 Ga0068863_100081619 3300005841 Bacteria 3063
326 Ga0068863_100084627 3300005841 Bacteria 3005
327 Ga0068863_100126453 3300005841 Bacteria 2439
328 Ga0068863_100177811 3300005841 Bacteria 2042
329 Ga0068863_100370791 3300005841 Bacteria 1397
330 Ga0068863_100634723 3300005841 Bacteria 1059
331 Ga0068858_100000832 3300005842 Bacteria 32118
332 Ga0068858_100002274 3300005842 Bacteria 19431
333 Ga0068858_100006226 3300005842 Bacteria 11628
334 Ga0068858_100007735 3300005842 Bacteria 10371
335 Ga0068858_100011344 3300005842 Bacteria 8416
336 Ga0068858_100024957 3300005842 Bacteria 5563
337 Ga0068858_100026952 3300005842 Bacteria 5338
338 Ga0068858_100046718 3300005842 Bacteria 4013
339 Ga0068858_100093331 3300005842 Bacteria 2802
340 Ga0068860_100012870 3300005843 Bacteria 8223
341 Ga0068860_100072773 3300005843 Bacteria 3267
342 Ga0068860_100076230 3300005843 Bacteria 3189
343 Ga0068860_100131338 3300005843 Bacteria 2403
344 Ga0068860_100520379 3300005843 Bacteria 1189
345 Ga0068862_100003518 3300005844 Bacteria 13444
346 Ga0068862_100049579 3300005844 Bacteria 3587
347 Ga0068862_100068984 3300005844 Bacteria 3051
348 Ga0068862_100235407 3300005844 Bacteria 1663
349 Ga0081539_10043339 3300005985 Bacteria 2610
350 Ga0070717_10014056 3300006028 Bacteria 6153
351 Ga0070716_100196860 3300006173 Bacteria 1336
352 Ga0075366_10058856 3300006195 Bacteria 2283
353 Ga0097621_100002557 3300006237 Bacteria 12458
354 Ga0097621_100029704 3300006237 Bacteria 4320
355 Ga0097621_100109448 3300006237 Bacteria 2334
356 Ga0097621_100119814 3300006237 Bacteria 2231
357 Ga0097621_100145826 3300006237 Bacteria 2027
358 Ga0068871_100089442 3300006358 Bacteria 2563
359 Ga0068871_100100772 3300006358 Bacteria 2420
360 Ga0068865_100011285 3300006881 Bacteria 5588
361 Ga0068865_100024575 3300006881 Bacteria 3954
362 Ga0068865_100035074 3300006881 Bacteria 3371
363 Ga0068865_100114862 3300006881 Bacteria 1992
364 Ga0068865_100231647 3300006881 Bacteria 1449
365 Ga0068865_100408711 3300006881 Bacteria 1113
366 Ga0097620_100010318 3300006931 Bacteria 9402
367 Ga0097620_100014392 3300006931 Bacteria 7938
368 Ga0097620_100019422 3300006931 Bacteria 6825
369 Ga0097620_100021440 3300006931 Bacteria 6485
370 Ga0097620_100030677 3300006931 Bacteria 5395
371 Ga0097620_100222788 3300006931 Bacteria 1974
372 Ga0097620_100543193 3300006931 Bacteria 1257
373 Ga0105251_10040608 3300009011 Bacteria 2268
374 Ga0105250_10003931 3300009092 Bacteria 6938
375 Ga0105250_10073901 3300009092 Bacteria 1379
376 Ga0105240_10075745 3300009093 Bacteria 4150
377 Ga0105240_10172916 3300009093 Bacteria 2556
378 Ga0111539_10073522 3300009094 Bacteria 4030
379 Ga0105245_10000342 3300009098 Bacteria 43782
380 Ga0105245_10006243 3300009098 Bacteria 10483
381 Ga0105245_10091382 3300009098 Bacteria 2801
382 Ga0114129_10954250 3300009147 Bacteria 1083
383 Ga0105243_10181415 3300009148 Bacteria 1831
384 Ga0105241_10103401 3300009174 Bacteria 2268
385 Ga0105241_10194774 3300009174 Bacteria 1689
386 Ga0105242_10003633 3300009176 Bacteria 12007
387 Ga0105242_10352518 3300009176 Bacteria 1359
388 Ga0105248_10000544 3300009177 Bacteria 43036
389 Ga0105248_10002910 3300009177 Bacteria 18999
390 Ga0105248_10004523 3300009177 Bacteria 15387
391 Ga0105248_10014376 3300009177 Bacteria 8711
392 Ga0105248_10021075 3300009177 Bacteria 7222
393 Ga0105248_10023560 3300009177 Bacteria 6839
394 Ga0105248_10033496 3300009177 Bacteria 5739
395 Ga0105248_10033950 3300009177 Bacteria 5702
396 Ga0105248_10046730 3300009177 Bacteria 4853
397 Ga0105248_10069459 3300009177 Bacteria 3955
398 Ga0105248_10100816 3300009177 Bacteria 3254
399 Ga0105248_10178214 3300009177 Bacteria 2395
400 Ga0105237_10027692 3300009545 Bacteria 5779
401 Ga0105237_10030869 3300009545 Bacteria 5438
402 Ga0105237_10032851 3300009545 Bacteria 5253
403 Ga0105238_10020220 3300009551 Bacteria 6776
404 Ga0105238_10025509 3300009551 Bacteria 6026
405 Ga0105238_10056843 3300009551 Bacteria 3924
406 Ga0105249_10075864 3300009553 Bacteria 3114
407 Ga0105249_10393943 3300009553 Bacteria 1414
408 Ga0105249_10750577 3300009553 Bacteria 1038
409 Ga0105239_10028632 3300010375 Bacteria 6125
410 Ga0105239_10219152 3300010375 Bacteria 2134
411 Ga0105246_10076784 3300011119 Bacteria 2368
412 Ga0105246_10448503 3300011119 Bacteria 1084
413 Ga0157373_10010702 3300013100 Bacteria 6747
414 Ga0157373_10028624 3300013100 Bacteria 4019
415 Ga0157373_10049210 3300013100 Bacteria 3004
416 Ga0157373_10105650 3300013100 Bacteria 1980
417 Ga0157373_10200643 3300013100 Bacteria 1406
418 Ga0157371_10000612 3300013102 Bacteria 42458
419 Ga0157371_10013748 3300013102 Bacteria 6136
420 Ga0157371_10022569 3300013102 Bacteria 4607
421 Ga0157371_10054122 3300013102 Bacteria 2850
422 Ga0157371_10064799 3300013102 Bacteria 2589
423 Ga0157371_10065105 3300013102 Bacteria 2581
424 Ga0157371_10093453 3300013102 Bacteria 2131
425 Ga0157371_10094166 3300013102 Bacteria 2122
426 Ga0157371_10105412 3300013102 Bacteria 2000
427 Ga0157371_10145013 3300013102 Bacteria 1691
428 Ga0157371_10222745 3300013102 Bacteria 1355
429 Ga0157370_10001982 3300013104 Bacteria 25168
430 Ga0157370_10012302 3300013104 Bacteria 8881
431 Ga0157370_10156723 3300013104 Bacteria 2118
432 Ga0157370_10221388 3300013104 Bacteria 1753
433 Ga0157370_10261661 3300013104 Bacteria 1599
434 Ga0157370_10338485 3300013104 Bacteria 1387
435 Ga0157370_10552852 3300013104 Bacteria 1055
436 Ga0157369_10002495 3300013105 Bacteria 22057
437 Ga0157369_10005483 3300013105 Bacteria 14744
438 Ga0157369_10009057 3300013105 Bacteria 11398
439 Ga0157369_10068610 3300013105 Bacteria 3810
440 Ga0157369_10096842 3300013105 Bacteria 3147
441 Ga0157369_10196688 3300013105 Bacteria 2117
442 Ga0157369_10305602 3300013105 Bacteria 1654
443 Ga0157369_10334291 3300013105 Bacteria 1574
444 Ga0157369_10416922 3300013105 Bacteria 1392
445 Ga0157369_10592465 3300013105 Bacteria 1145
446 Ga0157374_10030191 3300013296 Bacteria 4918
447 Ga0157374_10070052 3300013296 Bacteria 3303
448 Ga0157374_10312086 3300013296 Bacteria 1557
449 Ga0157378_10001183 3300013297 Bacteria 23705
450 Ga0157378_10033143 3300013297 Bacteria 4566
451 Ga0157378_10226806 3300013297 Bacteria 1778
452 Ga0163162_10004990 3300013306 Bacteria 12790
453 Ga0163162_10010754 3300013306 Bacteria 8903
454 Ga0163162_10073515 3300013306 Bacteria 3474
455 Ga0163162_10158974 3300013306 Bacteria 2381
456 Ga0163162_10159127 3300013306 Bacteria 2380
457 Ga0163162_10194538 3300013306 Bacteria 2156
458 Ga0163162_10378722 3300013306 Bacteria 1548
459 Ga0157372_10085245 3300013307 Bacteria 3583
460 Ga0157372_10122516 3300013307 Bacteria 2988
461 Ga0157372_10182330 3300013307 Bacteria 2431
462 Ga0157372_10202554 3300013307 Bacteria 2299
463 Ga0157372_10226889 3300013307 Bacteria 2165
464 Ga0157372_10361242 3300013307 Bacteria 1692
465 Ga0157375_10021110 3300013308 Bacteria 5964
466 Ga0157375_10023031 3300013308 Bacteria 5741
467 Ga0157375_10035911 3300013308 Bacteria 4735
468 Ga0157375_10068189 3300013308 Bacteria 3558
469 Ga0157375_10117860 3300013308 Bacteria 2761
470 Ga0157375_10434193 3300013308 Bacteria 1479
471 Ga0163163_10000258 3300014325 Bacteria 53627
472 Ga0163163_10028898 3300014325 Bacteria 5329
473 Ga0163163_10029168 3300014325 Bacteria 5307
474 Ga0163163_10136615 3300014325 Bacteria 2493
475 Ga0163163_10151215 3300014325 Bacteria 2365
476 Ga0157377_10014511 3300014745 Bacteria 4010
477 Ga0157379_10002519 3300014968 Bacteria 15338
478 Ga0157379_10034380 3300014968 Bacteria 4520
479 Ga0157379_10080677 3300014968 Bacteria 2914
480 Ga0157379_10105672 3300014968 Bacteria 2527
481 Ga0157379_10154402 3300014968 Bacteria 2070
482 Ga0157376_10001235 3300014969 Bacteria 16843
483 Ga0206356_10496746 3300020070 Bacteria 1332
484 Ga0206356_10794718 3300020070 Bacteria 2159
485 Ga0206354_11003028 3300020081 Bacteria 1307
486 Ga0206354_11266106 3300020081 Bacteria 1064
487 Ga0206353_11434613 3300020082 Bacteria 1073
488 Ga0206353_11497196 3300020082 Bacteria 2294
489 Ga0206353_11507767 3300020082 Bacteria 1044
490 Ga0206353_12058462 3300020082 Bacteria 2674
491 Ga0213875_10002933 3300021388 Bacteria 9939
492 Ga0207697_10000132 3300025315 Bacteria 36064
493 Ga0207656_10006704 3300025321 Bacteria 4159
494 Ga0207656_10024786 3300025321 Bacteria 2429
495 Ga0207656_10123941 3300025321 Bacteria 1205
496 Ga0207696_1026678 3300025711 Bacteria 1785
497 Ga0207682_10011313 3300025893 Bacteria 3486
498 Ga0207682_10018969 3300025893 Bacteria 2692
499 Ga0207682_10029829 3300025893 Bacteria 2182
500 Ga0207642_10007833 3300025899 Bacteria 3628
501 Ga0207688_10000380 3300025901 Bacteria 20710
502 Ga0207688_10000937 3300025901 Bacteria 14744
503 Ga0207688_10025616 3300025901 Bacteria 3241
504 Ga0207688_10066300 3300025901 Bacteria 2042
505 Ga0207680_10000219 3300025903 Bacteria 27636
506 Ga0207680_10000459 3300025903 Bacteria 19207
507 Ga0207680_10002571 3300025903 Bacteria 8464
508 Ga0207680_10011268 3300025903 Bacteria 4512
509 Ga0207680_10022828 3300025903 Bacteria 3408
510 Ga0207680_10235710 3300025903 Bacteria 1259
511 Ga0207647_10000248 3300025904 Bacteria 44089
512 Ga0207647_10003591 3300025904 Bacteria 11626
513 Ga0207647_10005630 3300025904 Bacteria 9147
514 Ga0207647_10010619 3300025904 Bacteria 6494
515 Ga0207647_10019937 3300025904 Bacteria 4503
516 Ga0207647_10137511 3300025904 Bacteria 1433
517 Ga0207647_10176691 3300025904 Bacteria 1242
518 Ga0207647_10179585 3300025904 Bacteria 1230
519 Ga0207699_10148590 3300025906 Bacteria 1548
520 Ga0207699_10182285 3300025906 Bacteria 1412
521 Ga0207645_10001656 3300025907 Bacteria 18134
522 Ga0207645_10012042 3300025907 Bacteria 5881
523 Ga0207645_10015238 3300025907 Bacteria 5117
524 Ga0207645_10165096 3300025907 Bacteria 1449
525 Ga0207645_10284528 3300025907 Bacteria 1098
526 Ga0207643_10041300 3300025908 Bacteria 2599
527 Ga0207643_10204636 3300025908 Bacteria 1203
528 Ga0207705_10000285 3300025909 Bacteria 47658
529 Ga0207705_10000320 3300025909 Bacteria 43763
530 Ga0207705_10000330 3300025909 Bacteria 43029
531 Ga0207705_10030070 3300025909 Bacteria 3874
532 Ga0207705_10031278 3300025909 Bacteria 3797
533 Ga0207705_10032005 3300025909 Bacteria 3757
534 Ga0207705_10037294 3300025909 Bacteria 3478
535 Ga0207705_10051681 3300025909 Bacteria 2958
536 Ga0207705_10057951 3300025909 Bacteria 2795
537 Ga0207705_10069521 3300025909 Bacteria 2550
538 Ga0207705_10123567 3300025909 Bacteria 1922
539 Ga0207705_10124727 3300025909 Bacteria 1913
540 Ga0207705_10145573 3300025909 Bacteria 1772
541 Ga0207705_10150153 3300025909 Bacteria 1746
542 Ga0207684_10436031 3300025910 Bacteria 1125
543 Ga0207654_10057022 3300025911 Bacteria 2268
544 Ga0207654_10100380 3300025911 Bacteria 1782
545 Ga0207707_10008275 3300025912 Bacteria 9025
546 Ga0207707_10016497 3300025912 Bacteria 6440
547 Ga0207707_10028296 3300025912 Bacteria 4899
548 Ga0207707_10036989 3300025912 Bacteria 4265
549 Ga0207695_10038816 3300025913 Bacteria 5122
550 Ga0207695_10177477 3300025913 Bacteria 2052
551 Ga0207695_10248552 3300025913 Bacteria 1678
552 Ga0207695_10355015 3300025913 Bacteria 1353
553 Ga0207671_10182776 3300025914 Bacteria 1632
554 Ga0207660_10001110 3300025917 Bacteria 17977
555 Ga0207660_10002477 3300025917 Bacteria 12136
556 Ga0207660_10004291 3300025917 Bacteria 9301
557 Ga0207660_10038492 3300025917 Bacteria 3339
558 Ga0207660_10084695 3300025917 Bacteria 2337
559 Ga0207660_10118536 3300025917 Bacteria 2002
560 Ga0207660_10337728 3300025917 Bacteria 1205
561 Ga0207657_10001031 3300025919 Bacteria 29517
562 Ga0207657_10001361 3300025919 Bacteria 26052
563 Ga0207657_10001906 3300025919 Bacteria 22540
564 Ga0207657_10002839 3300025919 Bacteria 18611
565 Ga0207657_10004068 3300025919 Bacteria 15519
566 Ga0207657_10006395 3300025919 Bacteria 12232
567 Ga0207657_10010782 3300025919 Bacteria 9099
568 Ga0207657_10012964 3300025919 Bacteria 8196
569 Ga0207657_10014496 3300025919 Bacteria 7691
570 Ga0207657_10014520 3300025919 Bacteria 7681
571 Ga0207657_10020563 3300025919 Bacteria 6234
572 Ga0207657_10020823 3300025919 Bacteria 6188
573 Ga0207657_10021169 3300025919 Bacteria 6126
574 Ga0207657_10073222 3300025919 Bacteria 2896
575 Ga0207657_10085802 3300025919 Bacteria 2636
576 Ga0207657_10194249 3300025919 Bacteria 1636
577 Ga0207657_10195768 3300025919 Bacteria 1628
578 Ga0207657_10223348 3300025919 Bacteria 1508
579 Ga0207657_10232518 3300025919 Bacteria 1474
580 Ga0207649_10000128 3300025920 Bacteria 64425
581 Ga0207649_10006830 3300025920 Bacteria 6201
582 Ga0207649_10015845 3300025920 Bacteria 4238
583 Ga0207649_10021725 3300025920 Bacteria 3699
584 Ga0207649_10026939 3300025920 Bacteria 3368
585 Ga0207649_10041346 3300025920 Bacteria 2806
586 Ga0207649_10052302 3300025920 Bacteria 2534
587 Ga0207649_10061196 3300025920 Bacteria 2369
588 Ga0207649_10084708 3300025920 Bacteria 2061
589 Ga0207649_10115376 3300025920 Bacteria 1802
590 Ga0207649_10123702 3300025920 Bacteria 1747
591 Ga0207649_10149082 3300025920 Bacteria 1609
592 Ga0207649_10164051 3300025920 Bacteria 1542
593 Ga0207649_10246823 3300025920 Bacteria 1284
594 Ga0207649_10288216 3300025920 Bacteria 1196
595 Ga0207649_10381274 3300025920 Bacteria 1051
596 Ga0207652_10000356 3300025921 Bacteria 47404
597 Ga0207652_10034765 3300025921 Bacteria 4249
598 Ga0207652_10037349 3300025921 Bacteria 4111
599 Ga0207652_10064378 3300025921 Bacteria 3172
600 Ga0207652_10173103 3300025921 Bacteria 1938
601 Ga0207652_10306738 3300025921 Bacteria 1433
602 Ga0207681_10000250 3300025923 Bacteria 40821
603 Ga0207681_10001907 3300025923 Bacteria 13355
604 Ga0207681_10051078 3300025923 Bacteria 2800
605 Ga0207681_10052430 3300025923 Bacteria 2766
606 Ga0207681_10054598 3300025923 Bacteria 2717
607 Ga0207681_10244003 3300025923 Bacteria 1399
608 Ga0207694_10014118 3300025924 Bacteria 6022
609 Ga0207650_10015267 3300025925 Bacteria 5345
610 Ga0207650_10031065 3300025925 Bacteria 3854
611 Ga0207650_10039476 3300025925 Bacteria 3450
612 Ga0207650_10042919 3300025925 Bacteria 3318
613 Ga0207650_10109227 3300025925 Bacteria 2139
614 Ga0207659_10030476 3300025926 Bacteria 3687
615 Ga0207659_10049852 3300025926 Bacteria 2971
616 Ga0207659_10051748 3300025926 Bacteria 2923
617 Ga0207659_10139416 3300025926 Bacteria 1881
618 Ga0207659_10275147 3300025926 Bacteria 1375
619 Ga0207687_10003318 3300025927 Bacteria 10875
620 Ga0207687_10079455 3300025927 Bacteria 2365
621 Ga0207687_10110731 3300025927 Bacteria 2037
622 Ga0207700_10037863 3300025928 Bacteria 3496
623 Ga0207700_10148930 3300025928 Bacteria 1932
624 Ga0207700_10166989 3300025928 Bacteria 1832
625 Ga0207664_10036988 3300025929 Bacteria 3775
626 Ga0207664_10043687 3300025929 Bacteria 3507
627 Ga0207664_10044944 3300025929 Bacteria 3461
628 Ga0207664_10109037 3300025929 Bacteria 2300
629 Ga0207664_10147351 3300025929 Bacteria 1997
630 Ga0207664_10272938 3300025929 Bacteria 1482
631 Ga0207664_10624268 3300025929 Bacteria 968
632 Ga0207644_10000214 3300025931 Bacteria 39975
633 Ga0207644_10000377 3300025931 Bacteria 29090
634 Ga0207644_10006352 3300025931 Bacteria 7695
635 Ga0207644_10006437 3300025931 Bacteria 7653
