F491993

General Info

Members Datasets Scaffolds Average Seq Length
1231 453 1030 253

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10000313|Ga0105243_1000031332
Length 295
Sequence MRQCDDSAKRPTAGVDWPPAKETVMGSILTLRHYTHDLIAHSHEHAQLVFGLRGQLDFEVEGQGSRVQQQSFVVVPAGARHVCGSPSGSHCLVLDIPGEHWVQQSLGEHAEASRRLLDAPRHQVLGPSQSRLVNWLADSPVDDPLIAQQGAVLLLASLNHRADSQPRERRLPYAALNAHIDHHAAHPLQVADLARIAGLSAARLHARFIAECGASPMEYVRRRRLHMALELLRGSTLPMGEIASRVGYSSQSAFAAAILRQYGHSPRQLRQGADASPSTKNARIATDQQAAPPVD

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231010 Pseudomonas sp. GM25 Isolate Nodule
8 2511231011 Pseudomonas sp. GM30 Isolate Nodule
9 2511231012 Pseudomonas sp. GM33 Isolate Nodule
10 2511231014 Pseudomonas sp. GM48 Isolate Nodule
11 2511231015 Pseudomonas sp. GM49 Isolate Nodule
12 2511231016 Pseudomonas sp. GM50 Isolate Nodule
13 2511231017 Pseudomonas sp. GM55 Isolate Nodule
14 2511231018 Pseudomonas sp. GM60 Isolate Nodule
15 2511231019 Pseudomonas sp. GM67 Isolate Nodule
16 2511231020 Pseudomonas sp. GM74 Isolate Nodule
17 2511231021 Pseudomonas sp. GM78 Isolate Nodule
18 2511231022 Pseudomonas sp. GM79 Isolate Nodule
19 2511231023 Pseudomonas sp. GM80 Isolate Nodule
20 2511231031 Pseudomonas sp. GM16 Isolate Nodule
21 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
22 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
23 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
24 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
25 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
26 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
27 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
28 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
29 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
30 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
31 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
32 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
33 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
34 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
35 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
36 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
37 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
38 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
39 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
40 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
41 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
42 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
43 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
44 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
45 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
46 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
47 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
48 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
49 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
50 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
51 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
52 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
53 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
54 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
55 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
56 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
57 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
58 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
59 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
60 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
61 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
62 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
63 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
64 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
65 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
66 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
67 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
68 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
69 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
70 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
71 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
72 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
73 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
74 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
75 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
76 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
77 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
78 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
79 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
80 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
81 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
82 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
83 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
84 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
85 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
86 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
87 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
88 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
89 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
90 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
91 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
92 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
93 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
94 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
95 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
96 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
97 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
98 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
99 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
100 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
101 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
102 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
103 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
104 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
105 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
106 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
107 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
108 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
109 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
110 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
111 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