636 Ga0207644_10006738 3300025931 Bacteria 7485
637 Ga0207644_10008630 3300025931 Bacteria 6668
638 Ga0207644_10010201 3300025931 Bacteria 6189
639 Ga0207644_10020550 3300025931 Bacteria 4490
640 Ga0207644_10031319 3300025931 Bacteria 3705
641 Ga0207644_10042700 3300025931 Bacteria 3214
642 Ga0207644_10172072 3300025931 Bacteria 1691
643 Ga0207690_10000045 3300025932 Bacteria 116965
644 Ga0207690_10002794 3300025932 Bacteria 10532
645 Ga0207690_10007682 3300025932 Bacteria 6398
646 Ga0207690_10008018 3300025932 Bacteria 6270
647 Ga0207690_10009666 3300025932 Bacteria 5726
648 Ga0207690_10018992 3300025932 Bacteria 4221
649 Ga0207690_10050503 3300025932 Bacteria 2777
650 Ga0207690_10067960 3300025932 Bacteria 2446
651 Ga0207690_10083036 3300025932 Bacteria 2242
652 Ga0207690_10144333 3300025932 Bacteria 1758
653 Ga0207690_10154992 3300025932 Bacteria 1702
654 Ga0207706_10000161 3300025933 Bacteria 75202
655 Ga0207706_10000660 3300025933 Bacteria 36291
656 Ga0207706_10005341 3300025933 Bacteria 11974
657 Ga0207706_10013172 3300025933 Bacteria 7526
658 Ga0207706_10015619 3300025933 Bacteria 6861
659 Ga0207706_10044324 3300025933 Bacteria 3943
660 Ga0207706_10047492 3300025933 Bacteria 3798
661 Ga0207706_10048436 3300025933 Bacteria 3758
662 Ga0207706_10051570 3300025933 Bacteria 3632
663 Ga0207706_10059505 3300025933 Bacteria 3364
664 Ga0207706_10062580 3300025933 Bacteria 3277
665 Ga0207706_10111158 3300025933 Bacteria 2410
666 Ga0207706_10252246 3300025933 Bacteria 1541
667 Ga0207686_10013436 3300025934 Bacteria 4532
668 Ga0207686_10299484 3300025934 Bacteria 1194
669 Ga0207709_10269904 3300025935 Bacteria 1251
670 Ga0207670_10119020 3300025936 Bacteria 1916
671 Ga0207669_10003979 3300025937 Bacteria 6457
672 Ga0207669_10005841 3300025937 Bacteria 5566
673 Ga0207669_10020706 3300025937 Bacteria 3455
674 Ga0207669_10033958 3300025937 Bacteria 2885
675 Ga0207669_10072003 3300025937 Bacteria 2174
676 Ga0207669_10152696 3300025937 Bacteria 1620
677 Ga0207669_10159791 3300025937 Bacteria 1590
678 Ga0207669_10394220 3300025937 Bacteria 1082
679 Ga0207704_10001070 3300025938 Bacteria 12174
680 Ga0207704_10071079 3300025938 Bacteria 2207
681 Ga0207704_10081623 3300025938 Bacteria 2092
682 Ga0207665_10131041 3300025939 Bacteria 1780
683 Ga0207691_10002277 3300025940 Bacteria 18791
684 Ga0207691_10002553 3300025940 Bacteria 17793
685 Ga0207691_10003283 3300025940 Bacteria 15755
686 Ga0207691_10028103 3300025940 Bacteria 5268
687 Ga0207691_10056363 3300025940 Bacteria 3579
688 Ga0207711_10000042 3300025941 Bacteria 158782
689 Ga0207711_10001092 3300025941 Bacteria 25881
690 Ga0207711_10002037 3300025941 Bacteria 18274
691 Ga0207711_10002492 3300025941 Bacteria 16434
692 Ga0207711_10003890 3300025941 Bacteria 12851
693 Ga0207711_10017046 3300025941 Bacteria 6034
694 Ga0207711_10028155 3300025941 Bacteria 4726
695 Ga0207711_10030261 3300025941 Bacteria 4566
696 Ga0207711_10043833 3300025941 Bacteria 3818
697 Ga0207711_10047359 3300025941 Bacteria 3675
698 Ga0207711_10053392 3300025941 Bacteria 3466
699 Ga0207711_10102611 3300025941 Bacteria 2532
700 Ga0207711_10210121 3300025941 Bacteria 1778
701 Ga0207711_10213348 3300025941 Bacteria 1764
702 Ga0207689_10000403 3300025942 Bacteria 40529
703 Ga0207689_10011314 3300025942 Bacteria 7656
704 Ga0207689_10011824 3300025942 Bacteria 7476
705 Ga0207661_10000187 3300025944 Bacteria 40098
706 Ga0207661_10013914 3300025944 Bacteria 5882
707 Ga0207661_10025443 3300025944 Bacteria 4499
708 Ga0207661_10042740 3300025944 Bacteria 3574
709 Ga0207661_10180286 3300025944 Bacteria 1844
710 Ga0207679_10000259 3300025945 Bacteria 40381
711 Ga0207679_10004653 3300025945 Bacteria 8544
712 Ga0207679_10032529 3300025945 Bacteria 3662
713 Ga0207679_10041360 3300025945 Bacteria 3305
714 Ga0207679_10077895 3300025945 Bacteria 2524
715 Ga0207679_10189779 3300025945 Bacteria 1707
716 Ga0207679_10254904 3300025945 Bacteria 1494
717 Ga0207667_10021125 3300025949 Bacteria 7220
718 Ga0207667_10023776 3300025949 Bacteria 6744
719 Ga0207667_10030112 3300025949 Bacteria 5874
720 Ga0207667_10090693 3300025949 Bacteria 3158
721 Ga0207667_10120462 3300025949 Bacteria 2704
722 Ga0207667_10201410 3300025949 Bacteria 2042
723 Ga0207667_10269028 3300025949 Bacteria 1742
724 Ga0207667_10437933 3300025949 Bacteria 1329
725 Ga0207651_10001209 3300025960 Bacteria 11557
726 Ga0207651_10001342 3300025960 Bacteria 11129
727 Ga0207651_10003812 3300025960 Bacteria 7472
728 Ga0207651_10011452 3300025960 Bacteria 4968
729 Ga0207651_10011759 3300025960 Bacteria 4912
730 Ga0207651_10085253 3300025960 Bacteria 2291
731 Ga0207651_10106403 3300025960 Bacteria 2094
732 Ga0207651_10143451 3300025960 Bacteria 1848
733 Ga0207712_10005619 3300025961 Bacteria 7910
734 Ga0207712_10117378 3300025961 Bacteria 2007
735 Ga0207668_10000021 3300025972 Bacteria 137592
736 Ga0207668_10013664 3300025972 Bacteria 5008
737 Ga0207668_10038134 3300025972 Bacteria 3222
738 Ga0207640_10000182 3300025981 Bacteria 45459
739 Ga0207640_10005537 3300025981 Bacteria 6881
740 Ga0207640_10024733 3300025981 Bacteria 3628
741 Ga0207640_10033059 3300025981 Bacteria 3213
742 Ga0207640_10046863 3300025981 Bacteria 2785
743 Ga0207640_10174431 3300025981 Bacteria 1606
744 Ga0207658_10002468 3300025986 Bacteria 13499
745 Ga0207658_10002571 3300025986 Bacteria 13185
746 Ga0207658_10007079 3300025986 Bacteria 7641
747 Ga0207658_10008860 3300025986 Bacteria 6827
748 Ga0207658_10009967 3300025986 Bacteria 6457
749 Ga0207658_10056825 3300025986 Bacteria 2906
750 Ga0207658_10071202 3300025986 Bacteria 2632
751 Ga0207658_10084860 3300025986 Bacteria 2438
752 Ga0207658_10111184 3300025986 Bacteria 2166
753 Ga0207658_10132817 3300025986 Bacteria 2002
754 Ga0207658_10487593 3300025986 Bacteria 1096
755 Ga0207677_10001023 3300026023 Bacteria 15394
756 Ga0207677_10009857 3300026023 Bacteria 5385
757 Ga0207677_10011080 3300026023 Bacteria 5125
758 Ga0207677_10504023 3300026023 Bacteria 1047
759 Ga0207703_10001404 3300026035 Bacteria 21944
760 Ga0207703_10004700 3300026035 Bacteria 11152
761 Ga0207703_10005215 3300026035 Bacteria 10503
762 Ga0207703_10011664 3300026035 Bacteria 6836
763 Ga0207703_10015254 3300026035 Bacteria 5995
764 Ga0207703_10026274 3300026035 Bacteria 4581
765 Ga0207703_10036004 3300026035 Bacteria 3936
766 Ga0207703_10045405 3300026035 Bacteria 3534
767 Ga0207703_10045541 3300026035 Bacteria 3529
768 Ga0207639_10000434 3300026041 Bacteria 28905
769 Ga0207639_10002074 3300026041 Bacteria 13509
770 Ga0207639_10003254 3300026041 Bacteria 10934
771 Ga0207639_10038123 3300026041 Bacteria 3573
772 Ga0207639_10044857 3300026041 Bacteria 3327
773 Ga0207639_10051972 3300026041 Bacteria 3120
774 Ga0207639_10062995 3300026041 Bacteria 2870
775 Ga0207639_10070294 3300026041 Bacteria 2734
776 Ga0207639_10195441 3300026041 Bacteria 1731
777 Ga0207639_10215327 3300026041 Bacteria 1656
778 Ga0207639_10232319 3300026041 Bacteria 1599
779 Ga0207678_10001604 3300026067 Bacteria 20809
780 Ga0207678_10003597 3300026067 Bacteria 13927
781 Ga0207678_10014296 3300026067 Bacteria 6978
782 Ga0207678_10015901 3300026067 Bacteria 6611
783 Ga0207678_10037051 3300026067 Bacteria 4245
784 Ga0207678_10062646 3300026067 Bacteria 3196
785 Ga0207678_10067448 3300026067 Bacteria 3071
786 Ga0207678_10068261 3300026067 Bacteria 3051
787 Ga0207678_10069542 3300026067 Bacteria 3018
788 Ga0207678_10076194 3300026067 Bacteria 2873
789 Ga0207678_10146274 3300026067 Bacteria 2017
790 Ga0207678_10158898 3300026067 Bacteria 1930
791 Ga0207678_10216509 3300026067 Bacteria 1639
792 Ga0207702_10000324 3300026078 Bacteria 54694
793 Ga0207702_10007017 3300026078 Bacteria 9635
794 Ga0207702_10007309 3300026078 Bacteria 9442
795 Ga0207702_10052596 3300026078 Bacteria 3447
796 Ga0207702_10140284 3300026078 Bacteria 2186
797 Ga0207702_10409677 3300026078 Bacteria 1309
798 Ga0207702_10428489 3300026078 Bacteria 1280
799 Ga0207702_10578612 3300026078 Bacteria 1101
800 Ga0207702_10613457 3300026078 Bacteria 1068
801 Ga0207641_10000626 3300026088 Bacteria 38602
802 Ga0207641_10008242 3300026088 Bacteria 8615
803 Ga0207641_10017421 3300026088 Bacteria 5880
804 Ga0207641_10030844 3300026088 Bacteria 4442
805 Ga0207641_10036947 3300026088 Bacteria 4077
806 Ga0207641_10043223 3300026088 Bacteria 3783
807 Ga0207641_10102971 3300026088 Bacteria 2518
808 Ga0207641_10122685 3300026088 Bacteria 2321
809 Ga0207641_10180156 3300026088 Bacteria 1935
810 Ga0207641_10245683 3300026088 Bacteria 1669
811 Ga0207641_10300794 3300026088 Bacteria 1515
812 Ga0207641_10350189 3300026088 Bacteria 1407
813 Ga0207648_10000857 3300026089 Bacteria 34281
814 Ga0207648_10003049 3300026089 Bacteria 17709
815 Ga0207648_10003494 3300026089 Bacteria 16462
816 Ga0207648_10019137 3300026089 Bacteria 6179
817 Ga0207648_10075208 3300026089 Bacteria 2944
818 Ga0207676_10000194 3300026095 Bacteria 53017
819 Ga0207676_10003816 3300026095 Bacteria 10650
820 Ga0207676_10006287 3300026095 Bacteria 8388
821 Ga0207676_10006503 3300026095 Bacteria 8259
822 Ga0207676_10018431 3300026095 Bacteria 5074
823 Ga0207676_10021255 3300026095 Bacteria 4761
824 Ga0207676_10042482 3300026095 Bacteria 3497
825 Ga0207676_10068673 3300026095 Bacteria 2835
826 Ga0207676_10080658 3300026095 Bacteria 2641
827 Ga0207674_10000322 3300026116 Bacteria 61051
828 Ga0207674_10000344 3300026116 Bacteria 59855
829 Ga0207674_10001626 3300026116 Bacteria 28919
830 Ga0207674_10003716 3300026116 Bacteria 18636
831 Ga0207674_10004951 3300026116 Bacteria 15912
832 Ga0207674_10010165 3300026116 Bacteria 10693
833 Ga0207674_10032002 3300026116 Bacteria 5520
834 Ga0207674_10063538 3300026116 Bacteria 3727
835 Ga0207674_10076735 3300026116 Bacteria 3349
836 Ga0207675_100045562 3300026118 Bacteria 4098
837 Ga0207675_100134977 3300026118 Bacteria 2341
838 Ga0207683_10000636 3300026121 Bacteria 32084
839 Ga0207683_10002836 3300026121 Bacteria 15133
840 Ga0207683_10013482 3300026121 Bacteria 6974
841 Ga0207683_10030752 3300026121 Bacteria 4654
842 Ga0207683_10047282 3300026121 Bacteria 3768
843 Ga0207683_10051628 3300026121 Bacteria 3603
844 Ga0207683_10059873 3300026121 Bacteria 3346
845 Ga0207698_10000527 3300026142 Bacteria 22215
846 Ga0207698_10000780 3300026142 Bacteria 18515
847 Ga0207698_10007780 3300026142 Bacteria 6734
848 Ga0207698_10008400 3300026142 Bacteria 6529
849 Ga0207698_10011485 3300026142 Bacteria 5747
850 Ga0207698_10011537 3300026142 Bacteria 5734
851 Ga0207698_10013046 3300026142 Bacteria 5467
852 Ga0207698_10016480 3300026142 Bacteria 4982
853 Ga0207698_10018573 3300026142 Bacteria 4741
854 Ga0207698_10026214 3300026142 Bacteria 4120
855 Ga0207698_10035886 3300026142 Bacteria 3632
856 Ga0207698_10072707 3300026142 Bacteria 2734
857 Ga0207698_10083226 3300026142 Bacteria 2589
858 Ga0207698_10143925 3300026142 Bacteria 2058
859 Ga0207698_10171417 3300026142 Bacteria 1911
860 Ga0207698_10181745 3300026142 Bacteria 1864
861 Ga0207698_10337608 3300026142 Bacteria 1418
862 Ga0207698_10587102 3300026142 Bacteria 1097
863 Ga0209983_1007430 3300027665 Bacteria 2246
864 Ga0209974_10018773 3300027876 Bacteria 2294
865 Ga0268266_10000600 3300028379 Bacteria 49251
866 Ga0268266_10013082 3300028379 Bacteria 7156
867 Ga0268266_10021573 3300028379 Bacteria 5486
868 Ga0268266_10045071 3300028379 Bacteria 3772
869 Ga0268266_10151062 3300028379 Bacteria 2093
870 Ga0268266_10365409 3300028379 Bacteria 1358
871 Ga0268265_10143799 3300028380 Bacteria 2000
872 Ga0268265_10165074 3300028380 Bacteria 1886
873 Ga0268265_10265860 3300028380 Bacteria 1527
874 Ga0268264_10004576 3300028381 Bacteria 11775
875 Ga0268264_10004618 3300028381 Bacteria 11705
876 Ga0268264_10017268 3300028381 Bacteria 5912
877 Ga0268264_10128678 3300028381 Bacteria 2241
878 Ga0268264_10205951 3300028381 Bacteria 1803
879 Ga0307408_100022504 3300031548 Bacteria 4283
880 Ga0307408_100203345 3300031548 Bacteria 1605
881 Ga0307408_100471101 3300031548 Bacteria 1093
882 Ga0307405_10053667 3300031731 Bacteria 2512
883 Ga0307405_10144718 3300031731 Bacteria 1663
884 Ga0307405_10181506 3300031731 Bacteria 1511
885 Ga0307413_10008267 3300031824 Bacteria 4900
886 Ga0307413_10199872 3300031824 Bacteria 1443
887 Ga0307413_10292252 3300031824 Bacteria 1231
888 Ga0307410_10002245 3300031852 Bacteria 9229
889 Ga0307410_10014471 3300031852 Bacteria 4643
890 Ga0307410_10060530 3300031852 Bacteria 2588
891 Ga0307410_10100521 3300031852 Bacteria 2072
892 Ga0307410_10117689 3300031852 Bacteria 1932
893 Ga0307406_10058404 3300031901 Bacteria 2479
894 Ga0307406_10085071 3300031901 Bacteria 2113
895 Ga0307407_10044947 3300031903 Bacteria 2492
896 Ga0307407_10053977 3300031903 Bacteria 2315
897 Ga0307407_10081298 3300031903 Bacteria 1960
898 Ga0307407_10177319 3300031903 Bacteria 1409
899 Ga0307412_10088581 3300031911 Bacteria 2159
900 Ga0307412_10102812 3300031911 Bacteria 2024
901 Ga0307412_10528877 3300031911 Bacteria 986
902 Ga0307409_100097121 3300031995 Bacteria 2432
903 Ga0307409_100185966 3300031995 Bacteria 1844
904 Ga0307409_100283484 3300031995 Bacteria 1532
905 Ga0307409_100371263 3300031995 Bacteria 1357
906 Ga0307409_100419830 3300031995 Bacteria 1283
907 Ga0307416_100055345 3300032002 Bacteria 3194
908 Ga0307416_100063883 3300032002 Bacteria 3017
909 Ga0307416_100340902 3300032002 Bacteria 1511
910 Ga0307414_10023363 3300032004 Bacteria 3921
911 Ga0307414_10099967 3300032004 Bacteria 2180
912 Ga0307414_10131772 3300032004 Bacteria 1942
913 Ga0307414_10152794 3300032004 Bacteria 1823
914 Ga0307414_10339785 3300032004 Bacteria 1285
915 Ga0307411_10013123 3300032005 Bacteria 4556
916 Ga0307411_10015399 3300032005 Bacteria 4294
917 Ga0307411_10039899 3300032005 Bacteria 2974
918 Ga0307411_10125268 3300032005 Bacteria 1867
919 Ga0307411_10366097 3300032005 Bacteria 1181
920 Ga0307415_100036319 3300032126 Bacteria 3227
921 Ga0307415_100051385 3300032126 Bacteria 2797
922 Ga0307415_100075503 3300032126 Bacteria 2385
923 Ga0373940_0026166 3300035088 Bacteria 1525
924 Ga0373949_0017027 3300035090 Bacteria 1635
925 Ga0373932_0038841 3300035112 Bacteria 1363
926 Ga0373953_0089308 3300035117 Bacteria 1288
927 Ga0373960_0012655 3300035121 Bacteria 2100
928 Ga0373943_0004324 3300035170 Bacteria 6444
929 Ga0373943_0174803 3300035170 Bacteria 1177
930 Ga0373946_0005985 3300035171 Bacteria 4411
931 Ga0373955_0095908 3300035172 Bacteria 1697
932 Ga0373935_0011883 3300035692 Bacteria 5231
933 Ga0373927_0070397 3300035695 Bacteria 2264
934 Ga0373933_0037910 3300035724 Bacteria 2830
935 Ga0373947_0021481 3300035725 Bacteria 3736
936 Ga0373925_0152695 3300037068 Bacteria 1814
937 Ga0395899_0000372 3300037312 Bacteria 53863
938 Ga0395899_0013913 3300037312 Bacteria 6144
939 Ga0395899_0018782 3300037312 Bacteria 5252
940 Ga0395899_0019836 3300037312 Bacteria 5101
941 Ga0395899_0021544 3300037312 Bacteria 4887
942 Ga0395899_0029932 3300037312 Bacteria 4097
943 Ga0395899_0037136 3300037312 Bacteria 3652
944 Ga0395899_0042075 3300037312 Bacteria 3411
945 Ga0395899_0109639 3300037312 Bacteria 1986
946 Ga0395899_0117337 3300037312 Bacteria 1909
947 Ga0395899_0131240 3300037312 Bacteria 1788
948 Ga0395899_0131279 3300037312 Bacteria 1788
949 Ga0395899_0184269 3300037312 Bacteria 1464
950 Ga0395899_0218378 3300037312 Bacteria 1321
951 Ga0395899_0218421 3300037312 Bacteria 1321
952 Ga0395899_0221206 3300037312 Bacteria 1311
953 Ga0395899_0221232 3300037312 Bacteria 1311
954 Ga0395900_0000240 3300037418 Bacteria 86222
955 Ga0395900_0000703 3300037418 Bacteria 44559
956 Ga0395900_0000764 3300037418 Bacteria 42836
957 Ga0395900_0006967 3300037418 Bacteria 11719
958 Ga0395900_0009569 3300037418 Bacteria 9934
959 Ga0395900_0009815 3300037418 Bacteria 9808
960 Ga0395900_0020505 3300037418 Bacteria 6748
961 Ga0395900_0032467 3300037418 Bacteria 5369
962 Ga0395900_0042039 3300037418 Bacteria 4708
963 Ga0395900_0044017 3300037418 Bacteria 4601
964 Ga0395900_0056244 3300037418 Bacteria 4050
965 Ga0395900_0071287 3300037418 Bacteria 3572
966 Ga0395900_0079644 3300037418 Bacteria 3366
967 Ga0395900_0081537 3300037418 Bacteria 3323
968 Ga0395900_0091720 3300037418 Bacteria 3121
969 Ga0395900_0092843 3300037418 Bacteria 3101
970 Ga0395900_0102061 3300037418 Bacteria 2946
971 Ga0395900_0137072 3300037418 Bacteria 2507
972 Ga0395900_0152416 3300037418 Bacteria 2361
973 Ga0395900_0160818 3300037418 Bacteria 2290
974 Ga0395900_0187187 3300037418 Bacteria 2101
975 Ga0395900_0231957 3300037418 Bacteria 1856
976 Ga0395900_0237976 3300037418 Bacteria 1827
977 Ga0395900_0259671 3300037418 Bacteria 1735
978 Ga0395900_0337455 3300037418 Bacteria 1483
979 Ga0395900_0341846 3300037418 Bacteria 1472
980 Ga0395900_0385472 3300037418 Bacteria 1369
981 Ga0395900_0387058 3300037418 Bacteria 1365
982 Ga0395900_0411012 3300037418 Bacteria 1315
983 Ga0395900_0433922 3300037418 Bacteria 1272
984 Ga0395900_0571202 3300037418 Bacteria 1073
985 Ga0395900_0665828 3300037418 Bacteria 977
986 Ga0395898_0000619 3300037466 Bacteria 65174
987 Ga0395898_0007467 3300037466 Bacteria 11608
988 Ga0395898_0021463 3300037466 Bacteria 6548
989 Ga0395898_0028931 3300037466 Bacteria 5553
990 Ga0395898_0035223 3300037466 Bacteria 4980
991 Ga0395898_0036491 3300037466 Bacteria 4880
992 Ga0395898_0058445 3300037466 Bacteria 3753
993 Ga0395898_0069323 3300037466 Bacteria 3411
994 Ga0395898_0083356 3300037466 Bacteria 3081
995 Ga0395898_0083630 3300037466 Bacteria 3076
996 Ga0395898_0098471 3300037466 Bacteria 2808
997 Ga0395898_0109907 3300037466 Bacteria 2643
998 Ga0395898_0188771 3300037466 Bacteria 1969
999 Ga0395898_0215520 3300037466 Bacteria 1831
1000 Ga0395898_0312873 3300037466 Bacteria 1498
1001 Ga0395898_0357967 3300037466 Bacteria 1391
1002 Ga0395898_0415302 3300037466 Bacteria 1282
1003 Ga0395898_0652404 3300037466 Bacteria 995
1004 Ga0395905_0000219 3300037471 Bacteria 87705
1005 Ga0395905_0000259 3300037471 Bacteria 79396
1006 Ga0395905_0000627 3300037471 Bacteria 47256
1007 Ga0395905_0002653 3300037471 Bacteria 19635
1008 Ga0395905_0003045 3300037471 Bacteria 18153
1009 Ga0395905_0004674 3300037471 Bacteria 14154
1010 Ga0395905_0013463 3300037471 Bacteria 7838
1011 Ga0395905_0014451 3300037471 Bacteria 7537
1012 Ga0395905_0017316 3300037471 Bacteria 6842
1013 Ga0395905_0017532 3300037471 Bacteria 6797
1014 Ga0395905_0019396 3300037471 Bacteria 6447
1015 Ga0395905_0021249 3300037471 Bacteria 6142
1016 Ga0395905_0021418 3300037471 Bacteria 6114
1017 Ga0395905_0026188 3300037471 Bacteria 5500
1018 Ga0395905_0027179 3300037471 Bacteria 5397
1019 Ga0395905_0033153 3300037471 Bacteria 4853
1020 Ga0395905_0034490 3300037471 Bacteria 4752
1021 Ga0395905_0044710 3300037471 Bacteria 4155
1022 Ga0395905_0051019 3300037471 Bacteria 3875
1023 Ga0395905_0089815 3300037471 Bacteria 2879
1024 Ga0395905_0091834 3300037471 Bacteria 2846
1025 Ga0395905_0110840 3300037471 Bacteria 2577
1026 Ga0395905_0119628 3300037471 Bacteria 2475
1027 Ga0395905_0132999 3300037471 Bacteria 2339
1028 Ga0395905_0140668 3300037471 Bacteria 2270
1029 Ga0395905_0148412 3300037471 Bacteria 2206
1030 Ga0395905_0156115 3300037471 Bacteria 2146
1031 Ga0395905_0228802 3300037471 Bacteria 1739
1032 Ga0395905_0252570 3300037471 Bacteria 1647
1033 Ga0395905_0284811 3300037471 Bacteria 1539
1034 Ga0395905_0329802 3300037471 Bacteria 1416
1035 Ga0395905_0334313 3300037471 Bacteria 1405
1036 Ga0395905_0351894 3300037471 Bacteria 1365
1037 Ga0395905_0435956 3300037471 Bacteria 1207
1038 Ga0395905_0484828 3300037471 Bacteria 1136
1039 Ga0436364_0612163 3300037853 Bacteria 25384
1040 Ga0395901_0001641 3300038443 Bacteria 23129
1041 Ga0395901_0004422 3300038443 Bacteria 14177
1042 Ga0395901_0005146 3300038443 Bacteria 13202
1043 Ga0395901_0009829 3300038443 Bacteria 9698
1044 Ga0395901_0028941 3300038443 Bacteria 5700
1045 Ga0395901_0074130 3300038443 Bacteria 3550
1046 Ga0395901_0074757 3300038443 Bacteria 3534
1047 Ga0395901_0081528 3300038443 Bacteria 3379
1048 Ga0395901_0107771 3300038443 Bacteria 2925
1049 Ga0395901_0111681 3300038443 Bacteria 2870
1050 Ga0395901_0118405 3300038443 Bacteria 2782
1051 Ga0395901_0119574 3300038443 Bacteria 2768
1052 Ga0395901_0129010 3300038443 Bacteria 2658
1053 Ga0395901_0155434 3300038443 Bacteria 2402
1054 Ga0395901_0163831 3300038443 Bacteria 2334
1055 Ga0395901_0167230 3300038443 Bacteria 2308
1056 Ga0395901_0175314 3300038443 Bacteria 2249
1057 Ga0395901_0180614 3300038443 Bacteria 2213
1058 Ga0395901_0183450 3300038443 Bacteria 2195
1059 Ga0395901_0216042 3300038443 Bacteria 2005
1060 Ga0395901_0360297 3300038443 Bacteria 1499
1061 Ga0395901_0373544 3300038443 Bacteria 1468
1062 Ga0395901_0405330 3300038443 Bacteria 1400
1063 Ga0395901_0409533 3300038443 Bacteria 1392
1064 Ga0395901_0489377 3300038443 Bacteria 1253
1065 Ga0395901_0507157 3300038443 Bacteria 1227
1066 Ga0395901_0562349 3300038443 Bacteria 1154
1067 Ga0395901_0711719 3300038443 Bacteria 1001
1068 Ga0436365_0174261 3300039437 Bacteria 27738
1069 Ga0439448_0002960 3300042005 Bacteria 4660
1070 Ga0439432_023802 3300042006 Bacteria 2015
1071 Ga0450905_001171 3300042142 Bacteria 3319
1072 Ga0439458_0000559 3300042157 Bacteria 9582
1073 Ga0439458_0001765 3300042157 Bacteria 5384
1074 Ga0439464_0000922 3300042439 Bacteria 6596
1075 Ga0466969_0022242 3300044656 Bacteria 3274
1076 Ga0466972_0027337 3300044658 Bacteria 2823
1077 Ga0466972_0112403 3300044658 Bacteria 1287
1078 Ga0466965_0040933 3300044683 Bacteria 2282
1079 Ga0466965_0091099 3300044683 Bacteria 1551
1080 Ga0466966_0003928 3300044684 Bacteria 9816
1081 Ga0466966_0036123 3300044684 Bacteria 3191
1082 Ga0466966_0176589 3300044684 Bacteria 1297
1083 Ga0466961_0011363 3300044693 Bacteria 5693
1084 Ga0466961_0028348 3300044693 Bacteria 3600
1085 Ga0466961_0056257 3300044693 Bacteria 2506
1086 Ga0466961_0100218 3300044693 Bacteria 1825
1087 Ga0466963_0003301 3300044694 Bacteria 9202
1088 Ga0466963_0006667 3300044694 Bacteria 6858
1089 Ga0466963_0015006 3300044694 Bacteria 4788
1090 Ga0466963_0022983 3300044694 Bacteria 3954
1091 Ga0466963_0024760 3300044694 Bacteria 3822
1092 Ga0466963_0034218 3300044694 Bacteria 3305
1093 Ga0466963_0039949 3300044694 Bacteria 3074
1094 Ga0466963_0067971 3300044694 Bacteria 2392
1095 Ga0466963_0084830 3300044694 Bacteria 2149
1096 Ga0466963_0105742 3300044694 Bacteria 1929
1097 Ga0466963_0325193 3300044694 Bacteria 1082
1098 Ga0466964_0032722 3300044706 Bacteria 2068
1099 Ga0466964_0088652 3300044706 Bacteria 1342
1100 Ga0466964_0093637 3300044706 Bacteria 1312
1101 Ga0466971_0032249 3300044719 Bacteria 2347
1102 Ga0466971_0033255 3300044719 Bacteria 2311
1103 Ga0466971_0042871 3300044719 Bacteria 2034
1104 Ga0466968_0082148 3300044735 Bacteria 1417
1105 Ga0466970_0095793 3300044765 Bacteria 1614
1106 Ga0466957_0002027 3300044842 Bacteria 10800
1107 Ga0466957_0002685 3300044842 Bacteria 9613
1108 Ga0466957_0009688 3300044842 Bacteria 5501
1109 Ga0466957_0010471 3300044842 Bacteria 5328
1110 Ga0466957_0071501 3300044842 Bacteria 2146
1111 Ga0466957_0077279 3300044842 Bacteria 2068
1112 Ga0466957_0144447 3300044842 Bacteria 1535
1113 Ga0466957_0216235 3300044842 Bacteria 1264
1114 Ga0466957_0234605 3300044842 Bacteria 1216
1115 Ga0466957_0320798 3300044842 Bacteria 1045
1116 Ga0466960_0025899 3300044901 Bacteria 2659
1117 Ga0466959_0013667 3300045049 Bacteria 5890
1118 Ga0466959_0068216 3300045049 Bacteria 2577
1119 Ga0466959_0084882 3300045049 Bacteria 2279
1120 Ga0466959_0174095 3300045049 Bacteria 1508
1121 Ga0466959_0182553 3300045049 Bacteria 1467
1122 Ga0466958_0025243 3300045836 Bacteria 3502
1123 Ga0466958_0028463 3300045836 Bacteria 3313
1124 Ga0466958_0072792 3300045836 Bacteria 2105
1125 Ga0466958_0078150 3300045836 Bacteria 2033
1126 Ga0466967_0000381 3300045976 Bacteria 20628
1127 Ga0466967_0003611 3300045976 Bacteria 10158
1128 Ga0466967_0007454 3300045976 Bacteria 7893
1129 Ga0466967_0015627 3300045976 Bacteria 5956
1130 Ga0466967_0019455 3300045976 Bacteria 5459
1131 Ga0466967_0031391 3300045976 Bacteria 4472
1132 Ga0466967_0037136 3300045976 Bacteria 4165
1133 Ga0466967_0063233 3300045976 Bacteria 3288
1134 Ga0466967_0100305 3300045976 Bacteria 2645
1135 Ga0466967_0103000 3300045976 Bacteria 2612
1136 Ga0466967_0111042 3300045976 Bacteria 2519
1137 Ga0466967_0134300 3300045976 Bacteria 2300
1138 Ga0466967_0182249 3300045976 Bacteria 1981
1139 Ga0466967_0594890 3300045976 Bacteria 1091
1140 Ga0495580_0133007 3300046472 Bacteria 1725
1141 Ga0495663_0055456 3300046525 Bacteria 1236
1142 Ga0495654_0211477 3300046530 Bacteria 825
1143 Ga0495598_0003591 3300046537 Bacteria 3306
1144 Ga0495621_0005957 3300046539 Bacteria 3535
1145 Ga0495668_0006675 3300046616 Bacteria 7512
1146 Ga0495668_0017279 3300046616 Bacteria 4186
1147 Ga0495669_0000306 3300046684 Bacteria 27112
1148 Ga0495669_0007410 3300046684 Bacteria 4601
1149 Ga0495669_0023280 3300046684 Bacteria 2695
1150 Ga0495669_0039320 3300046684 Bacteria 2094
1151 Ga0495669_0056519 3300046684 Bacteria 1769
1152 Ga0495670_0018868 3300046691 Bacteria 3398
1153 Ga0495677_0072718 3300047445 Bacteria 1283
1154 Ga0495602_0155291 3300048088 Bacteria 1792
1155 Ga0496100_0005362 3300048903 Bacteria 6896
1156 Ga0496100_0038046 3300048903 Bacteria 3046
1157 Ga0496100_0137466 3300048903 Bacteria 1728
1158 Ga0496101_0001845 3300048904 Bacteria 12772
1159 Ga0496101_0007157 3300048904 Bacteria 7214
1160 Ga0496101_0089785 3300048904 Bacteria 2284
1161 Ga0496101_0146966 3300048904 Bacteria 1800
1162 Ga0496101_0464907 3300048904 Bacteria 998
1163 Ga0496102_0540707 3300048905 Bacteria 1088
1164 Ga0496104_0063254 3300048907 Bacteria 3509
1165 Ga0496104_0148252 3300048907 Bacteria 2253
1166 Ga0496104_0258463 3300048907 Bacteria 1654
1167 Ga0496105_0035375 3300048908 Bacteria 4111
1168 Ga0496105_0086958 3300048908 Bacteria 2583
1169 Ga0496106_0002590 3300048909 Bacteria 13463
1170 Ga0496106_0024920 3300048909 Bacteria 4448
1171 Ga0496106_0032636 3300048909 Bacteria 3883
1172 Ga0496107_0002051 3300048910 Bacteria 12880
1173 Ga0496107_0003122 3300048910 Bacteria 11018
1174 Ga0496107_0148044 3300048910 Bacteria 1736
1175 Ga0496108_0004931 3300048911 Bacteria 10782
1176 Ga0496108_0010742 3300048911 Bacteria 7433
1177 Ga0496108_0011705 3300048911 Bacteria 7137
1178 Ga0496108_0014779 3300048911 Bacteria 6372
1179 Ga0496108_0016413 3300048911 Bacteria 6039
1180 Ga0496108_0051888 3300048911 Bacteria 3435
1181 Ga0496108_0252026 3300048911 Bacteria 1536
1182 Ga0496109_0011964 3300048912 Bacteria 7472
1183 Ga0496109_0014535 3300048912 Bacteria 6847
1184 Ga0496109_0027613 3300048912 Bacteria 5070
1185 Ga0496109_0038420 3300048912 Bacteria 4327
1186 Ga0496109_0071775 3300048912 Bacteria 3180
1187 Ga0496109_0106396 3300048912 Bacteria 2605
1188 Ga0496109_0132943 3300048912 Bacteria 2323
1189 Ga0496109_0141271 3300048912 Bacteria 2251
1190 Ga0496109_0205886 3300048912 Bacteria 1850
1191 Ga0496110_0009431 3300048913 Bacteria 7906
1192 Ga0496110_0029480 3300048913 Bacteria 4724
1193 Ga0496110_0036846 3300048913 Bacteria 4249
1194 Ga0496110_0056128 3300048913 Bacteria 3466
1195 Ga0496110_0127609 3300048913 Bacteria 2295
1196 Ga0496111_0001035 3300048914 Bacteria 15288
1197 Ga0496111_0003669 3300048914 Bacteria 9535
1198 Ga0496111_0004529 3300048914 Bacteria 8794
1199 Ga0496111_0023837 3300048914 Bacteria 4300
1200 Ga0496111_0127951 3300048914 Bacteria 1878
1201 Ga0496112_0002414 3300048915 Bacteria 15049
1202 Ga0496112_0005570 3300048915 Bacteria 10917
1203 Ga0496112_0013316 3300048915 Bacteria 7592
1204 Ga0496112_0030618 3300048915 Bacteria 5210
1205 Ga0496112_0049292 3300048915 Bacteria 4128
1206 Ga0496112_0064162 3300048915 Bacteria 3624
1207 Ga0496112_0076688 3300048915 Bacteria 3306
1208 Ga0496112_0218483 3300048915 Bacteria 1862
1209 Ga0496112_0286192 3300048915 Bacteria 1595
1210 Ga0496112_0514119 3300048915 Bacteria 1132
1211 Ga0496113_0014613 3300048916 Bacteria 5363
1212 Ga0496113_0018400 3300048916 Bacteria 4865
1213 Ga0496113_0025796 3300048916 Bacteria 4195
1214 Ga0496113_0077172 3300048916 Bacteria 2546
1215 Ga0496114_0000206 3300048917 Bacteria 42865
1216 Ga0496114_0033866 3300048917 Bacteria 4211
1217 Ga0496114_0057548 3300048917 Bacteria 3246
1218 Ga0496115_0026126 3300048918 Bacteria 4554
1219 Ga0501067_0043758 3300049583 Bacteria 2487
1220 Ga0501257_085494 3300049686 Bacteria 817
1221 Ga0501221_010780 3300049704 Bacteria 1631
1222 Ga0501268_007562 3300049765 Bacteria 1623
1223 Ga0501044_0215498 3300049823 Bacteria 1873
1224 nmdc:mga08y16_94019_c1 3300050511 Bacteria 3123
1225 nmdc:mga0n895_170208_c1 3300050512 Bacteria 2210
1226 nmdc:mga0a205_6441_c1 3300050515 Bacteria 10612
1227 Ga0500597_007525 3300053120 Bacteria 3696
1228 Ga0500658_0000088 3300053134 Bacteria 42563
1229 Ga0500624_000008 3300053157 Bacteria 181801
1230 Ga0500637_0000037 3300053178 Bacteria 47475
1231 Ga0466962_0036472 3300061719 Bacteria 2353
1232 Ga0466962_0036981 3300061719 Bacteria 2336
1233 Ga0466962_0100113 3300061719 Bacteria 1392

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025906 Ga0207699_10182285 Ga0207699_101822853 253
2 3300046530 Ga0495654_0211477 Ga0495654_0211477_18_797 253
3 3300046684 Ga0495669_0039320 Ga0495669_0039320_1260_2039 253
4 3300025908 Ga0207643_10041300 Ga0207643_100413004 259
5 3300037418 Ga0395900_0092843 Ga0395900_0092843_21_800 259
6 3300037418 Ga0395900_0665828 Ga0395900_0665828_37_816 259
7 3300037466 Ga0395898_0215520 Ga0395898_0215520_16_795 259
8 3300044842 Ga0466957_0234605 Ga0466957_0234605_28_807 259
9 3300048917 Ga0496114_0057548 Ga0496114_0057548_2427_3206 259
10 3300049686 Ga0501257_085494 Ga0501257_085494_23_802 259
11 3300025907 Ga0207645_10284528 Ga0207645_102845282 261
12 3300002067 JGI24735J21928_10001242 JGI24735J21928_1000124210 286
13 3300005327 Ga0070658_10007616 Ga0070658_100076166 286
14 3300005327 Ga0070658_10079969 Ga0070658_100799692 286
15 3300005336 Ga0070680_100338369 Ga0070680_1003383691 286
16 3300005344 Ga0070661_100165099 Ga0070661_1001650992 286
17 3300005530 Ga0070679_100153616 Ga0070679_1001536162 286
18 3300005564 Ga0070664_100081692 Ga0070664_1000816921 286
19 3300005577 Ga0068857_100015202 Ga0068857_1000152025 286
20 3300005616 Ga0068852_100021306 Ga0068852_1000213062 286
21 3300005834 Ga0068851_10080628 Ga0068851_100806283 286
22 3300009545 Ga0105237_10030869 Ga0105237_100308696 286