112 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
113 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
114 2773857670 Pseudomonas sp. 478 Isolate Unclassified
115 2773857673 Pseudomonas sp. 443 Isolate Unclassified
116 2784132063 Pseudomonas sp. 424 Isolate Unclassified
117 2784132072 Pseudomonas sp. 460 Isolate Unclassified
118 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
119 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
120 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
121 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
122 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
123 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
124 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
125 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
126 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
127 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
128 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
129 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
130 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
131 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
132 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
133 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
134 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
135 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
136 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
137 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
138 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
139 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
140 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
141 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
142 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
143 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
144 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
145 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
146 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
147 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
148 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
149 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
150 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
151 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
152 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
153 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
154 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
155 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
156 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
157 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
158 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
159 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
160 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
161 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
162 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
163 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
164 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
165 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
166 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
167 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
168 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
169 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
170 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
171 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
172 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
173 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
174 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
175 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
176 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
177 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
178 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
179 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
180 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
181 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
182 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
183 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
184 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
185 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
186 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
187 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
188 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
189 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
190 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
191 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
192 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
193 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
194 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
195 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
196 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
197 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
198 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
199 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
200 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
201 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
202 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
203 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
204 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
205 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
206 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
207 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
208 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
209 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
210 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
211 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
212 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
213 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
214 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
215 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
216 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
217 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
218 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
219 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
220 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
221 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
222 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