23 3300009551 Ga0105238_10056843 Ga0105238_100568434 286
24 3300013105 Ga0157369_10002495 Ga0157369_100024955 286
25 3300025909 Ga0207705_10150153 Ga0207705_101501532 286
26 3300025912 Ga0207707_10008275 Ga0207707_100082752 286
27 3300025913 Ga0207695_10248552 Ga0207695_102485522 286
28 3300025917 Ga0207660_10337728 Ga0207660_103377282 286
29 3300025920 Ga0207649_10149082 Ga0207649_101490821 286
30 3300025921 Ga0207652_10037349 Ga0207652_100373495 286
31 3300025924 Ga0207694_10014118 Ga0207694_100141183 286
32 3300025981 Ga0207640_10046863 Ga0207640_100468631 286
33 3300026041 Ga0207639_10002074 Ga0207639_1000207412 286
34 3300026041 Ga0207639_10044857 Ga0207639_100448574 286
35 3300026078 Ga0207702_10578612 Ga0207702_105786121 286
36 3300026142 Ga0207698_10008400 Ga0207698_100084002 286
37 3300026142 Ga0207698_10035886 Ga0207698_100358864 286
38 3300045976 Ga0466967_0037136 Ga0466967_0037136_1589_2503 286
39 3300044842 Ga0466957_0320798 Ga0466957_0320798_108_1022 290
40 3300005614 Ga0068856_100290455 Ga0068856_1002904552 291
41 3300005616 Ga0068852_100565020 Ga0068852_1005650202 291
42 3300013102 Ga0157371_10065105 Ga0157371_100651052 291
43 3300013104 Ga0157370_10261661 Ga0157370_102616612 291
44 3300005366 Ga0070659_100079588 Ga0070659_1000795883 293
45 3300005444 Ga0070694_100214030 Ga0070694_1002140303 293
46 3300005457 Ga0070662_100044799 Ga0070662_1000447993 293
47 3300005545 Ga0070695_100011571 Ga0070695_1000115715 293
48 3300005546 Ga0070696_100006531 Ga0070696_1000065317 293
49 3300005563 Ga0068855_100365624 Ga0068855_1003656243 293
50 3300009094 Ga0111539_10073522 Ga0111539_100735224 293
51 3300009147 Ga0114129_10954250 Ga0114129_109542502 293
52 3300025910 Ga0207684_10436031 Ga0207684_104360311 293
53 3300025917 Ga0207660_10084695 Ga0207660_100846953 293
54 3300037471 Ga0395905_0091834 Ga0395905_0091834_1407_2288 293
55 3300042142 Ga0450905_001171 Ga0450905_001171_1530_2444 293
56 3300050511 nmdc:mga08y16_94019_c1 nmdc:mga08y16_94019_c1_809_1723 293
57 3300044683 Ga0466965_0091099 Ga0466965_0091099_549_1463 294
58 3300044693 Ga0466961_0100218 Ga0466961_0100218_640_1554 294
59 3300044694 Ga0466963_0003301 Ga0466963_0003301_4405_5319 294
60 3300044706 Ga0466964_0088652 Ga0466964_0088652_272_1186 294
61 3300044735 Ga0466968_0082148 Ga0466968_0082148_40_954 294
62 3300044842 Ga0466957_0009688 Ga0466957_0009688_2798_3712 294
63 3300044842 Ga0466957_0077279 Ga0466957_0077279_379_1293 294
64 3300045049 Ga0466959_0084882 Ga0466959_0084882_337_1251 294
65 3300045976 Ga0466967_0019455 Ga0466967_0019455_3035_3949 294
66 3300001979 JGI24740J21852_10001349 JGI24740J21852_100013493 295
67 3300002067 JGI24735J21928_10035649 JGI24735J21928_100356493 295
68 3300005327 Ga0070658_10160331 Ga0070658_101603313 295
69 3300005327 Ga0070658_10219002 Ga0070658_102190022 295
70 3300005329 Ga0070683_100006563 Ga0070683_1000065638 295
71 3300005335 Ga0070666_10183802 Ga0070666_101838022 295
72 3300005336 Ga0070680_100118928 Ga0070680_1001189283 295
73 3300005337 Ga0070682_100050091 Ga0070682_1000500913 295
74 3300005339 Ga0070660_100054576 Ga0070660_1000545762 295
75 3300005341 Ga0070691_10000763 Ga0070691_1000076312 295
76 3300005344 Ga0070661_100015407 Ga0070661_1000154075 295
77 3300005355 Ga0070671_100077647 Ga0070671_1000776473 295
78 3300005366 Ga0070659_100137347 Ga0070659_1001373472 295
79 3300005367 Ga0070667_100457402 Ga0070667_1004574021 295
80 3300005530 Ga0070679_100290609 Ga0070679_1002906092 295
81 3300005535 Ga0070684_100004255 Ga0070684_1000042557 295
82 3300005539 Ga0068853_100035156 Ga0068853_1000351565 295
83 3300005563 Ga0068855_100244327 Ga0068855_1002443273 295
84 3300005577 Ga0068857_100168918 Ga0068857_1001689183 295
85 3300005578 Ga0068854_100005206 Ga0068854_1000052067 295
86 3300005614 Ga0068856_100182927 Ga0068856_1001829273 295
87 3300005616 Ga0068852_100279301 Ga0068852_1002793012 295
88 3300005834 Ga0068851_10027636 Ga0068851_100276364 295
89 3300006237 Ga0097621_100119814 Ga0097621_1001198143 295
90 3300009093 Ga0105240_10075745 Ga0105240_100757452 295
91 3300009174 Ga0105241_10194774 Ga0105241_101947742 295
92 3300009177 Ga0105248_10100816 Ga0105248_101008162 295
93 3300009545 Ga0105237_10032851 Ga0105237_100328513 295
94 3300009551 Ga0105238_10025509 Ga0105238_100255094 295
95 3300013100 Ga0157373_10028624 Ga0157373_100286244 295
96 3300013104 Ga0157370_10221388 Ga0157370_102213883 295
97 3300013105 Ga0157369_10416922 Ga0157369_104169223 295
98 3300013307 Ga0157372_10085245 Ga0157372_100852455 295
99 3300020070 Ga0206356_10794718 Ga0206356_107947184 295
100 3300020081 Ga0206354_11266106 Ga0206354_112661061 295
101 3300020082 Ga0206353_11507767 Ga0206353_115077671 295
102 3300025321 Ga0207656_10006704 Ga0207656_100067045 295
103 3300025904 Ga0207647_10005630 Ga0207647_100056302 295
104 3300025909 Ga0207705_10123567 Ga0207705_101235672 295
105 3300025909 Ga0207705_10124727 Ga0207705_101247272 295
106 3300025911 Ga0207654_10100380 Ga0207654_101003802 295
107 3300025913 Ga0207695_10038816 Ga0207695_100388164 295
108 3300025914 Ga0207671_10182776 Ga0207671_101827762 295
109 3300025917 Ga0207660_10038492 Ga0207660_100384922 295
110 3300025919 Ga0207657_10012964 Ga0207657_100129647 295
111 3300025920 Ga0207649_10006830 Ga0207649_100068303 295
112 3300025921 Ga0207652_10173103 Ga0207652_101731033 295
113 3300025932 Ga0207690_10007682 Ga0207690_100076824 295
114 3300025941 Ga0207711_10053392 Ga0207711_100533923 295
115 3300025944 Ga0207661_10042740 Ga0207661_100427403 295
116 3300025949 Ga0207667_10021125 Ga0207667_100211255 295
117 3300025981 Ga0207640_10005537 Ga0207640_100055374 295
118 3300026041 Ga0207639_10038123 Ga0207639_100381233 295
119 3300026067 Ga0207678_10067448 Ga0207678_100674484 295
120 3300026078 Ga0207702_10140284 Ga0207702_101402843 295
121 3300026116 Ga0207674_10010165 Ga0207674_100101659 295
122 3300026142 Ga0207698_10013046 Ga0207698_100130467 295
123 3300037312 Ga0395899_0037136 Ga0395899_0037136_2475_3389 295
124 3300037418 Ga0395900_0137072 Ga0395900_0137072_352_1266 295
125 3300037466 Ga0395898_0058445 Ga0395898_0058445_501_1415 295
126 3300048903 Ga0496100_0038046 Ga0496100_0038046_1338_2252 295
127 3300048904 Ga0496101_0007157 Ga0496101_0007157_6219_7133 295
128 3300048911 Ga0496108_0004931 Ga0496108_0004931_8072_8986 295
129 3300048917 Ga0496114_0033866 Ga0496114_0033866_2069_2983 295
130 3300048918 Ga0496115_0026126 Ga0496115_0026126_883_1797 295
131 3300025925 Ga0207650_10031065 Ga0207650_100310656 296
132 3300025926 Ga0207659_10030476 Ga0207659_100304762 296
133 3300031548 Ga0307408_100022504 Ga0307408_1000225042 296
134 3300031901 Ga0307406_10058404 Ga0307406_100584043 296
135 3300031995 Ga0307409_100371263 Ga0307409_1003712632 296
136 3300044693 Ga0466961_0028348 Ga0466961_0028348_2380_3294 296
137 3300045049 Ga0466959_0013667 Ga0466959_0013667_1615_2529 296
138 3300048912 Ga0496109_0141271 Ga0496109_0141271_382_1296 296
139 3300045976 Ga0466967_0031391 Ga0466967_0031391_2055_2969 297
140 3300005339 Ga0070660_100387780 Ga0070660_1003877801 298
141 3300005364 Ga0070673_100038050 Ga0070673_1000380504 298
142 3300005548 Ga0070665_100006682 Ga0070665_1000066826 298
143 3300005618 Ga0068864_100314667 Ga0068864_1003146672 298
144 3300025960 Ga0207651_10106403 Ga0207651_101064032 298
145 3300028379 Ga0268266_10151062 Ga0268266_101510623 298
146 3300028380 Ga0268265_10265860 Ga0268265_102658602 298
147 3300031731 Ga0307405_10144718 Ga0307405_101447183 298
148 3300032004 Ga0307414_10131772 Ga0307414_101317723 298
149 3300035171 Ga0373946_0005985 Ga0373946_0005985_662_1576 298
150 3300035695 Ga0373927_0070397 Ga0373927_0070397_188_1102 298
151 3300035725 Ga0373947_0021481 Ga0373947_0021481_332_1246 298
152 3300037068 Ga0373925_0152695 Ga0373925_0152695_202_1116 298
153 3300046616 Ga0495668_0006675 Ga0495668_0006675_5261_6175 298
154 3300046684 Ga0495669_0000306 Ga0495669_0000306_21178_22092 298
155 3300046684 Ga0495669_0007410 Ga0495669_0007410_282_1196 298
156 3300005564 Ga0070664_100205049 Ga0070664_1002050492 299
157 3300049583 Ga0501067_0043758 Ga0501067_0043758_191_1105 299
158 3300053120 Ga0500597_007525 Ga0500597_007525_1465_2364 299
159 3300053157 Ga0500624_000008 Ga0500624_000008_112966_113865 299
160 3300053178 Ga0500637_0000037 Ga0500637_0000037_36129_37028 299
161 3300027665 Ga0209983_1007430 Ga0209983_10074302 302
162 3300027876 Ga0209974_10018773 Ga0209974_100187734 302
163 3300005578 Ga0068854_100504332 Ga0068854_1005043321 303
164 3300026078 Ga0207702_10409677 Ga0207702_104096772 303
165 3300026142 Ga0207698_10337608 Ga0207698_103376082 303
166 3300001915 JGI24741J21665_1003018 JGI24741J21665_10030184 304
167 3300001915 JGI24741J21665_1004177 JGI24741J21665_10041774 304
168 3300001979 JGI24740J21852_10008408 JGI24740J21852_100084084 304
169 3300001989 JGI24739J22299_10004194 JGI24739J22299_100041942 304
170 3300001989 JGI24739J22299_10007463 JGI24739J22299_100074635 304
171 3300001990 JGI24737J22298_10000104 JGI24737J22298_100001048 304
172 3300001990 JGI24737J22298_10000336 JGI24737J22298_1000033612 304
173 3300001990 JGI24737J22298_10007128 JGI24737J22298_100071285 304
174 3300001990 JGI24737J22298_10039754 JGI24737J22298_100397542 304
175 3300002067 JGI24735J21928_10009681 JGI24735J21928_100096812 304
176 3300002075 JGI24738J21930_10000383 JGI24738J21930_100003835 304
177 3300002077 JGI24744J21845_10000207 JGI24744J21845_100002072 304
178 3300005327 Ga0070658_10000154 Ga0070658_1000015434 304
179 3300005327 Ga0070658_10018026 Ga0070658_100180266 304
180 3300005327 Ga0070658_10031224 Ga0070658_100312244 304
181 3300005327 Ga0070658_10065514 Ga0070658_100655143 304
182 3300005327 Ga0070658_10135521 Ga0070658_101355213 304
183 3300005327 Ga0070658_10198579 Ga0070658_101985792 304
184 3300005327 Ga0070658_10267382 Ga0070658_102673821 304
185 3300005327 Ga0070658_10531185 Ga0070658_105311851 304
186 3300005328 Ga0070676_10000859 Ga0070676_100008595 304
187 3300005328 Ga0070676_10000958 Ga0070676_1000095813 304
188 3300005328 Ga0070676_10161015 Ga0070676_101610152 304
189 3300005329 Ga0070683_100015278 Ga0070683_1000152784 304
190 3300005329 Ga0070683_100149316 Ga0070683_1001493161 304
191 3300005329 Ga0070683_100220777 Ga0070683_1002207773 304
192 3300005329 Ga0070683_100279139 Ga0070683_1002791391 304
193 3300005330 Ga0070690_100026517 Ga0070690_1000265175 304
194 3300005330 Ga0070690_100072043 Ga0070690_1000720433 304
195 3300005330 Ga0070690_100259441 Ga0070690_1002594411 304
196 3300005330 Ga0070690_100300768 Ga0070690_1003007682 304
197 3300005331 Ga0070670_100015694 Ga0070670_1000156946 304
198 3300005331 Ga0070670_100025000 Ga0070670_1000250004 304
199 3300005331 Ga0070670_100060663 Ga0070670_1000606633 304
200 3300005331 Ga0070670_100212640 Ga0070670_1002126402 304
201 3300005331 Ga0070670_100302445 Ga0070670_1003024451 304
202 3300005333 Ga0070677_10035868 Ga0070677_100358683 304
203 3300005333 Ga0070677_10053565 Ga0070677_100535652 304
204 3300005333 Ga0070677_10059980 Ga0070677_100599802 304
205 3300005334 Ga0068869_100000775 Ga0068869_10000077513 304
206 3300005335 Ga0070666_10004574 Ga0070666_100045746 304
207 3300005335 Ga0070666_10010482 Ga0070666_100104821 304
208 3300005335 Ga0070666_10038984 Ga0070666_100389844 304
209 3300005335 Ga0070666_10068344 Ga0070666_100683443 304
210 3300005336 Ga0070680_100000628 Ga0070680_10000062815 304
211 3300005336 Ga0070680_100000647 Ga0070680_10000064718 304
212 3300005336 Ga0070680_100009749 Ga0070680_1000097493 304
213 3300005336 Ga0070680_100010145 Ga0070680_1000101454 304
214 3300005336 Ga0070680_100036669 Ga0070680_1000366693 304
215 3300005338 Ga0068868_100001843 Ga0068868_1000018435 304
216 3300005338 Ga0068868_100004431 Ga0068868_1000044319 304
217 3300005339 Ga0070660_100000284 Ga0070660_10000028428 304
218 3300005339 Ga0070660_100000869 Ga0070660_10000086916 304
219 3300005339 Ga0070660_100003772 Ga0070660_1000037724 304
220 3300005339 Ga0070660_100010071 Ga0070660_1000100712 304
221 3300005339 Ga0070660_100015745 Ga0070660_1000157455 304
222 3300005339 Ga0070660_100035397 Ga0070660_1000353975 304
223 3300005339 Ga0070660_100134410 Ga0070660_1001344103 304
224 3300005339 Ga0070660_100179233 Ga0070660_1001792332 304
225 3300005339 Ga0070660_100190256 Ga0070660_1001902562 304
226 3300005339 Ga0070660_100216532 Ga0070660_1002165322 304
227 3300005340 Ga0070689_100013624 Ga0070689_1000136242 304
228 3300005344 Ga0070661_100000195 Ga0070661_10000019534 304
229 3300005344 Ga0070661_100020750 Ga0070661_1000207506 304
230 3300005344 Ga0070661_100022812 Ga0070661_1000228127 304
231 3300005344 Ga0070661_100024157 Ga0070661_1000241573 304
232 3300005344 Ga0070661_100041711 Ga0070661_1000417115 304
233 3300005344 Ga0070661_100056132 Ga0070661_1000561324 304
234 3300005344 Ga0070661_100066999 Ga0070661_1000669992 304
235 3300005344 Ga0070661_100241427 Ga0070661_1002414272 304
236 3300005344 Ga0070661_100277185 Ga0070661_1002771852 304
237 3300005344 Ga0070661_100317332 Ga0070661_1003173322 304
238 3300005344 Ga0070661_100478110 Ga0070661_1004781101 304
239 3300005345 Ga0070692_10006130 Ga0070692_100061303 304
240 3300005345 Ga0070692_10028975 Ga0070692_100289754 304
241 3300005345 Ga0070692_10040297 Ga0070692_100402971 304
242 3300005347 Ga0070668_100001286 Ga0070668_10000128612 304
243 3300005347 Ga0070668_100021509 Ga0070668_1000215095 304
244 3300005347 Ga0070668_100134118 Ga0070668_1001341182 304
245 3300005347 Ga0070668_100160389 Ga0070668_1001603893 304
246 3300005353 Ga0070669_100000196 Ga0070669_10000019643 304
247 3300005353 Ga0070669_100026244 Ga0070669_1000262443 304
248 3300005353 Ga0070669_100120814 Ga0070669_1001208143 304
249 3300005354 Ga0070675_100177780 Ga0070675_1001777802 304
250 3300005354 Ga0070675_100219931 Ga0070675_1002199312 304
251 3300005355 Ga0070671_100004097 Ga0070671_1000040974 304
252 3300005355 Ga0070671_100004402 Ga0070671_1000044022 304
253 3300005355 Ga0070671_100020224 Ga0070671_1000202245 304
254 3300005355 Ga0070671_100028487 Ga0070671_1000284875 304
255 3300005355 Ga0070671_100043806 Ga0070671_1000438063 304
256 3300005355 Ga0070671_100111200 Ga0070671_1001112003 304
257 3300005355 Ga0070671_100399666 Ga0070671_1003996662 304
258 3300005356 Ga0070674_100017838 Ga0070674_1000178384 304
259 3300005356 Ga0070674_100240936 Ga0070674_1002409362 304
260 3300005356 Ga0070674_100295993 Ga0070674_1002959932 304
261 3300005364 Ga0070673_100004026 Ga0070673_1000040261 304
262 3300005364 Ga0070673_100018613 Ga0070673_1000186136 304
263 3300005364 Ga0070673_100020191 Ga0070673_1000201912 304
264 3300005364 Ga0070673_100024623 Ga0070673_1000246234 304
265 3300005364 Ga0070673_100025378 Ga0070673_1000253782 304
266 3300005364 Ga0070673_100025930 Ga0070673_1000259306 304
267 3300005364 Ga0070673_100177809 Ga0070673_1001778091 304
268 3300005364 Ga0070673_100221283 Ga0070673_1002212831 304
269 3300005364 Ga0070673_100244115 Ga0070673_1002441152 304
270 3300005364 Ga0070673_100268375 Ga0070673_1002683752 304
271 3300005366 Ga0070659_100002125 Ga0070659_1000021256 304
272 3300005366 Ga0070659_100003347 Ga0070659_1000033477 304