223 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
224 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
225 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
226 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
227 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
228 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
229 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
230 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
231 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
232 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
233 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
234 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
235 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
241 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
242 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
244 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
245 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
246 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
247 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
251 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
266 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
268 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
269 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
271 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
272 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
273 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
274 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
275 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
276 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
277 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
278 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
279 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
280 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
281 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
282 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
283 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
284 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
285 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
286 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
287 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
288 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
289 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
290 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
291 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
292 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
293 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
294 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
295 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
296 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
297 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
298 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
299 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
300 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
301 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
302 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
303 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
304 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
305 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
306 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
307 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
308 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
309 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
310 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
311 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
312 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
313 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
314 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
315 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
316 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
317 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
318 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
319 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
320 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
321 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
322 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
323 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
324 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
325 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
326 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
327 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
328 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
329 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
330 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
331 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
332 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
333 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
334 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
335 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
336 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
337 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
338 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
339 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
340 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
341 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
342 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
343 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
344 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
345 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
346 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
347 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
348 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
349 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
350 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
351 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
352 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
353 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
354 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
355 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
356 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
357 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
358 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
359 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
360 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
361 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
362 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
363 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
364 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
365 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
366 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
367 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
368 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
369 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
370 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
371 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
372 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
373 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
374 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
375 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
376 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
377 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
378 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
379 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
380 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
381 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
382 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
383 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
384 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
385 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
386 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
387 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
388 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
389 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
390 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
391 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
392 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
393 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
394 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
395 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
396 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
397 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
398 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
399 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
400 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
401 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
402 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
403 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
404 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
405 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
406 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
407 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
408 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
409 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
410 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
411 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
412 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
413 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
414 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
415 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
416 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
417 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
418 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
419 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
420 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
421 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
422 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
423 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
424 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
425 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
426 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
427 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
428 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
429 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
430 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
431 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
432 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
433 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
434 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
435 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
436 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
437 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
438 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
439 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
440 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
441 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
442 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
443 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
444 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
445 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
446 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
447 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
448 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
449 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
450 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
451 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
452 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
453 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.67
Metatranscriptomes 0
Isolates 16.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.28
Nodule 2.03
Rhizoplane 5.77
Rhizosphere 77.42
Stem 0
Stem Tuber 0
Unclassified 9.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_223 2124908027 Bacteria 18952
2 MRS2a_Contig_7032 2124908027 Bacteria 3078
3 SwRhRL2b_contig_1281804 2162886007 Bacteria 2695
4 JGI25162J39368_1000037 3300002737 Bacteria 179339
5 JGI25162J39368_1000087 3300002737 Bacteria 107005
6 JGI25154J39366_1004045 3300002738 Bacteria 2779
7 JGI25163J39215_1000066 3300002771 Bacteria 47667
8 JGI25163J39215_1000110 3300002771 Bacteria 34458
9 JGI25164J39214_1000020 3300002772 Bacteria 179339
10 JGI25164J39214_1000065 3300002772 Bacteria 107006
11 JGI25165J46597_1000077 3300003214 Bacteria 179339
12 JGI25165J46597_1000091 3300003214 Bacteria 167941
13 Ga0055538_1000086 3300003751 Bacteria 80460
14 Ga0055539_1000128 3300003752 Bacteria 80565