273 3300005366 Ga0070659_100005974 Ga0070659_1000059745 304
274 3300005366 Ga0070659_100011358 Ga0070659_1000113587 304
275 3300005366 Ga0070659_100011981 Ga0070659_1000119812 304
276 3300005366 Ga0070659_100035537 Ga0070659_1000355373 304
277 3300005366 Ga0070659_100043883 Ga0070659_1000438833 304
278 3300005366 Ga0070659_100052732 Ga0070659_1000527323 304
279 3300005366 Ga0070659_100080865 Ga0070659_1000808654 304
280 3300005366 Ga0070659_100087371 Ga0070659_1000873714 304
281 3300005366 Ga0070659_100108950 Ga0070659_1001089503 304
282 3300005366 Ga0070659_100112485 Ga0070659_1001124853 304
283 3300005366 Ga0070659_100125137 Ga0070659_1001251373 304
284 3300005366 Ga0070659_100237364 Ga0070659_1002373642 304
285 3300005367 Ga0070667_100007016 Ga0070667_1000070169 304
286 3300005367 Ga0070667_100022481 Ga0070667_1000224815 304
287 3300005367 Ga0070667_100038048 Ga0070667_1000380485 304
288 3300005367 Ga0070667_100043386 Ga0070667_1000433863 304
289 3300005367 Ga0070667_100172242 Ga0070667_1001722422 304
290 3300005367 Ga0070667_100197410 Ga0070667_1001974102 304
291 3300005367 Ga0070667_100237995 Ga0070667_1002379952 304
292 3300005367 Ga0070667_100263655 Ga0070667_1002636551 304
293 3300005434 Ga0070709_10037136 Ga0070709_100371363 304
294 3300005435 Ga0070714_100031841 Ga0070714_1000318416 304
295 3300005435 Ga0070714_100046761 Ga0070714_1000467615 304
296 3300005435 Ga0070714_100332891 Ga0070714_1003328912 304
297 3300005436 Ga0070713_100014363 Ga0070713_1000143636 304
298 3300005436 Ga0070713_100049574 Ga0070713_1000495741 304
299 3300005444 Ga0070694_100051216 Ga0070694_1000512166 304
300 3300005455 Ga0070663_100000199 Ga0070663_10000019930 304
301 3300005455 Ga0070663_100024339 Ga0070663_1000243395 304
302 3300005455 Ga0070663_100052497 Ga0070663_1000524972 304
303 3300005455 Ga0070663_100082163 Ga0070663_1000821632 304
304 3300005455 Ga0070663_100107220 Ga0070663_1001072203 304
305 3300005455 Ga0070663_100126214 Ga0070663_1001262143 304
306 3300005455 Ga0070663_100171858 Ga0070663_1001718583 304
307 3300005456 Ga0070678_100001565 Ga0070678_1000015657 304
308 3300005456 Ga0070678_100008600 Ga0070678_1000086004 304
309 3300005456 Ga0070678_100019238 Ga0070678_1000192384 304
310 3300005456 Ga0070678_100027353 Ga0070678_1000273531 304
311 3300005456 Ga0070678_100107505 Ga0070678_1001075052 304
312 3300005457 Ga0070662_100000049 Ga0070662_10000004928 304
313 3300005457 Ga0070662_100000507 Ga0070662_1000005075 304
314 3300005457 Ga0070662_100005871 Ga0070662_1000058716 304
315 3300005457 Ga0070662_100027358 Ga0070662_1000273585 304
316 3300005457 Ga0070662_100046556 Ga0070662_1000465562 304
317 3300005457 Ga0070662_100047746 Ga0070662_1000477464 304
318 3300005457 Ga0070662_100048090 Ga0070662_1000480904 304
319 3300005457 Ga0070662_100070464 Ga0070662_1000704643 304
320 3300005457 Ga0070662_100075820 Ga0070662_1000758202 304
321 3300005457 Ga0070662_100103914 Ga0070662_1001039143 304
322 3300005457 Ga0070662_100177115 Ga0070662_1001771153 304
323 3300005458 Ga0070681_10025826 Ga0070681_100258267 304
324 3300005458 Ga0070681_10065822 Ga0070681_100658221 304
325 3300005458 Ga0070681_10069647 Ga0070681_100696474 304
326 3300005458 Ga0070681_10447469 Ga0070681_104474692 304
327 3300005458 Ga0070681_10499187 Ga0070681_104991872 304
328 3300005458 Ga0070681_10522468 Ga0070681_105224682 304
329 3300005459 Ga0068867_100009423 Ga0068867_1000094233 304
330 3300005459 Ga0068867_100012048 Ga0068867_1000120487 304
331 3300005459 Ga0068867_100029493 Ga0068867_1000294933 304
332 3300005459 Ga0068867_100068890 Ga0068867_1000688903 304
333 3300005530 Ga0070679_100005648 Ga0070679_1000056484 304
334 3300005530 Ga0070679_100033561 Ga0070679_1000335615 304
335 3300005530 Ga0070679_100372499 Ga0070679_1003724993 304
336 3300005530 Ga0070679_100431076 Ga0070679_1004310761 304
337 3300005530 Ga0070679_100598637 Ga0070679_1005986371 304
338 3300005535 Ga0070684_100002165 Ga0070684_1000021657 304
339 3300005535 Ga0070684_100036973 Ga0070684_1000369735 304
340 3300005535 Ga0070684_100156893 Ga0070684_1001568933 304
341 3300005539 Ga0068853_100000098 Ga0068853_10000009834 304
342 3300005539 Ga0068853_100004186 Ga0068853_10000418610 304
343 3300005539 Ga0068853_100066503 Ga0068853_1000665034 304
344 3300005539 Ga0068853_100098251 Ga0068853_1000982513 304
345 3300005539 Ga0068853_100143516 Ga0068853_1001435162 304
346 3300005539 Ga0068853_100428416 Ga0068853_1004284162 304
347 3300005543 Ga0070672_100002144 Ga0070672_1000021444 304
348 3300005543 Ga0070672_100006310 Ga0070672_1000063107 304
349 3300005543 Ga0070672_100011514 Ga0070672_1000115145 304
350 3300005543 Ga0070672_100141267 Ga0070672_1001412673 304
351 3300005543 Ga0070672_100192696 Ga0070672_1001926961 304
352 3300005544 Ga0070686_100046913 Ga0070686_1000469134 304
353 3300005546 Ga0070696_100003877 Ga0070696_10000387710 304
354 3300005547 Ga0070693_100001644 Ga0070693_1000016446 304
355 3300005547 Ga0070693_100096568 Ga0070693_1000965682 304
356 3300005547 Ga0070693_100119430 Ga0070693_1001194302 304
357 3300005547 Ga0070693_100121626 Ga0070693_1001216262 304
358 3300005548 Ga0070665_100002247 Ga0070665_10000224712 304
359 3300005548 Ga0070665_100007505 Ga0070665_1000075059 304
360 3300005548 Ga0070665_100007683 Ga0070665_10000768310 304
361 3300005548 Ga0070665_100685811 Ga0070665_1006858111 304
362 3300005563 Ga0068855_100000546 Ga0068855_10000054611 304
363 3300005563 Ga0068855_100018927 Ga0068855_1000189277 304
364 3300005563 Ga0068855_100023345 Ga0068855_1000233453 304
365 3300005563 Ga0068855_100063965 Ga0068855_1000639655 304
366 3300005563 Ga0068855_100128428 Ga0068855_1001284284 304
367 3300005563 Ga0068855_100169119 Ga0068855_1001691193 304
368 3300005563 Ga0068855_100216320 Ga0068855_1002163203 304
369 3300005563 Ga0068855_100228774 Ga0068855_1002287743 304
370 3300005563 Ga0068855_100296782 Ga0068855_1002967823 304
371 3300005563 Ga0068855_100433868 Ga0068855_1004338681 304
372 3300005563 Ga0068855_100526004 Ga0068855_1005260042 304
373 3300005564 Ga0070664_100000162 Ga0070664_10000016227 304
374 3300005564 Ga0070664_100002252 Ga0070664_10000225214 304
375 3300005564 Ga0070664_100003267 Ga0070664_1000032679 304
376 3300005564 Ga0070664_100017302 Ga0070664_1000173022 304
377 3300005564 Ga0070664_100017785 Ga0070664_1000177854 304
378 3300005564 Ga0070664_100025951 Ga0070664_1000259515 304
379 3300005564 Ga0070664_100033729 Ga0070664_1000337295 304
380 3300005564 Ga0070664_100042269 Ga0070664_1000422693 304
381 3300005564 Ga0070664_100159111 Ga0070664_1001591113 304
382 3300005577 Ga0068857_100002224 Ga0068857_10000222416 304
383 3300005577 Ga0068857_100007467 Ga0068857_1000074675 304
384 3300005577 Ga0068857_100022989 Ga0068857_1000229894 304
385 3300005577 Ga0068857_100036242 Ga0068857_1000362424 304
386 3300005578 Ga0068854_100029180 Ga0068854_1000291804 304
387 3300005578 Ga0068854_100047339 Ga0068854_1000473393 304
388 3300005578 Ga0068854_100092246 Ga0068854_1000922463 304
389 3300005578 Ga0068854_100270349 Ga0068854_1002703492 304
390 3300005614 Ga0068856_100000788 Ga0068856_10000078827 304
391 3300005614 Ga0068856_100019423 Ga0068856_1000194236 304
392 3300005614 Ga0068856_100038942 Ga0068856_1000389426 304
393 3300005614 Ga0068856_100444945 Ga0068856_1004449452 304
394 3300005614 Ga0068856_100485933 Ga0068856_1004859332 304
395 3300005614 Ga0068856_100610398 Ga0068856_1006103982 304
396 3300005616 Ga0068852_100000425 Ga0068852_1000004256 304
397 3300005616 Ga0068852_100001147 Ga0068852_10000114714 304
398 3300005616 Ga0068852_100013294 Ga0068852_1000132947 304
399 3300005616 Ga0068852_100018142 Ga0068852_1000181426 304
400 3300005616 Ga0068852_100021530 Ga0068852_1000215306 304
401 3300005616 Ga0068852_100043318 Ga0068852_1000433184 304
402 3300005616 Ga0068852_100049064 Ga0068852_1000490642 304
403 3300005616 Ga0068852_100051429 Ga0068852_1000514293 304
404 3300005616 Ga0068852_100058518 Ga0068852_1000585183 304
405 3300005616 Ga0068852_100076587 Ga0068852_1000765873 304
406 3300005616 Ga0068852_100086011 Ga0068852_1000860113 304
407 3300005616 Ga0068852_100129819 Ga0068852_1001298192 304
408 3300005616 Ga0068852_100145153 Ga0068852_1001451533 304
409 3300005616 Ga0068852_100146505 Ga0068852_1001465052 304
410 3300005616 Ga0068852_100148421 Ga0068852_1001484212 304
411 3300005616 Ga0068852_100190841 Ga0068852_1001908412 304
412 3300005616 Ga0068852_100226645 Ga0068852_1002266453 304
413 3300005616 Ga0068852_100404077 Ga0068852_1004040771 304
414 3300005617 Ga0068859_100010318 Ga0068859_1000103185 304
415 3300005617 Ga0068859_100014394 Ga0068859_1000143942 304
416 3300005617 Ga0068859_100019422 Ga0068859_1000194224 304
417 3300005617 Ga0068859_100021440 Ga0068859_1000214407 304
418 3300005617 Ga0068859_100030677 Ga0068859_1000306776 304
419 3300005617 Ga0068859_100222778 Ga0068859_1002227781 304
420 3300005617 Ga0068859_100543092 Ga0068859_1005430922 304
421 3300005618 Ga0068864_100000078 Ga0068864_10000007858 304
422 3300005618 Ga0068864_100000153 Ga0068864_10000015343 304
423 3300005618 Ga0068864_100003538 Ga0068864_10000353813 304
424 3300005618 Ga0068864_100004670 Ga0068864_1000046703 304
425 3300005618 Ga0068864_100007271 Ga0068864_1000072715 304
426 3300005618 Ga0068864_100028517 Ga0068864_1000285174 304
427 3300005618 Ga0068864_100028619 Ga0068864_1000286196 304
428 3300005618 Ga0068864_100035617 Ga0068864_1000356175 304
429 3300005618 Ga0068864_100070649 Ga0068864_1000706491 304
430 3300005618 Ga0068864_100224095 Ga0068864_1002240953 304
431 3300005718 Ga0068866_10001322 Ga0068866_100013229 304
432 3300005719 Ga0068861_100029147 Ga0068861_1000291475 304
433 3300005834 Ga0068851_10005074 Ga0068851_100050745 304
434 3300005834 Ga0068851_10053047 Ga0068851_100530473 304
435 3300005834 Ga0068851_10200024 Ga0068851_102000242 304
436 3300005840 Ga0068870_10139303 Ga0068870_101393032 304
437 3300005841 Ga0068863_100002169 Ga0068863_10000216910 304
438 3300005841 Ga0068863_100002816 Ga0068863_1000028164 304
439 3300005841 Ga0068863_100004752 Ga0068863_1000047524 304
440 3300005841 Ga0068863_100016990 Ga0068863_1000169903 304
441 3300005841 Ga0068863_100033633 Ga0068863_1000336334 304
442 3300005841 Ga0068863_100076334 Ga0068863_1000763344 304
443 3300005841 Ga0068863_100081619 Ga0068863_1000816194 304
444 3300005841 Ga0068863_100084627 Ga0068863_1000846274 304
445 3300005841 Ga0068863_100126453 Ga0068863_1001264534 304
446 3300005841 Ga0068863_100177811 Ga0068863_1001778113 304
447 3300005841 Ga0068863_100370791 Ga0068863_1003707912 304
448 3300005841 Ga0068863_100634723 Ga0068863_1006347231 304
449 3300005842 Ga0068858_100000832 Ga0068858_10000083218 304
450 3300005842 Ga0068858_100002274 Ga0068858_10000227423 304
451 3300005842 Ga0068858_100006226 Ga0068858_1000062265 304
452 3300005842 Ga0068858_100007735 Ga0068858_1000077356 304
453 3300005842 Ga0068858_100011344 Ga0068858_1000113446 304
454 3300005842 Ga0068858_100024957 Ga0068858_1000249574 304
455 3300005842 Ga0068858_100026952 Ga0068858_1000269526 304
456 3300005842 Ga0068858_100046718 Ga0068858_1000467185 304
457 3300005842 Ga0068858_100093331 Ga0068858_1000933314 304
458 3300005843 Ga0068860_100012870 Ga0068860_1000128709 304
459 3300005843 Ga0068860_100072773 Ga0068860_1000727733 304
460 3300005843 Ga0068860_100076230 Ga0068860_1000762303 304
461 3300005843 Ga0068860_100131338 Ga0068860_1001313381 304
462 3300005843 Ga0068860_100520379 Ga0068860_1005203792 304
463 3300005844 Ga0068862_100003518 Ga0068862_10000351810 304
464 3300005844 Ga0068862_100049579 Ga0068862_1000495793 304
465 3300005844 Ga0068862_100068984 Ga0068862_1000689844 304
466 3300005844 Ga0068862_100235407 Ga0068862_1002354072 304
467 3300005985 Ga0081539_10043339 Ga0081539_100433393 304
468 3300006028 Ga0070717_10014056 Ga0070717_100140562 304
469 3300006173 Ga0070716_100196860 Ga0070716_1001968602 304
470 3300006195 Ga0075366_10058856 Ga0075366_100588563 304
471 3300006237 Ga0097621_100002557 Ga0097621_1000025577 304
472 3300006237 Ga0097621_100029704 Ga0097621_1000297044 304
473 3300006237 Ga0097621_100109448 Ga0097621_1001094484 304
474 3300006237 Ga0097621_100145826 Ga0097621_1001458263 304
475 3300006358 Ga0068871_100089442 Ga0068871_1000894422 304
476 3300006358 Ga0068871_100100772 Ga0068871_1001007723 304
477 3300006881 Ga0068865_100011285 Ga0068865_1000112855 304
478 3300006881 Ga0068865_100024575 Ga0068865_1000245753 304
479 3300006881 Ga0068865_100035074 Ga0068865_1000350744 304
480 3300006881 Ga0068865_100114862 Ga0068865_1001148622 304
481 3300006881 Ga0068865_100231647 Ga0068865_1002316472 304
482 3300006881 Ga0068865_100408711 Ga0068865_1004087111 304
483 3300006931 Ga0097620_100010318 Ga0097620_1000103185 304
484 3300006931 Ga0097620_100014392 Ga0097620_1000143929 304
485 3300006931 Ga0097620_100019422 Ga0097620_1000194224 304
486 3300006931 Ga0097620_100021440 Ga0097620_1000214404 304
487 3300006931 Ga0097620_100030677 Ga0097620_1000306773 304
488 3300006931 Ga0097620_100222788 Ga0097620_1002227883 304
489 3300006931 Ga0097620_100543193 Ga0097620_1005431932 304
490 3300009011 Ga0105251_10040608 Ga0105251_100406083 304
491 3300009092 Ga0105250_10003931 Ga0105250_100039312 304
492 3300009092 Ga0105250_10073901 Ga0105250_100739012 304
493 3300009093 Ga0105240_10172916 Ga0105240_101729163 304
494 3300009098 Ga0105245_10000342 Ga0105245_1000034240 304
495 3300009098 Ga0105245_10006243 Ga0105245_100062437 304
496 3300009098 Ga0105245_10091382 Ga0105245_100913824 304
497 3300009148 Ga0105243_10181415 Ga0105243_101814152 304
498 3300009174 Ga0105241_10103401 Ga0105241_101034012 304
499 3300009176 Ga0105242_10003633 Ga0105242_1000363311 304
500 3300009176 Ga0105242_10352518 Ga0105242_103525182 304
501 3300009177 Ga0105248_10000544 Ga0105248_1000054428 304
502 3300009177 Ga0105248_10002910 Ga0105248_100029108 304
503 3300009177 Ga0105248_10004523 Ga0105248_1000452313 304
504 3300009177 Ga0105248_10014376 Ga0105248_100143763 304
505 3300009177 Ga0105248_10021075 Ga0105248_100210755 304
506 3300009177 Ga0105248_10023560 Ga0105248_100235605 304
507 3300009177 Ga0105248_10033496 Ga0105248_100334962 304
508 3300009177 Ga0105248_10033950 Ga0105248_100339506 304
509 3300009177 Ga0105248_10046730 Ga0105248_100467304 304
510 3300009177 Ga0105248_10069459 Ga0105248_100694594 304
511 3300009177 Ga0105248_10178214 Ga0105248_101782143 304
512 3300009545 Ga0105237_10027692 Ga0105237_100276927 304
513 3300009551 Ga0105238_10020220 Ga0105238_100202205 304
514 3300009553 Ga0105249_10075864 Ga0105249_100758643 304
515 3300009553 Ga0105249_10393943 Ga0105249_103939432 304
516 3300009553 Ga0105249_10750577 Ga0105249_107505771 304
517 3300010375 Ga0105239_10028632 Ga0105239_100286326 304
518 3300010375 Ga0105239_10219152 Ga0105239_102191522 304
519 3300011119 Ga0105246_10076784 Ga0105246_100767841 304
520 3300011119 Ga0105246_10448503 Ga0105246_104485032 304
521 3300013100 Ga0157373_10010702 Ga0157373_100107026 304
522 3300013100 Ga0157373_10049210 Ga0157373_100492103 304
523 3300013100 Ga0157373_10105650 Ga0157373_101056503 304
524 3300013100 Ga0157373_10200643 Ga0157373_102006433 304