15 Ga0055533_1000270 3300003756 Bacteria 28666
16 Ga0055525_1000195 3300003759 Bacteria 71342
17 Ga0055536_1000041 3300003781 Bacteria 127266
18 Ga0055536_1000042 3300003781 Bacteria 125029
19 Ga0055536_1000360 3300003781 Bacteria 33801
20 Ga0055530_10000063 3300003791 Bacteria 94619
21 Ga0055530_10000660 3300003791 Bacteria 29508
22 Ga0055530_10002068 3300003791 Bacteria 13475
23 Ga0055540_1000278 3300003792 Bacteria 45985
24 Ga0055540_1000318 3300003792 Bacteria 42704
25 Ga0055531_10000412 3300003794 Bacteria 41097
26 Ga0055541_1000184 3300003841 Bacteria 28666
27 Ga0065714_10000391 3300005288 Bacteria 7635
28 Ga0065714_10004358 3300005288 Bacteria 7078
29 Ga0065714_10004643 3300005288 Bacteria 8728
30 Ga0065714_10007024 3300005288 Bacteria 4634
31 Ga0065714_10031195 3300005288 Bacteria 1259
32 Ga0065714_10066756 3300005288 Bacteria 6361
33 Ga0065714_10067840 3300005288 Bacteria 5163
34 Ga0065714_10068009 3300005288 Bacteria 5030
35 Ga0065714_10072754 3300005288 Bacteria 3309
36 Ga0065714_10084753 3300005288 Bacteria 2182
37 Ga0065704_10095815 3300005289 Bacteria 2471
38 Ga0065712_10002466 3300005290 Bacteria 13852
39 Ga0065715_10002811 3300005293 Bacteria 4815
40 Ga0070670_100003837 3300005331 Bacteria 12527
41 Ga0070669_100000272 3300005353 Bacteria 41853
42 Ga0070669_100045051 3300005353 Bacteria 3214
43 Ga0068853_100067423 3300005539 Bacteria 3109
44 Ga0070665_100079480 3300005548 Bacteria 3285
45 Ga0070664_100000075 3300005564 Bacteria 62615
46 Ga0070664_100053152 3300005564 Bacteria 3432
47 Ga0068854_100052237 3300005578 Bacteria 2931
48 Ga0068851_10000028 3300005834 Bacteria 117106
49 Ga0075364_10239458 3300006051 Bacteria 1232
50 Ga0075432_10001831 3300006058 Bacteria 7007
51 Ga0075432_10003614 3300006058 Bacteria 5256
52 Ga0075432_10008785 3300006058 Bacteria 3447
53 Ga0075432_10029252 3300006058 Bacteria 1901
54 Ga0075432_10054957 3300006058 Bacteria 1410
55 Ga0075369_10057680 3300006186 Bacteria 1689
56 Ga0075436_100048899 3300006914 Bacteria 2918
57 Ga0079104_1000224 3300006946 Bacteria 78551
58 Ga0079104_1000559 3300006946 Bacteria 38288
59 Ga0099826_10038410 3300006948 Bacteria 3363
60 Ga0105251_10001124 3300009011 Bacteria 23282
61 Ga0105251_10002955 3300009011 Bacteria 12735
62 Ga0105251_10015589 3300009011 Bacteria 4144
63 Ga0105251_10038998 3300009011 Bacteria 2323
64 Ga0105251_10236447 3300009011 Bacteria 823
65 Ga0105244_10000558 3300009036 Bacteria 33269
66 Ga0105244_10003184 3300009036 Bacteria 11908
67 Ga0105244_10004359 3300009036 Bacteria 9761
68 Ga0105244_10014817 3300009036 Bacteria 4493
69 Ga0105244_10044085 3300009036 Bacteria 2299
70 Ga0105244_10057435 3300009036 Bacteria 1966
71 Ga0105244_10162129 3300009036 Bacteria 1067
72 Ga0105250_10000261 3300009092 Bacteria 43192
73 Ga0105250_10001013 3300009092 Bacteria 16242
74 Ga0105250_10002353 3300009092 Bacteria 9550
75 Ga0105250_10071526 3300009092 Bacteria 1401
76 Ga0105243_10000162 3300009148 Bacteria 75904
77 Ga0105243_10000313 3300009148 Bacteria 53525
78 Ga0105243_10041924 3300009148 Bacteria 3581
79 Ga0105242_10000418 3300009176 Bacteria 33866
80 Ga0105242_10324487 3300009176 Bacteria 1413
81 Ga0105248_10103715 3300009177 Bacteria 3206
82 Ga0105237_10000856 3300009545 Bacteria 41326
83 Ga0105246_10000155 3300011119 Bacteria 32536
84 Ga0105246_10070068 3300011119 Bacteria 2465
85 Ga0105246_10072397 3300011119 Bacteria 2430
86 Ga0105246_10530884 3300011119 Bacteria 1005
87 Ga0157345_1000143 3300012498 Bacteria 12901
88 Ga0157373_10003502 3300013100 Bacteria 11872
89 Ga0157373_10003758 3300013100 Bacteria 11482
90 Ga0157373_10009739 3300013100 Bacteria 7091
91 Ga0157373_10011310 3300013100 Bacteria 6563
92 Ga0157373_10051169 3300013100 Bacteria 2942
93 Ga0157373_10171413 3300013100 Bacteria 1527
94 Ga0157373_10175828 3300013100 Bacteria 1507
95 Ga0157373_10214420 3300013100 Bacteria 1358
96 Ga0157371_10000827 3300013102 Bacteria 35450
97 Ga0157371_10001450 3300013102 Bacteria 24595
98 Ga0157371_10064150 3300013102 Bacteria 2603
99 Ga0157370_10017968 3300013104 Bacteria 7120
100 Ga0157370_10032424 3300013104 Bacteria 5103
101 Ga0157370_10068821 3300013104 Bacteria 3345
102 Ga0157370_10070976 3300013104 Bacteria 3287
103 Ga0157370_10509361 3300013104 Bacteria 1105
104 Ga0157370_10509363 3300013104 Bacteria 1105
105 Ga0157370_10560701 3300013104 Bacteria 1047
106 Ga0157370_10584349 3300013104 Bacteria 1023
107 Ga0157370_10760348 3300013104 Bacteria 883
108 Ga0157369_10004662 3300013105 Bacteria 16118
109 Ga0157369_10007063 3300013105 Bacteria 12952
110 Ga0157369_10012309 3300013105 Bacteria 9717
111 Ga0157369_10059231 3300013105 Bacteria 4129
112 Ga0163162_10001228 3300013306 Bacteria 23952
113 Ga0163162_10003530 3300013306 Bacteria 14961
114 Ga0157372_10004887 3300013307 Bacteria 14255
115 Ga0157375_10034056 3300013308 Bacteria 4848
116 Ga0157375_10066119 3300013308 Bacteria 3607
117 Ga0157375_10171863 3300013308 Bacteria 2315
118 Ga0157375_10629976 3300013308 Bacteria 1230
119 Ga0182008_10001796 3300014497 Bacteria 14013
120 Ga0182008_10002331 3300014497 Bacteria 11960
121 Ga0182008_10003253 3300014497 Bacteria 9911
122 Ga0182008_10003354 3300014497 Bacteria 9721
123 Ga0182008_10003488 3300014497 Bacteria 9484
124 Ga0182008_10016925 3300014497 Bacteria 3782
125 Ga0182008_10187995 3300014497 Bacteria 1047
126 Ga0182006_1000531 3300015261 Bacteria 28946
127 Ga0182006_1001588 3300015261 Bacteria 13462
128 Ga0182006_1002581 3300015261 Bacteria 9801
129 Ga0182006_1003027 3300015261 Bacteria 8844
130 Ga0182006_1003687 3300015261 Bacteria 7766
131 Ga0182006_1037126 3300015261 Bacteria 1933
132 Ga0182007_10000270 3300015262 Bacteria 34556
133 Ga0182007_10003579 3300015262 Bacteria 7300
134 Ga0182005_1000757 3300015265 Bacteria 14760
135 Ga0182005_1000848 3300015265 Bacteria 13688
136 Ga0182005_1010493 3300015265 Bacteria 2663
137 Ga0182005_1042069 3300015265 Bacteria 1242
138 Ga0182005_1056233 3300015265 Bacteria 1072
139 Ga0182005_1056848 3300015265 Bacteria 1066
140 Ga0163161_10001988 3300017792 Bacteria 14823
141 Ga0163161_10013134 3300017792 Bacteria 5756
142 Ga0163161_10014264 3300017792 Bacteria 5533
143 Ga0163161_10022653 3300017792 Bacteria 4425
144 Ga0163161_10165295 3300017792 Bacteria 1689
145 Ga0163161_10181352 3300017792 Bacteria 1614
146 Ga0163161_10486772 3300017792 Bacteria 1002
147 Ga0163161_10550864 3300017792 Bacteria 945
148 Ga0209435_100480 3300025206 Bacteria 7887
149 Ga0209760_100022 3300025207 Bacteria 159218
150 Ga0209760_100262 3300025207 Bacteria 19860