525 3300013102 Ga0157371_10000612 Ga0157371_1000061242 304
526 3300013102 Ga0157371_10013748 Ga0157371_100137487 304
527 3300013102 Ga0157371_10022569 Ga0157371_100225697 304
528 3300013102 Ga0157371_10054122 Ga0157371_100541222 304
529 3300013102 Ga0157371_10064799 Ga0157371_100647993 304
530 3300013102 Ga0157371_10093453 Ga0157371_100934532 304
531 3300013102 Ga0157371_10094166 Ga0157371_100941662 304
532 3300013102 Ga0157371_10105412 Ga0157371_101054123 304
533 3300013102 Ga0157371_10145013 Ga0157371_101450132 304
534 3300013102 Ga0157371_10222745 Ga0157371_102227452 304
535 3300013104 Ga0157370_10001982 Ga0157370_1000198221 304
536 3300013104 Ga0157370_10012302 Ga0157370_100123023 304
537 3300013104 Ga0157370_10156723 Ga0157370_101567233 304
538 3300013104 Ga0157370_10338485 Ga0157370_103384852 304
539 3300013104 Ga0157370_10552852 Ga0157370_105528522 304
540 3300013105 Ga0157369_10005483 Ga0157369_100054835 304
541 3300013105 Ga0157369_10009057 Ga0157369_100090575 304
542 3300013105 Ga0157369_10068610 Ga0157369_100686104 304
543 3300013105 Ga0157369_10096842 Ga0157369_100968423 304
544 3300013105 Ga0157369_10196688 Ga0157369_101966882 304
545 3300013105 Ga0157369_10305602 Ga0157369_103056022 304
546 3300013105 Ga0157369_10334291 Ga0157369_103342912 304
547 3300013105 Ga0157369_10592465 Ga0157369_105924652 304
548 3300013296 Ga0157374_10030191 Ga0157374_100301914 304
549 3300013296 Ga0157374_10070052 Ga0157374_100700525 304
550 3300013296 Ga0157374_10312086 Ga0157374_103120862 304
551 3300013297 Ga0157378_10001183 Ga0157378_1000118315 304
552 3300013297 Ga0157378_10033143 Ga0157378_100331434 304
553 3300013297 Ga0157378_10226806 Ga0157378_102268062 304
554 3300013306 Ga0163162_10004990 Ga0163162_1000499014 304
555 3300013306 Ga0163162_10010754 Ga0163162_1001075410 304
556 3300013306 Ga0163162_10073515 Ga0163162_100735153 304
557 3300013306 Ga0163162_10158974 Ga0163162_101589743 304
558 3300013306 Ga0163162_10159127 Ga0163162_101591274 304
559 3300013306 Ga0163162_10194538 Ga0163162_101945382 304
560 3300013306 Ga0163162_10378722 Ga0163162_103787223 304
561 3300013307 Ga0157372_10122516 Ga0157372_101225163 304
562 3300013307 Ga0157372_10182330 Ga0157372_101823303 304
563 3300013307 Ga0157372_10202554 Ga0157372_102025543 304
564 3300013307 Ga0157372_10226889 Ga0157372_102268892 304
565 3300013307 Ga0157372_10361242 Ga0157372_103612421 304
566 3300013308 Ga0157375_10021110 Ga0157375_100211103 304
567 3300013308 Ga0157375_10023031 Ga0157375_100230317 304
568 3300013308 Ga0157375_10035911 Ga0157375_100359113 304
569 3300013308 Ga0157375_10068189 Ga0157375_100681894 304
570 3300013308 Ga0157375_10117860 Ga0157375_101178603 304
571 3300013308 Ga0157375_10434193 Ga0157375_104341932 304
572 3300014325 Ga0163163_10000258 Ga0163163_1000025819 304
573 3300014325 Ga0163163_10028898 Ga0163163_100288983 304
574 3300014325 Ga0163163_10029168 Ga0163163_100291685 304
575 3300014325 Ga0163163_10136615 Ga0163163_101366153 304
576 3300014325 Ga0163163_10151215 Ga0163163_101512153 304
577 3300014745 Ga0157377_10014511 Ga0157377_100145116 304
578 3300014968 Ga0157379_10002519 Ga0157379_1000251916 304
579 3300014968 Ga0157379_10034380 Ga0157379_100343807 304
580 3300014968 Ga0157379_10080677 Ga0157379_100806773 304
581 3300014968 Ga0157379_10105672 Ga0157379_101056724 304
582 3300014968 Ga0157379_10154402 Ga0157379_101544023 304
583 3300014969 Ga0157376_10001235 Ga0157376_1000123516 304
584 3300020070 Ga0206356_10496746 Ga0206356_104967462 304
585 3300020081 Ga0206354_11003028 Ga0206354_110030281 304
586 3300020082 Ga0206353_11434613 Ga0206353_114346132 304
587 3300020082 Ga0206353_11497196 Ga0206353_114971963 304
588 3300020082 Ga0206353_12058462 Ga0206353_120584621 304
589 3300021388 Ga0213875_10002933 Ga0213875_1000293310 304
590 3300025315 Ga0207697_10000132 Ga0207697_1000013241 304
591 3300025321 Ga0207656_10024786 Ga0207656_100247863 304
592 3300025321 Ga0207656_10123941 Ga0207656_101239411 304
593 3300025711 Ga0207696_1026678 Ga0207696_10266782 304
594 3300025893 Ga0207682_10011313 Ga0207682_100113132 304
595 3300025893 Ga0207682_10018969 Ga0207682_100189692 304
596 3300025893 Ga0207682_10029829 Ga0207682_100298293 304
597 3300025899 Ga0207642_10007833 Ga0207642_100078332 304
598 3300025901 Ga0207688_10000380 Ga0207688_100003809 304
599 3300025901 Ga0207688_10000937 Ga0207688_1000093713 304
600 3300025901 Ga0207688_10025616 Ga0207688_100256162 304
601 3300025901 Ga0207688_10066300 Ga0207688_100663003 304
602 3300025903 Ga0207680_10000219 Ga0207680_1000021913 304
603 3300025903 Ga0207680_10000459 Ga0207680_1000045915 304
604 3300025903 Ga0207680_10002571 Ga0207680_100025717 304
605 3300025903 Ga0207680_10011268 Ga0207680_100112686 304
606 3300025903 Ga0207680_10022828 Ga0207680_100228284 304
607 3300025903 Ga0207680_10235710 Ga0207680_102357102 304
608 3300025904 Ga0207647_10000248 Ga0207647_1000024843 304
609 3300025904 Ga0207647_10003591 Ga0207647_100035914 304
610 3300025904 Ga0207647_10010619 Ga0207647_100106196 304
611 3300025904 Ga0207647_10019937 Ga0207647_100199375 304
612 3300025904 Ga0207647_10137511 Ga0207647_101375112 304
613 3300025904 Ga0207647_10176691 Ga0207647_101766912 304
614 3300025904 Ga0207647_10179585 Ga0207647_101795852 304
615 3300025906 Ga0207699_10148590 Ga0207699_101485902 304
616 3300025907 Ga0207645_10001656 Ga0207645_100016566 304
617 3300025907 Ga0207645_10012042 Ga0207645_100120424 304
618 3300025907 Ga0207645_10015238 Ga0207645_100152384 304
619 3300025907 Ga0207645_10165096 Ga0207645_101650962 304
620 3300025908 Ga0207643_10204636 Ga0207643_102046362 304
621 3300025909 Ga0207705_10000285 Ga0207705_1000028535 304
622 3300025909 Ga0207705_10000320 Ga0207705_1000032037 304
623 3300025909 Ga0207705_10000330 Ga0207705_1000033030 304
624 3300025909 Ga0207705_10030070 Ga0207705_100300704 304
625 3300025909 Ga0207705_10031278 Ga0207705_100312784 304
626 3300025909 Ga0207705_10032005 Ga0207705_100320053 304
627 3300025909 Ga0207705_10037294 Ga0207705_100372942 304
628 3300025909 Ga0207705_10051681 Ga0207705_100516814 304
629 3300025909 Ga0207705_10057951 Ga0207705_100579513 304
630 3300025909 Ga0207705_10069521 Ga0207705_100695214 304
631 3300025909 Ga0207705_10145573 Ga0207705_101455732 304
632 3300025911 Ga0207654_10057022 Ga0207654_100570222 304
633 3300025912 Ga0207707_10016497 Ga0207707_100164975 304
634 3300025912 Ga0207707_10028296 Ga0207707_100282963 304
635 3300025912 Ga0207707_10036989 Ga0207707_100369895 304
636 3300025913 Ga0207695_10177477 Ga0207695_101774772 304
637 3300025913 Ga0207695_10355015 Ga0207695_103550151 304
638 3300025917 Ga0207660_10001110 Ga0207660_100011105 304
639 3300025917 Ga0207660_10002477 Ga0207660_100024775 304
640 3300025917 Ga0207660_10004291 Ga0207660_100042912 304
641 3300025917 Ga0207660_10118536 Ga0207660_101185363 304
642 3300025919 Ga0207657_10001031 Ga0207657_1000103122 304
643 3300025919 Ga0207657_10001361 Ga0207657_1000136114 304
644 3300025919 Ga0207657_10001906 Ga0207657_1000190624 304
645 3300025919 Ga0207657_10002839 Ga0207657_100028396 304
646 3300025919 Ga0207657_10004068 Ga0207657_1000406813 304
647 3300025919 Ga0207657_10006395 Ga0207657_100063952 304
648 3300025919 Ga0207657_10010782 Ga0207657_100107828 304
649 3300025919 Ga0207657_10014496 Ga0207657_100144967 304
650 3300025919 Ga0207657_10014520 Ga0207657_100145204 304
651 3300025919 Ga0207657_10020563 Ga0207657_100205636 304
652 3300025919 Ga0207657_10020823 Ga0207657_100208235 304
653 3300025919 Ga0207657_10021169 Ga0207657_100211692 304
654 3300025919 Ga0207657_10073222 Ga0207657_100732222 304
655 3300025919 Ga0207657_10085802 Ga0207657_100858024 304
656 3300025919 Ga0207657_10194249 Ga0207657_101942493 304
657 3300025919 Ga0207657_10195768 Ga0207657_101957682 304
658 3300025919 Ga0207657_10223348 Ga0207657_102233482 304
659 3300025919 Ga0207657_10232518 Ga0207657_102325183 304
660 3300025920 Ga0207649_10000128 Ga0207649_1000012837 304
661 3300025920 Ga0207649_10015845 Ga0207649_100158454 304
662 3300025920 Ga0207649_10021725 Ga0207649_100217254 304
663 3300025920 Ga0207649_10026939 Ga0207649_100269393 304
664 3300025920 Ga0207649_10041346 Ga0207649_100413464 304
665 3300025920 Ga0207649_10052302 Ga0207649_100523022 304
666 3300025920 Ga0207649_10061196 Ga0207649_100611963 304
667 3300025920 Ga0207649_10084708 Ga0207649_100847083 304
668 3300025920 Ga0207649_10115376 Ga0207649_101153761 304
669 3300025920 Ga0207649_10123702 Ga0207649_101237022 304
670 3300025920 Ga0207649_10164051 Ga0207649_101640512 304
671 3300025920 Ga0207649_10246823 Ga0207649_102468232 304
672 3300025920 Ga0207649_10288216 Ga0207649_102882162 304
673 3300025920 Ga0207649_10381274 Ga0207649_103812741 304
674 3300025921 Ga0207652_10000356 Ga0207652_1000035611 304
675 3300025921 Ga0207652_10034765 Ga0207652_100347654 304
676 3300025921 Ga0207652_10064378 Ga0207652_100643783 304
677 3300025921 Ga0207652_10306738 Ga0207652_103067383 304
678 3300025923 Ga0207681_10000250 Ga0207681_100002507 304
679 3300025923 Ga0207681_10001907 Ga0207681_1000190713 304
680 3300025923 Ga0207681_10051078 Ga0207681_100510784 304
681 3300025923 Ga0207681_10052430 Ga0207681_100524303 304
682 3300025923 Ga0207681_10054598 Ga0207681_100545983 304
683 3300025923 Ga0207681_10244003 Ga0207681_102440032 304
684 3300025925 Ga0207650_10015267 Ga0207650_100152675 304
685 3300025925 Ga0207650_10039476 Ga0207650_100394763 304
686 3300025925 Ga0207650_10042919 Ga0207650_100429195 304
687 3300025925 Ga0207650_10109227 Ga0207650_101092272 304
688 3300025926 Ga0207659_10049852 Ga0207659_100498524 304
689 3300025926 Ga0207659_10051748 Ga0207659_100517482 304
690 3300025926 Ga0207659_10139416 Ga0207659_101394163 304
691 3300025926 Ga0207659_10275147 Ga0207659_102751472 304
692 3300025927 Ga0207687_10003318 Ga0207687_100033185 304
693 3300025927 Ga0207687_10079455 Ga0207687_100794552 304
694 3300025927 Ga0207687_10110731 Ga0207687_101107313 304
695 3300025928 Ga0207700_10037863 Ga0207700_100378633 304
696 3300025928 Ga0207700_10148930 Ga0207700_101489303 304
697 3300025928 Ga0207700_10166989 Ga0207700_101669893 304
698 3300025929 Ga0207664_10036988 Ga0207664_100369884 304
699 3300025929 Ga0207664_10043687 Ga0207664_100436875 304
700 3300025929 Ga0207664_10044944 Ga0207664_100449442 304
701 3300025929 Ga0207664_10109037 Ga0207664_101090372 304
702 3300025929 Ga0207664_10147351 Ga0207664_101473511 304
703 3300025929 Ga0207664_10272938 Ga0207664_102729382 304
704 3300025929 Ga0207664_10624268 Ga0207664_106242681 304
705 3300025931 Ga0207644_10000214 Ga0207644_1000021418 304
706 3300025931 Ga0207644_10000377 Ga0207644_1000037729 304
707 3300025931 Ga0207644_10006352 Ga0207644_100063526 304
708 3300025931 Ga0207644_10006437 Ga0207644_100064371 304
709 3300025931 Ga0207644_10006738 Ga0207644_100067386 304
710 3300025931 Ga0207644_10008630 Ga0207644_100086306 304
711 3300025931 Ga0207644_10010201 Ga0207644_100102016 304
712 3300025931 Ga0207644_10020550 Ga0207644_100205505 304
713 3300025931 Ga0207644_10031319 Ga0207644_100313193 304
714 3300025931 Ga0207644_10042700 Ga0207644_100427002 304
715 3300025931 Ga0207644_10172072 Ga0207644_101720722 304
716 3300025932 Ga0207690_10000045 Ga0207690_1000004589 304
717 3300025932 Ga0207690_10002794 Ga0207690_100027946 304
718 3300025932 Ga0207690_10008018 Ga0207690_100080185 304
719 3300025932 Ga0207690_10009666 Ga0207690_100096665 304
720 3300025932 Ga0207690_10018992 Ga0207690_100189924 304
721 3300025932 Ga0207690_10050503 Ga0207690_100505034 304
722 3300025932 Ga0207690_10067960 Ga0207690_100679604 304
723 3300025932 Ga0207690_10083036 Ga0207690_100830363 304
724 3300025932 Ga0207690_10144333 Ga0207690_101443333 304
725 3300025932 Ga0207690_10154992 Ga0207690_101549923 304
726 3300025933 Ga0207706_10000161 Ga0207706_1000016143 304
727 3300025933 Ga0207706_10000660 Ga0207706_100006607 304
728 3300025933 Ga0207706_10005341 Ga0207706_100053419 304
729 3300025933 Ga0207706_10013172 Ga0207706_100131727 304
730 3300025933 Ga0207706_10015619 Ga0207706_100156198 304
731 3300025933 Ga0207706_10044324 Ga0207706_100443243 304
732 3300025933 Ga0207706_10047492 Ga0207706_100474922 304
733 3300025933 Ga0207706_10048436 Ga0207706_100484364 304
734 3300025933 Ga0207706_10051570 Ga0207706_100515702 304
735 3300025933 Ga0207706_10059505 Ga0207706_100595054 304
736 3300025933 Ga0207706_10062580 Ga0207706_100625805 304
737 3300025933 Ga0207706_10111158 Ga0207706_101111583 304
738 3300025933 Ga0207706_10252246 Ga0207706_102522462 304
739 3300025934 Ga0207686_10013436 Ga0207686_100134365 304
740 3300025934 Ga0207686_10299484 Ga0207686_102994842 304
741 3300025935 Ga0207709_10269904 Ga0207709_102699042 304
742 3300025936 Ga0207670_10119020 Ga0207670_101190202 304
743 3300025937 Ga0207669_10003979 Ga0207669_100039794 304
744 3300025937 Ga0207669_10005841 Ga0207669_100058414 304
745 3300025937 Ga0207669_10020706 Ga0207669_100207063 304
746 3300025937 Ga0207669_10033958 Ga0207669_100339582 304
747 3300025937 Ga0207669_10072003 Ga0207669_100720033 304
748 3300025937 Ga0207669_10152696 Ga0207669_101526962 304
749 3300025937 Ga0207669_10159791 Ga0207669_101597912 304
750 3300025937 Ga0207669_10394220 Ga0207669_103942202 304
751 3300025938 Ga0207704_10001070 Ga0207704_100010705 304
752 3300025938 Ga0207704_10071079 Ga0207704_100710792 304
753 3300025938 Ga0207704_10081623 Ga0207704_100816232 304
754 3300025939 Ga0207665_10131041 Ga0207665_101310413 304
755 3300025940 Ga0207691_10002277 Ga0207691_100022775 304
756 3300025940 Ga0207691_10002553 Ga0207691_1000255318 304
757 3300025940 Ga0207691_10003283 Ga0207691_100032837 304
758 3300025940 Ga0207691_10028103 Ga0207691_100281034 304
759 3300025940 Ga0207691_10056363 Ga0207691_100563634 304
760 3300025941 Ga0207711_10000042 Ga0207711_100000426 304
761 3300025941 Ga0207711_10001092 Ga0207711_1000109223 304
762 3300025941 Ga0207711_10002037 Ga0207711_100020376 304
763 3300025941 Ga0207711_10002492 Ga0207711_100024928 304
764 3300025941 Ga0207711_10003890 Ga0207711_100038909 304
765 3300025941 Ga0207711_10017046 Ga0207711_100170465 304
766 3300025941 Ga0207711_10028155 Ga0207711_100281552 304
767 3300025941 Ga0207711_10030261 Ga0207711_100302614 304
768 3300025941 Ga0207711_10043833 Ga0207711_100438333 304
769 3300025941 Ga0207711_10047359 Ga0207711_100473595 304
770 3300025941 Ga0207711_10102611 Ga0207711_101026113 304
771 3300025941 Ga0207711_10210121 Ga0207711_102101212 304
772 3300025941 Ga0207711_10213348 Ga0207711_102133482 304
773 3300025942 Ga0207689_10000403 Ga0207689_1000040313 304
774 3300025942 Ga0207689_10011314 Ga0207689_100113148 304
775 3300025942 Ga0207689_10011824 Ga0207689_100118242 304
776 3300025944 Ga0207661_10000187 Ga0207661_1000018727 304
777 3300025944 Ga0207661_10013914 Ga0207661_100139145 304
778 3300025944 Ga0207661_10025443 Ga0207661_100254435 304
779 3300025944 Ga0207661_10180286 Ga0207661_101802861 304
780 3300025945 Ga0207679_10000259 Ga0207679_100002598 304
781 3300025945 Ga0207679_10004653 Ga0207679_100046539 304
782 3300025945 Ga0207679_10032529 Ga0207679_100325293 304
783 3300025945 Ga0207679_10041360 Ga0207679_100413605 304
784 3300025945 Ga0207679_10077895 Ga0207679_100778953 304
785 3300025945 Ga0207679_10189779 Ga0207679_101897791 304
786 3300025945 Ga0207679_10254904 Ga0207679_102549043 304
787 3300025949 Ga0207667_10023776 Ga0207667_100237767 304
788 3300025949 Ga0207667_10030112 Ga0207667_100301126 304
789 3300025949 Ga0207667_10090693 Ga0207667_100906933 304
790 3300025949 Ga0207667_10120462 Ga0207667_101204623 304
791 3300025949 Ga0207667_10201410 Ga0207667_102014103 304
792 3300025949 Ga0207667_10269028 Ga0207667_102690281 304
793 3300025949 Ga0207667_10437933 Ga0207667_104379332 304
794 3300025960 Ga0207651_10001209 Ga0207651_1000120913 304
795 3300025960 Ga0207651_10001342 Ga0207651_100013427 304
796 3300025960 Ga0207651_10003812 Ga0207651_100038124 304
797 3300025960 Ga0207651_10011452 Ga0207651_100114523 304
798 3300025960 Ga0207651_10011759 Ga0207651_100117596 304
799 3300025960 Ga0207651_10085253 Ga0207651_100852533 304
800 3300025960 Ga0207651_10143451 Ga0207651_101434512 304
801 3300025961 Ga0207712_10005619 Ga0207712_100056197 304
802 3300025961 Ga0207712_10117378 Ga0207712_101173782 304
803 3300025972 Ga0207668_10000021 Ga0207668_10000021142 304
804 3300025972 Ga0207668_10013664 Ga0207668_100136645 304
805 3300025972 Ga0207668_10038134 Ga0207668_100381341 304
806 3300025981 Ga0207640_10000182 Ga0207640_100001827 304
807 3300025981 Ga0207640_10024733 Ga0207640_100247334 304
808 3300025981 Ga0207640_10033059 Ga0207640_100330594 304
809 3300025981 Ga0207640_10174431 Ga0207640_101744312 304
810 3300025986 Ga0207658_10002468 Ga0207658_100024688 304
811 3300025986 Ga0207658_10002571 Ga0207658_1000257113 304
812 3300025986 Ga0207658_10007079 Ga0207658_100070794 304
813 3300025986 Ga0207658_10008860 Ga0207658_100088609 304
814 3300025986 Ga0207658_10009967 Ga0207658_100099675 304
815 3300025986 Ga0207658_10056825 Ga0207658_100568254 304
816 3300025986 Ga0207658_10071202 Ga0207658_100712023 304
817 3300025986 Ga0207658_10084860 Ga0207658_100848603 304
818 3300025986 Ga0207658_10111184 Ga0207658_101111841 304
819 3300025986 Ga0207658_10132817 Ga0207658_101328173 304
820 3300025986 Ga0207658_10487593 Ga0207658_104875932 304
821 3300026023 Ga0207677_10001023 Ga0207677_100010238 304
822 3300026023 Ga0207677_10009857 Ga0207677_100098575 304
823 3300026023 Ga0207677_10011080 Ga0207677_100110804 304
824 3300026023 Ga0207677_10504023 Ga0207677_105040232 304
825 3300026035 Ga0207703_10001404 Ga0207703_1000140420 304
826 3300026035 Ga0207703_10004700 Ga0207703_100047003 304
827 3300026035 Ga0207703_10005215 Ga0207703_100052154 304
828 3300026035 Ga0207703_10011664 Ga0207703_100116643 304
829 3300026035 Ga0207703_10015254 Ga0207703_100152543 304
830 3300026035 Ga0207703_10026274 Ga0207703_100262743 304
831 3300026035 Ga0207703_10036004 Ga0207703_100360042 304
832 3300026035 Ga0207703_10045405 Ga0207703_100454054 304
833 3300026035 Ga0207703_10045541 Ga0207703_100455413 304
834 3300026041 Ga0207639_10000434 Ga0207639_100004344 304
835 3300026041 Ga0207639_10003254 Ga0207639_100032548 304
836 3300026041 Ga0207639_10051972 Ga0207639_100519722 304
837 3300026041 Ga0207639_10062995 Ga0207639_100629954 304
838 3300026041 Ga0207639_10070294 Ga0207639_100702942 304
839 3300026041 Ga0207639_10195441 Ga0207639_101954413 304
840 3300026041 Ga0207639_10215327 Ga0207639_102153272 304
841 3300026041 Ga0207639_10232319 Ga0207639_102323192 304
842 3300026067 Ga0207678_10001604 Ga0207678_1000160414 304
843 3300026067 Ga0207678_10003597 Ga0207678_100035976 304
844 3300026067 Ga0207678_10014296 Ga0207678_100142965 304
845 3300026067 Ga0207678_10015901 Ga0207678_100159017 304
846 3300026067 Ga0207678_10037051 Ga0207678_100370512 304
847 3300026067 Ga0207678_10062646 Ga0207678_100626462 304
848 3300026067 Ga0207678_10068261 Ga0207678_100682614 304
849 3300026067 Ga0207678_10069542 Ga0207678_100695424 304
850 3300026067 Ga0207678_10076194 Ga0207678_100761944 304
851 3300026067 Ga0207678_10146274 Ga0207678_101462742 304
852 3300026067 Ga0207678_10158898 Ga0207678_101588982 304
853 3300026067 Ga0207678_10216509 Ga0207678_102165092 304
854 3300026078 Ga0207702_10000324 Ga0207702_100003246 304
855 3300026078 Ga0207702_10007017 Ga0207702_100070173 304
856 3300026078 Ga0207702_10007309 Ga0207702_100073095 304
857 3300026078 Ga0207702_10052596 Ga0207702_100525965 304
858 3300026078 Ga0207702_10428489 Ga0207702_104284892 304
859 3300026078 Ga0207702_10613457 Ga0207702_106134572 304
860 3300026088 Ga0207641_10000626 Ga0207641_1000062629 304
861 3300026088 Ga0207641_10008242 Ga0207641_100082423 304
862 3300026088 Ga0207641_10017421 Ga0207641_100174215 304
863 3300026088 Ga0207641_10030844 Ga0207641_100308444 304
864 3300026088 Ga0207641_10036947 Ga0207641_100369474 304
865 3300026088 Ga0207641_10043223 Ga0207641_100432232 304
866 3300026088 Ga0207641_10102971 Ga0207641_101029714 304
867 3300026088 Ga0207641_10122685 Ga0207641_101226854 304
868 3300026088 Ga0207641_10180156 Ga0207641_101801563 304
869 3300026088 Ga0207641_10245683 Ga0207641_102456832 304
870 3300026088 Ga0207641_10300794 Ga0207641_103007942 304
871 3300026088 Ga0207641_10350189 Ga0207641_103501892 304
872 3300026089 Ga0207648_10000857 Ga0207648_100008573 304
873 3300026089 Ga0207648_10003049 Ga0207648_100030493 304
874 3300026089 Ga0207648_10003494 Ga0207648_100034947 304
875 3300026089 Ga0207648_10019137 Ga0207648_100191373 304
876 3300026089 Ga0207648_10075208 Ga0207648_100752083 304
877 3300026095 Ga0207676_10000194 Ga0207676_1000019417 304
878 3300026095 Ga0207676_10003816 Ga0207676_1000381610 304
879 3300026095 Ga0207676_10006287 Ga0207676_100062878 304
880 3300026095 Ga0207676_10006503 Ga0207676_100065037 304
881 3300026095 Ga0207676_10018431 Ga0207676_100184313 304
882 3300026095 Ga0207676_10021255 Ga0207676_100212555 304
883 3300026095 Ga0207676_10042482 Ga0207676_100424825 304
884 3300026095 Ga0207676_10068673 Ga0207676_100686731 304
885 3300026095 Ga0207676_10080658 Ga0207676_100806583 304
886 3300026116 Ga0207674_10000322 Ga0207674_1000032230 304
887 3300026116 Ga0207674_10000344 Ga0207674_1000034440 304
888 3300026116 Ga0207674_10001626 Ga0207674_1000162627 304
889 3300026116 Ga0207674_10003716 Ga0207674_1000371611 304
890 3300026116 Ga0207674_10004951 Ga0207674_100049515 304
891 3300026116 Ga0207674_10032002 Ga0207674_100320027 304
892 3300026116 Ga0207674_10063538 Ga0207674_100635383 304
893 3300026116 Ga0207674_10076735 Ga0207674_100767355 304
894 3300026118 Ga0207675_100045562 Ga0207675_1000455623 304
895 3300026118 Ga0207675_100134977 Ga0207675_1001349772 304
896 3300026121 Ga0207683_10000636 Ga0207683_1000063624 304
897 3300026121 Ga0207683_10002836 Ga0207683_100028367 304
898 3300026121 Ga0207683_10013482 Ga0207683_100134827 304
899 3300026121 Ga0207683_10030752 Ga0207683_100307523 304
900 3300026121 Ga0207683_10047282 Ga0207683_100472824 304
901 3300026121 Ga0207683_10051628 Ga0207683_100516285 304
902 3300026121 Ga0207683_10059873 Ga0207683_100598735 304
903 3300026142 Ga0207698_10000527 Ga0207698_1000052715 304
904 3300026142 Ga0207698_10000780 Ga0207698_1000078018 304
905 3300026142 Ga0207698_10007780 Ga0207698_100077802 304
906 3300026142 Ga0207698_10011485 Ga0207698_100114854 304
907 3300026142 Ga0207698_10011537 Ga0207698_100115377 304
908 3300026142 Ga0207698_10016480 Ga0207698_100164804 304
909 3300026142 Ga0207698_10018573 Ga0207698_100185734 304
910 3300026142 Ga0207698_10026214 Ga0207698_100262144 304
911 3300026142 Ga0207698_10072707 Ga0207698_100727073 304
912 3300026142 Ga0207698_10083226 Ga0207698_100832264 304
913 3300026142 Ga0207698_10143925 Ga0207698_101439252 304
914 3300026142 Ga0207698_10171417 Ga0207698_101714172 304
915 3300026142 Ga0207698_10181745 Ga0207698_101817453 304
916 3300026142 Ga0207698_10587102 Ga0207698_105871022 304
917 3300028379 Ga0268266_10000600 Ga0268266_1000060037 304
918 3300028379 Ga0268266_10013082 Ga0268266_100130827 304
919 3300028379 Ga0268266_10021573 Ga0268266_100215734 304
920 3300028379 Ga0268266_10045071 Ga0268266_100450715 304
921 3300028379 Ga0268266_10365409 Ga0268266_103654091 304
922 3300028380 Ga0268265_10143799 Ga0268265_101437993 304
923 3300028380 Ga0268265_10165074 Ga0268265_101650743 304
924 3300028381 Ga0268264_10004576 Ga0268264_100045764 304
925 3300028381 Ga0268264_10004618 Ga0268264_1000461813 304
926 3300028381 Ga0268264_10017268 Ga0268264_100172686 304
927 3300028381 Ga0268264_10128678 Ga0268264_101286783 304
928 3300028381 Ga0268264_10205951 Ga0268264_102059513 304
929 3300031548 Ga0307408_100203345 Ga0307408_1002033452 304
930 3300031548 Ga0307408_100471101 Ga0307408_1004711011 304
931 3300031731 Ga0307405_10053667 Ga0307405_100536672 304
932 3300031731 Ga0307405_10181506 Ga0307405_101815062 304
933 3300031824 Ga0307413_10008267 Ga0307413_100082675 304
934 3300031824 Ga0307413_10199872 Ga0307413_101998722 304
935 3300031824 Ga0307413_10292252 Ga0307413_102922522 304
936 3300031852 Ga0307410_10002245 Ga0307410_100022456 304
937 3300031852 Ga0307410_10014471 Ga0307410_100144715 304
938 3300031852 Ga0307410_10060530 Ga0307410_100605304 304
939 3300031852 Ga0307410_10100521 Ga0307410_101005213 304
940 3300031852 Ga0307410_10117689 Ga0307410_101176893 304
941 3300031901 Ga0307406_10085071 Ga0307406_100850711 304
942 3300031903 Ga0307407_10044947 Ga0307407_100449473 304
943 3300031903 Ga0307407_10053977 Ga0307407_100539773 304
944 3300031903 Ga0307407_10081298 Ga0307407_100812982 304
945 3300031903 Ga0307407_10177319 Ga0307407_101773193 304
946 3300031911 Ga0307412_10088581 Ga0307412_100885813 304
947 3300031911 Ga0307412_10102812 Ga0307412_101028122 304
948 3300031911 Ga0307412_10528877 Ga0307412_105288771 304
949 3300031995 Ga0307409_100097121 Ga0307409_1000971213 304
950 3300031995 Ga0307409_100185966 Ga0307409_1001859663 304
951 3300031995 Ga0307409_100283484 Ga0307409_1002834843 304
952 3300031995 Ga0307409_100419830 Ga0307409_1004198301 304
953 3300032002 Ga0307416_100055345 Ga0307416_1000553454 304
954 3300032002 Ga0307416_100063883 Ga0307416_1000638833 304
955 3300032002 Ga0307416_100340902 Ga0307416_1003409022 304
956 3300032004 Ga0307414_10023363 Ga0307414_100233633 304
957 3300032004 Ga0307414_10099967 Ga0307414_100999671 304
958 3300032004 Ga0307414_10152794 Ga0307414_101527942 304
959 3300032004 Ga0307414_10339785 Ga0307414_103397852 304
960 3300032005 Ga0307411_10013123 Ga0307411_100131233 304
961 3300032005 Ga0307411_10015399 Ga0307411_100153996 304
962 3300032005 Ga0307411_10039899 Ga0307411_100398994 304
963 3300032005 Ga0307411_10125268 Ga0307411_101252682 304
964 3300032005 Ga0307411_10366097 Ga0307411_103660971 304
965 3300032126 Ga0307415_100036319 Ga0307415_1000363194 304
966 3300032126 Ga0307415_100051385 Ga0307415_1000513854 304
967 3300032126 Ga0307415_100075503 Ga0307415_1000755034 304
968 3300035088 Ga0373940_0026166 Ga0373940_0026166_549_1463 304
969 3300035090 Ga0373949_0017027 Ga0373949_0017027_364_1278 304
970 3300035112 Ga0373932_0038841 Ga0373932_0038841_401_1315 304
971 3300035117 Ga0373953_0089308 Ga0373953_0089308_165_1079 304
972 3300035121 Ga0373960_0012655 Ga0373960_0012655_993_1907 304
973 3300035170 Ga0373943_0004324 Ga0373943_0004324_4811_5725 304
974 3300035170 Ga0373943_0174803 Ga0373943_0174803_243_1157 304
975 3300035172 Ga0373955_0095908 Ga0373955_0095908_743_1657 304
976 3300035692 Ga0373935_0011883 Ga0373935_0011883_3224_4138 304
977 3300035724 Ga0373933_0037910 Ga0373933_0037910_493_1407 304
978 3300037312 Ga0395899_0000372 Ga0395899_0000372_14096_15010 304
979 3300037312 Ga0395899_0013913 Ga0395899_0013913_2813_3727 304
980 3300037312 Ga0395899_0018782 Ga0395899_0018782_2865_3779 304
981 3300037312 Ga0395899_0019836 Ga0395899_0019836_3376_4290 304
982 3300037312 Ga0395899_0021544 Ga0395899_0021544_2426_3340 304
983 3300037312 Ga0395899_0029932 Ga0395899_0029932_1071_1985 304
984 3300037312 Ga0395899_0042075 Ga0395899_0042075_870_1784 304
985 3300037312 Ga0395899_0109639 Ga0395899_0109639_629_1543 304
986 3300037312 Ga0395899_0117337 Ga0395899_0117337_246_1160 304
987 3300037312 Ga0395899_0131240 Ga0395899_0131240_710_1624 304
988 3300037312 Ga0395899_0131279 Ga0395899_0131279_846_1760 304
989 3300037312 Ga0395899_0184269 Ga0395899_0184269_244_1158 304
990 3300037312 Ga0395899_0218378 Ga0395899_0218378_166_1080 304
991 3300037312 Ga0395899_0218421 Ga0395899_0218421_14_928 304
992 3300037312 Ga0395899_0221206 Ga0395899_0221206_244_1158 304
993 3300037312 Ga0395899_0221232 Ga0395899_0221232_154_1068 304
994 3300037418 Ga0395900_0000240 Ga0395900_0000240_54594_55508 304
995 3300037418 Ga0395900_0000703 Ga0395900_0000703_16261_17175 304
996 3300037418 Ga0395900_0000764 Ga0395900_0000764_33527_34441 304
997 3300037418 Ga0395900_0006967 Ga0395900_0006967_4616_5530 304
998 3300037418 Ga0395900_0009569 Ga0395900_0009569_2973_3887 304
999 3300037418 Ga0395900_0009815 Ga0395900_0009815_874_1788 304
1000 3300037418 Ga0395900_0020505 Ga0395900_0020505_94_1008 304
1001 3300037418 Ga0395900_0032467 Ga0395900_0032467_816_1730 304
1002 3300037418 Ga0395900_0042039 Ga0395900_0042039_169_1083 304
1003 3300037418 Ga0395900_0044017 Ga0395900_0044017_2044_2958 304
1004 3300037418 Ga0395900_0056244 Ga0395900_0056244_2384_3298 304
1005 3300037418 Ga0395900_0071287 Ga0395900_0071287_49_963 304
1006 3300037418 Ga0395900_0079644 Ga0395900_0079644_2399_3313 304
1007 3300037418 Ga0395900_0081537 Ga0395900_0081537_976_1890 304
1008 3300037418 Ga0395900_0091720 Ga0395900_0091720_1338_2252 304
1009 3300037418 Ga0395900_0102061 Ga0395900_0102061_49_963 304
1010 3300037418 Ga0395900_0152416 Ga0395900_0152416_1419_2333 304
1011 3300037418 Ga0395900_0160818 Ga0395900_0160818_318_1232 304
1012 3300037418 Ga0395900_0187187 Ga0395900_0187187_215_1129 304
1013 3300037418 Ga0395900_0231957 Ga0395900_0231957_678_1592 304
1014 3300037418 Ga0395900_0237976 Ga0395900_0237976_703_1617 304
1015 3300037418 Ga0395900_0259671 Ga0395900_0259671_113_1027 304
1016 3300037418 Ga0395900_0337455 Ga0395900_0337455_511_1425 304
1017 3300037418 Ga0395900_0341846 Ga0395900_0341846_72_986 304
1018 3300037418 Ga0395900_0385472 Ga0395900_0385472_349_1263 304
1019 3300037418 Ga0395900_0387058 Ga0395900_0387058_71_985 304
1020 3300037418 Ga0395900_0411012 Ga0395900_0411012_319_1233 304
1021 3300037418 Ga0395900_0433922 Ga0395900_0433922_243_1157 304
1022 3300037418 Ga0395900_0571202 Ga0395900_0571202_80_994 304
1023 3300037466 Ga0395898_0000619 Ga0395898_0000619_8206_9120 304
1024 3300037466 Ga0395898_0007467 Ga0395898_0007467_2706_3620 304
1025 3300037466 Ga0395898_0021463 Ga0395898_0021463_2865_3779 304
1026 3300037466 Ga0395898_0028931 Ga0395898_0028931_3204_4118 304
1027 3300037466 Ga0395898_0035223 Ga0395898_0035223_2169_3083 304
1028 3300037466 Ga0395898_0036491 Ga0395898_0036491_1890_2804 304
1029 3300037466 Ga0395898_0069323 Ga0395898_0069323_870_1784 304
1030 3300037466 Ga0395898_0083356 Ga0395898_0083356_292_1206 304
1031 3300037466 Ga0395898_0083630 Ga0395898_0083630_636_1550 304
1032 3300037466 Ga0395898_0098471 Ga0395898_0098471_374_1288 304
1033 3300037466 Ga0395898_0109907 Ga0395898_0109907_1313_2227 304
1034 3300037466 Ga0395898_0188771 Ga0395898_0188771_923_1837 304
1035 3300037466 Ga0395898_0312873 Ga0395898_0312873_182_1096 304
1036 3300037466 Ga0395898_0357967 Ga0395898_0357967_148_1062 304
1037 3300037466 Ga0395898_0415302 Ga0395898_0415302_95_1009 304
1038 3300037466 Ga0395898_0652404 Ga0395898_0652404_61_975 304
1039 3300037471 Ga0395905_0000219 Ga0395905_0000219_56014_56928 304
1040 3300037471 Ga0395905_0000259 Ga0395905_0000259_30502_31416 304
1041 3300037471 Ga0395905_0000627 Ga0395905_0000627_11424_12338 304
1042 3300037471 Ga0395905_0002653 Ga0395905_0002653_2484_3398 304
1043 3300037471 Ga0395905_0003045 Ga0395905_0003045_10276_11190 304
1044 3300037471 Ga0395905_0004674 Ga0395905_0004674_8080_8994 304
1045 3300037471 Ga0395905_0013463 Ga0395905_0013463_2418_3332 304
1046 3300037471 Ga0395905_0014451 Ga0395905_0014451_2912_3826 304
1047 3300037471 Ga0395905_0017316 Ga0395905_0017316_1558_2472 304
1048 3300037471 Ga0395905_0017532 Ga0395905_0017532_1354_2268 304
1049 3300037471 Ga0395905_0019396 Ga0395905_0019396_2547_3461 304
1050 3300037471 Ga0395905_0021249 Ga0395905_0021249_4578_5492 304
1051 3300037471 Ga0395905_0021418 Ga0395905_0021418_1057_1971 304
1052 3300037471 Ga0395905_0026188 Ga0395905_0026188_3397_4311 304
1053 3300037471 Ga0395905_0027179 Ga0395905_0027179_2315_3229 304
1054 3300037471 Ga0395905_0033153 Ga0395905_0033153_1457_2371 304
1055 3300037471 Ga0395905_0034490 Ga0395905_0034490_991_1905 304
1056 3300037471 Ga0395905_0044710 Ga0395905_0044710_2904_3818 304
1057 3300037471 Ga0395905_0051019 Ga0395905_0051019_2092_3006 304
1058 3300037471 Ga0395905_0089815 Ga0395905_0089815_640_1554 304
1059 3300037471 Ga0395905_0110840 Ga0395905_0110840_1539_2453 304
1060 3300037471 Ga0395905_0119628 Ga0395905_0119628_543_1457 304
1061 3300037471 Ga0395905_0132999 Ga0395905_0132999_82_996 304
1062 3300037471 Ga0395905_0140668 Ga0395905_0140668_1047_1961 304
1063 3300037471 Ga0395905_0148412 Ga0395905_0148412_27_941 304
1064 3300037471 Ga0395905_0156115 Ga0395905_0156115_367_1281 304
1065 3300037471 Ga0395905_0228802 Ga0395905_0228802_612_1526 304
1066 3300037471 Ga0395905_0252570 Ga0395905_0252570_72_986 304
1067 3300037471 Ga0395905_0284811 Ga0395905_0284811_37_951 304
1068 3300037471 Ga0395905_0329802 Ga0395905_0329802_410_1324 304
1069 3300037471 Ga0395905_0334313 Ga0395905_0334313_17_931 304
1070 3300037471 Ga0395905_0351894 Ga0395905_0351894_275_1189 304
1071 3300037471 Ga0395905_0435956 Ga0395905_0435956_199_1113 304
1072 3300037471 Ga0395905_0484828 Ga0395905_0484828_129_1043 304
1073 3300037853 Ga0436364_0612163 Ga0436364_0612163_16716_17630 304
1074 3300038443 Ga0395901_0001641 Ga0395901_0001641_14295_15209 304
1075 3300038443 Ga0395901_0004422 Ga0395901_0004422_146_1060 304
1076 3300038443 Ga0395901_0005146 Ga0395901_0005146_9519_10433 304
1077 3300038443 Ga0395901_0009829 Ga0395901_0009829_2134_3048 304
1078 3300038443 Ga0395901_0028941 Ga0395901_0028941_3464_4378 304
1079 3300038443 Ga0395901_0074130 Ga0395901_0074130_870_1784 304
1080 3300038443 Ga0395901_0074757 Ga0395901_0074757_1898_2812 304
1081 3300038443 Ga0395901_0081528 Ga0395901_0081528_357_1271 304
1082 3300038443 Ga0395901_0107771 Ga0395901_0107771_1787_2701 304
1083 3300038443 Ga0395901_0111681 Ga0395901_0111681_1653_2567 304
1084 3300038443 Ga0395901_0118405 Ga0395901_0118405_1031_1945 304
1085 3300038443 Ga0395901_0119574 Ga0395901_0119574_1086_2000 304
1086 3300038443 Ga0395901_0129010 Ga0395901_0129010_929_1843 304
1087 3300038443 Ga0395901_0155434 Ga0395901_0155434_1051_1965 304
1088 3300038443 Ga0395901_0163831 Ga0395901_0163831_788_1702 304
1089 3300038443 Ga0395901_0167230 Ga0395901_0167230_808_1722 304
1090 3300038443 Ga0395901_0175314 Ga0395901_0175314_1218_2132 304
1091 3300038443 Ga0395901_0180614 Ga0395901_0180614_57_971 304
1092 3300038443 Ga0395901_0183450 Ga0395901_0183450_50_964 304
1093 3300038443 Ga0395901_0216042 Ga0395901_0216042_42_956 304
1094 3300038443 Ga0395901_0360297 Ga0395901_0360297_504_1418 304
1095 3300038443 Ga0395901_0373544 Ga0395901_0373544_337_1251 304
1096 3300038443 Ga0395901_0405330 Ga0395901_0405330_189_1103 304
1097 3300038443 Ga0395901_0409533 Ga0395901_0409533_429_1343 304
1098 3300038443 Ga0395901_0489377 Ga0395901_0489377_154_1068 304
1099 3300038443 Ga0395901_0507157 Ga0395901_0507157_249_1163 304
1100 3300038443 Ga0395901_0562349 Ga0395901_0562349_87_1001 304
1101 3300038443 Ga0395901_0711719 Ga0395901_0711719_63_977 304
1102 3300039437 Ga0436365_0174261 Ga0436365_0174261_21323_22237 304
1103 3300042005 Ga0439448_0002960 Ga0439448_0002960_1376_2290 304
1104 3300042006 Ga0439432_023802 Ga0439432_023802_779_1693 304
1105 3300042157 Ga0439458_0000559 Ga0439458_0000559_6224_7138 304
1106 3300042157 Ga0439458_0001765 Ga0439458_0001765_363_1277 304
1107 3300042439 Ga0439464_0000922 Ga0439464_0000922_1670_2584 304
1108 3300044656 Ga0466969_0022242 Ga0466969_0022242_681_1595 304
1109 3300044658 Ga0466972_0027337 Ga0466972_0027337_1467_2381 304
1110 3300044658 Ga0466972_0112403 Ga0466972_0112403_135_1049 304
1111 3300044683 Ga0466965_0040933 Ga0466965_0040933_53_967 304
1112 3300044684 Ga0466966_0003928 Ga0466966_0003928_2927_3841 304
1113 3300044684 Ga0466966_0036123 Ga0466966_0036123_1984_2898 304
1114 3300044684 Ga0466966_0176589 Ga0466966_0176589_182_1096 304
1115 3300044693 Ga0466961_0011363 Ga0466961_0011363_523_1437 304
1116 3300044693 Ga0466961_0056257 Ga0466961_0056257_1132_2046 304
1117 3300044694 Ga0466963_0006667 Ga0466963_0006667_1571_2485 304
1118 3300044694 Ga0466963_0015006 Ga0466963_0015006_318_1232 304
1119 3300044694 Ga0466963_0022983 Ga0466963_0022983_2763_3677 304
1120 3300044694 Ga0466963_0024760 Ga0466963_0024760_624_1538 304
1121 3300044694 Ga0466963_0034218 Ga0466963_0034218_1259_2173 304
1122 3300044694 Ga0466963_0039949 Ga0466963_0039949_1797_2711 304
1123 3300044694 Ga0466963_0067971 Ga0466963_0067971_606_1520 304
1124 3300044694 Ga0466963_0084830 Ga0466963_0084830_816_1730 304
1125 3300044694 Ga0466963_0105742 Ga0466963_0105742_954_1868 304
1126 3300044694 Ga0466963_0325193 Ga0466963_0325193_77_991 304
1127 3300044706 Ga0466964_0032722 Ga0466964_0032722_598_1512 304
1128 3300044706 Ga0466964_0093637 Ga0466964_0093637_150_1064 304
1129 3300044719 Ga0466971_0032249 Ga0466971_0032249_243_1157 304
1130 3300044719 Ga0466971_0033255 Ga0466971_0033255_1259_2173 304
1131 3300044719 Ga0466971_0042871 Ga0466971_0042871_615_1529 304
1132 3300044765 Ga0466970_0095793 Ga0466970_0095793_12_926 304
1133 3300044842 Ga0466957_0002027 Ga0466957_0002027_3557_4471 304
1134 3300044842 Ga0466957_0002685 Ga0466957_0002685_4783_5697 304
1135 3300044842 Ga0466957_0010471 Ga0466957_0010471_4389_5303 304
1136 3300044842 Ga0466957_0071501 Ga0466957_0071501_1046_1960 304
1137 3300044842 Ga0466957_0144447 Ga0466957_0144447_176_1090 304
1138 3300044842 Ga0466957_0216235 Ga0466957_0216235_66_980 304
1139 3300044901 Ga0466960_0025899 Ga0466960_0025899_398_1312 304
1140 3300045049 Ga0466959_0068216 Ga0466959_0068216_358_1272 304
1141 3300045049 Ga0466959_0174095 Ga0466959_0174095_329_1243 304
1142 3300045049 Ga0466959_0182553 Ga0466959_0182553_334_1248 304
1143 3300045836 Ga0466958_0025243 Ga0466958_0025243_1792_2706 304
1144 3300045836 Ga0466958_0028463 Ga0466958_0028463_851_1765 304
1145 3300045836 Ga0466958_0072792 Ga0466958_0072792_1004_1918 304
1146 3300045836 Ga0466958_0078150 Ga0466958_0078150_316_1230 304
1147 3300045976 Ga0466967_0000381 Ga0466967_0000381_3363_4277 304
1148 3300045976 Ga0466967_0003611 Ga0466967_0003611_4945_5859 304
1149 3300045976 Ga0466967_0007454 Ga0466967_0007454_2392_3306 304
1150 3300045976 Ga0466967_0015627 Ga0466967_0015627_1916_2830 304
1151 3300045976 Ga0466967_0063233 Ga0466967_0063233_1747_2661 304
1152 3300045976 Ga0466967_0100305 Ga0466967_0100305_1510_2424 304
1153 3300045976 Ga0466967_0103000 Ga0466967_0103000_325_1239 304
1154 3300045976 Ga0466967_0111042 Ga0466967_0111042_218_1132 304
1155 3300045976 Ga0466967_0134300 Ga0466967_0134300_186_1100 304
1156 3300045976 Ga0466967_0182249 Ga0466967_0182249_445_1359 304
1157 3300045976 Ga0466967_0594890 Ga0466967_0594890_90_1004 304
1158 3300046472 Ga0495580_0133007 Ga0495580_0133007_77_991 304
1159 3300046525 Ga0495663_0055456 Ga0495663_0055456_39_953 304
1160 3300046537 Ga0495598_0003591 Ga0495598_0003591_1016_1930 304
1161 3300046539 Ga0495621_0005957 Ga0495621_0005957_2471_3385 304
1162 3300046616 Ga0495668_0017279 Ga0495668_0017279_2288_3202 304
1163 3300046684 Ga0495669_0023280 Ga0495669_0023280_1437_2351 304
1164 3300046684 Ga0495669_0056519 Ga0495669_0056519_317_1231 304
1165 3300046691 Ga0495670_0018868 Ga0495670_0018868_891_1805 304
1166 3300047445 Ga0495677_0072718 Ga0495677_0072718_171_1085 304
1167 3300048088 Ga0495602_0155291 Ga0495602_0155291_76_990 304
1168 3300048903 Ga0496100_0005362 Ga0496100_0005362_4097_5011 304
1169 3300048903 Ga0496100_0137466 Ga0496100_0137466_564_1478 304
1170 3300048904 Ga0496101_0001845 Ga0496101_0001845_7611_8525 304
1171 3300048904 Ga0496101_0089785 Ga0496101_0089785_720_1634 304
1172 3300048904 Ga0496101_0146966 Ga0496101_0146966_371_1285 304
1173 3300048904 Ga0496101_0464907 Ga0496101_0464907_32_946 304
1174 3300048905 Ga0496102_0540707 Ga0496102_0540707_137_1051 304
1175 3300048907 Ga0496104_0063254 Ga0496104_0063254_1853_2767 304
1176 3300048907 Ga0496104_0148252 Ga0496104_0148252_937_1851 304
1177 3300048907 Ga0496104_0258463 Ga0496104_0258463_719_1633 304
1178 3300048908 Ga0496105_0035375 Ga0496105_0035375_2538_3452 304
1179 3300048908 Ga0496105_0086958 Ga0496105_0086958_124_1038 304
1180 3300048909 Ga0496106_0002590 Ga0496106_0002590_663_1577 304
1181 3300048909 Ga0496106_0024920 Ga0496106_0024920_1443_2357 304
1182 3300048909 Ga0496106_0032636 Ga0496106_0032636_1801_2715 304
1183 3300048910 Ga0496107_0002051 Ga0496107_0002051_7444_8358 304
1184 3300048910 Ga0496107_0003122 Ga0496107_0003122_5471_6385 304
1185 3300048910 Ga0496107_0148044 Ga0496107_0148044_744_1658 304
1186 3300048911 Ga0496108_0010742 Ga0496108_0010742_5200_6114 304
1187 3300048911 Ga0496108_0011705 Ga0496108_0011705_1587_2501 304
1188 3300048911 Ga0496108_0014779 Ga0496108_0014779_5281_6195 304
1189 3300048911 Ga0496108_0016413 Ga0496108_0016413_2954_3868 304
1190 3300048911 Ga0496108_0051888 Ga0496108_0051888_33_947 304
1191 3300048911 Ga0496108_0252026 Ga0496108_0252026_43_957 304
1192 3300048912 Ga0496109_0011964 Ga0496109_0011964_4820_5734 304
1193 3300048912 Ga0496109_0014535 Ga0496109_0014535_5917_6831 304
1194 3300048912 Ga0496109_0027613 Ga0496109_0027613_2340_3254 304
1195 3300048912 Ga0496109_0038420 Ga0496109_0038420_3262_4176 304
1196 3300048912 Ga0496109_0071775 Ga0496109_0071775_1242_2156 304
1197 3300048912 Ga0496109_0106396 Ga0496109_0106396_1427_2341 304
1198 3300048912 Ga0496109_0132943 Ga0496109_0132943_1255_2169 304
1199 3300048912 Ga0496109_0205886 Ga0496109_0205886_546_1460 304
1200 3300048913 Ga0496110_0009431 Ga0496110_0009431_4654_5568 304
1201 3300048913 Ga0496110_0029480 Ga0496110_0029480_700_1614 304
1202 3300048913 Ga0496110_0036846 Ga0496110_0036846_1741_2655 304
1203 3300048913 Ga0496110_0056128 Ga0496110_0056128_1254_2168 304
1204 3300048913 Ga0496110_0127609 Ga0496110_0127609_719_1633 304
1205 3300048914 Ga0496111_0001035 Ga0496111_0001035_5899_6813 304
1206 3300048914 Ga0496111_0003669 Ga0496111_0003669_3840_4754 304
1207 3300048914 Ga0496111_0004529 Ga0496111_0004529_2997_3911 304
1208 3300048914 Ga0496111_0023837 Ga0496111_0023837_2227_3141 304
1209 3300048914 Ga0496111_0127951 Ga0496111_0127951_390_1304 304
1210 3300048915 Ga0496112_0002414 Ga0496112_0002414_7536_8450 304
1211 3300048915 Ga0496112_0005570 Ga0496112_0005570_8397_9311 304
1212 3300048915 Ga0496112_0013316 Ga0496112_0013316_3289_4203 304
1213 3300048915 Ga0496112_0030618 Ga0496112_0030618_17_931 304
1214 3300048915 Ga0496112_0049292 Ga0496112_0049292_1071_1985 304
1215 3300048915 Ga0496112_0064162 Ga0496112_0064162_361_1275 304
1216 3300048915 Ga0496112_0076688 Ga0496112_0076688_1313_2227 304
1217 3300048915 Ga0496112_0218483 Ga0496112_0218483_558_1472 304
1218 3300048915 Ga0496112_0286192 Ga0496112_0286192_227_1141 304
1219 3300048915 Ga0496112_0514119 Ga0496112_0514119_84_998 304
1220 3300048916 Ga0496113_0014613 Ga0496113_0014613_148_1062 304
1221 3300048916 Ga0496113_0018400 Ga0496113_0018400_1488_2402 304
1222 3300048916 Ga0496113_0025796 Ga0496113_0025796_243_1157 304
1223 3300048916 Ga0496113_0077172 Ga0496113_0077172_1184_2098 304
1224 3300048917 Ga0496114_0000206 Ga0496114_0000206_36754_37668 304
1225 3300049704 Ga0501221_010780 Ga0501221_010780_452_1366 304
1226 3300049765 Ga0501268_007562 Ga0501268_007562_485_1399 304
1227 3300049823 Ga0501044_0215498 Ga0501044_0215498_148_1062 304
1228 3300050512 nmdc:mga0n895_170208_c1 nmdc:mga0n895_170208_c1_508_1422 304
1229 3300050515 nmdc:mga0a205_6441_c1 nmdc:mga0a205_6441_c1_2267_3181 304
1230 3300053134 Ga0500658_0000088 Ga0500658_0000088_40050_40964 304
1231 3300061719 Ga0466962_0036472 Ga0466962_0036472_1249_2163 304
1232 3300061719 Ga0466962_0036981 Ga0466962_0036981_86_1000 304
1233 3300061719 Ga0466962_0100113 Ga0466962_0100113_465_1379 304

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00348

polyprenyl_synt

Polyprenyl synthetase

39

290

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4llt-assembly1.cif.gz_B crystal structure of a farnesyl diphosphate synthase from roseobacter denitrificans och 114, target efi-509393, with two ipp and calcium bound in active site 0.9643 12 304
3m0g-assembly1.cif.gz_A crystal structure of putative farnesyl diphosphate synthase from rhodobacter capsulatus 0.961 13 301
4llt-assembly1.cif.gz_B crystal structure of a farnesyl diphosphate synthase from roseobacter denitrificans och 114, target efi-509393, with two ipp and calcium bound in active site 0.9578 12 304
3m0g-assembly1.cif.gz_B crystal structure of putative farnesyl diphosphate synthase from rhodobacter capsulatus 0.9562 13 302
3m0g-assembly1.cif.gz_A crystal structure of putative farnesyl diphosphate synthase from rhodobacter capsulatus 0.9539 13 301
ID Description Score Start End Superfamily
3m0gA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9528 13 301 1.10.600.10
4kkmB00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9484 10 299 1.10.600.10
3m0gA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9456 13 301 1.10.600.10
3zcdA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9439 13 302 1.10.600.10
4kkmB00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9385 10 299 1.10.600.10
ID Description Score Start End GO Terms
AF-A0A4Q2ZHZ1-F1-model_v4 Polyprenyl synthetase family protein 0.9923 12 163 GO:0004659
GO:0008299
AF-A0A520I5E3-F1-model_v4 Polyprenyl synthetase family protein 0.9902 14 151 GO:0004659
GO:0008299
AF-A0A840F7R2-F1-model_v4 Farnesyl diphosphate synthase (EC 2.5.1.1, EC 2.5.1.10) 0.987 9 304 GO:0004659
GO:0005737
GO:0008299
AF-A0A7V8KNK5-F1-model_v4 deleted 0.9861 66 304
AF-A0A418WKN5-F1-model_v4 Polyprenyl synthetase family protein 0.983 8 304 GO:0004659
GO:0005737
GO:0008299

Feature Viewer

pLDDT pTM Quality
90.37 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map