151 Ga0209784_100017 3300025224 Bacteria 472003
152 Ga0209566_100014 3300025225 Bacteria 472003
153 Ga0209674_100028 3300025226 Bacteria 472003
154 Ga0209147_100038 3300025229 Bacteria 314497
155 Ga0209563_100032 3300025230 Bacteria 472003
156 Ga0207427_100001 3300025231 Bacteria 1410763
157 Ga0207427_100047 3300025231 Bacteria 240409
158 Ga0209437_100003 3300025233 Bacteria 1517827
159 Ga0209437_100009 3300025233 Bacteria 915954
160 Ga0209437_106252 3300025233 Bacteria 1989
161 Ga0209258_100197 3300025242 Bacteria 124028
162 Ga0209646_1000377 3300025246 Bacteria 28821
163 Ga0209677_100018 3300025253 Bacteria 472003
164 Ga0209759_1019689 3300025256 Bacteria 1591
165 Ga0209233_1000007 3300025261 Bacteria 1411234
166 Ga0209233_1000032 3300025261 Bacteria 623596
167 Ga0209676_1000016 3300025292 Bacteria 655561
168 Ga0209676_1000021 3300025292 Bacteria 609534
169 Ga0209676_1001520 3300025292 Bacteria 21109
170 Ga0209676_1004876 3300025292 Bacteria 7249
171 Ga0209050_1000009 3300025298 Bacteria 1047265
172 Ga0209050_1000036 3300025298 Bacteria 423070
173 Ga0209050_1000107 3300025298 Bacteria 223303
174 Ga0209050_1001096 3300025298 Bacteria 32901
175 Ga0209051_1000043 3300025303 Bacteria 305473
176 Ga0209051_1000053 3300025303 Bacteria 281564
177 Ga0209051_1000090 3300025303 Bacteria 173748
178 Ga0209257_1000098 3300025304 Bacteria 256390
179 Ga0209257_1015422 3300025304 Bacteria 3180
180 Ga0207656_10000095 3300025321 Bacteria 33160
181 Ga0207696_1000043 3300025711 Bacteria 307112
182 Ga0207696_1000101 3300025711 Bacteria 170899
183 Ga0207696_1001999 3300025711 Bacteria 10329
184 Ga0207696_1003232 3300025711 Bacteria 7518
185 Ga0207696_1012410 3300025711 Bacteria 3013
186 Ga0207696_1037105 3300025711 Bacteria 1444
187 Ga0207655_1000019 3300025728 Bacteria 536324
188 Ga0207655_1000095 3300025728 Bacteria 195899
189 Ga0207655_1000297 3300025728 Bacteria 75120
190 Ga0207655_1001700 3300025728 Bacteria 19367
191 Ga0207655_1005351 3300025728 Bacteria 8757
192 Ga0207655_1005951 3300025728 Bacteria 8173
193 Ga0207655_1010618 3300025728 Bacteria 5568
194 Ga0207655_1019559 3300025728 Bacteria 3530
195 Ga0207655_1061410 3300025728 Bacteria 1451
196 Ga0207713_1000904 3300025735 Bacteria 26862
197 Ga0207713_1002172 3300025735 Bacteria 14556
198 Ga0207713_1005711 3300025735 Bacteria 7721
199 Ga0207713_1011373 3300025735 Bacteria 4846
200 Ga0207713_1015236 3300025735 Bacteria 3956
201 Ga0207713_1018106 3300025735 Bacteria 3498
202 Ga0207713_1103822 3300025735 Bacteria 977
203 Ga0207713_1116754 3300025735 Bacteria 900
204 Ga0207671_10000035 3300025914 Bacteria 237603
205 Ga0207649_10000017 3300025920 Bacteria 225193
206 Ga0207681_10002444 3300025923 Bacteria 11776
207 Ga0207681_10010392 3300025923 Bacteria 5696
208 Ga0207650_10000180 3300025925 Bacteria 74406
209 Ga0207706_10001223 3300025933 Bacteria 25958
210 Ga0207706_10043140 3300025933 Bacteria 3997
211 Ga0207686_10002363 3300025934 Bacteria 10318
212 Ga0207686_10196515 3300025934 Bacteria 1442
213 Ga0207709_10000053 3300025935 Bacteria 225514
214 Ga0207709_10000502 3300025935 Bacteria 34963
215 Ga0207709_10097183 3300025935 Bacteria 1939
216 Ga0207679_10000005 3300025945 Bacteria 525011
217 Ga0207679_10199053 3300025945 Bacteria 1672
218 Ga0207640_10039885 3300025981 Bacteria 2975
219 Ga0207639_10048093 3300026041 Bacteria 3226
220 Ga0209281_1000018 3300027111 Bacteria 579091
221 Ga0209281_1000174 3300027111 Bacteria 151659
222 Ga0209371_1000397 3300027312 Bacteria 45561
223 Ga0209282_1105366 3300027666 Bacteria 1443
224 Ga0207428_10027476 3300027907 Bacteria 4736
225 Ga0207428_10068562 3300027907 Bacteria 2790
226 Ga0207428_10091126 3300027907 Bacteria 2367
227 Ga0207428_10104097 3300027907 Bacteria 2191
228 Ga0207428_10204616 3300027907 Bacteria 1485
229 Ga0207428_10231218 3300027907 Bacteria 1384
230 Ga0268266_10040819 3300028379 Bacteria 3956
231 Ga0268266_10166407 3300028379 Bacteria 1998
232 Ga0307517_10060304 3300028786 Bacteria 3614
233 Ga0268256_1000340 3300030500 Bacteria 45572
234 Ga0307511_10039640 3300030521 Bacteria 4020
235 Ga0307511_10139188 3300030521 Bacteria 1433
236 Ga0307513_10403434 3300031456 Bacteria 1101
237 Ga0307509_10190435 3300031507 Bacteria 1903
238 Ga0307408_100003620 3300031548 Bacteria 10529
239 Ga0307408_100057172 3300031548 Bacteria 2830
240 Ga0307408_100164061 3300031548 Bacteria 1767
241 Ga0307408_100404070 3300031548 Bacteria 1173
242 Ga0307405_10001198 3300031731 Bacteria 10734
243 Ga0307405_10001406 3300031731 Bacteria 10128
244 Ga0307405_10210348 3300031731 Bacteria 1419
245 Ga0307413_10039227 3300031824 Bacteria 2752
246 Ga0307406_10018838 3300031901 Bacteria 4041
247 Ga0307406_10081360 3300031901 Bacteria 2153
248 Ga0307406_10459735 3300031901 Bacteria 1023
249 Ga0307412_10001319 3300031911 Bacteria 13891
250 Ga0307412_10014522 3300031911 Bacteria 4645
251 Ga0307412_10014797 3300031911 Bacteria 4610
252 Ga0307412_10027034 3300031911 Bacteria 3573
253 Ga0307412_10133427 3300031911 Bacteria 1807
254 Ga0307416_100227288 3300032002 Bacteria 1796
255 Ga0307414_10095031 3300032004 Bacteria 2226
256 Ga0307414_10105978 3300032004 Bacteria 2127
257 Ga0307510_10001493 3300033180 Bacteria 25834
258 Ga0237819_02368 3300038705 Bacteria 3841
259 Ga0439438_000506 3300041405 Bacteria 17698
260 Ga0439438_000923 3300041405 Bacteria 13115
261 Ga0439438_001117 3300041405 Bacteria 11938
262 Ga0439438_001212 3300041405 Bacteria 11414
263 Ga0439438_002209 3300041405 Bacteria 8370
264 Ga0439438_004349 3300041405 Bacteria 5456
265 Ga0439438_008140 3300041405 Bacteria 3509
266 Ga0439438_019460 3300041405 Bacteria 1918
267 Ga0439438_022078 3300041405 Bacteria 1769
268 Ga0439438_028734 3300041405 Bacteria 1493
269 Ga0439438_062666 3300041405 Bacteria 929
270 Ga0439447_000230 3300041407 Bacteria 19716
271 Ga0439447_000659 3300041407 Bacteria 12798
272 Ga0439447_003511 3300041407 Bacteria 5564
273 Ga0439447_005834 3300041407 Bacteria 4056
274 Ga0439447_011203 3300041407 Bacteria 2628
275 Ga0439447_013685 3300041407 Bacteria 2295
276 Ga0439466_0001972 3300041411 Bacteria 8048
277 Ga0439466_0002200 3300041411 Bacteria 7630
278 Ga0439466_0004829 3300041411 Bacteria 5181
279 Ga0439466_0008806 3300041411 Bacteria 3795
280 Ga0439466_0010147 3300041411 Bacteria 3502
281 Ga0439466_0012108 3300041411 Bacteria 3183
282 Ga0439466_0013494 3300041411 Bacteria 2989
283 Ga0439466_0017740 3300041411 Bacteria 2560
284 Ga0439466_0025700 3300041411 Bacteria 2053
285 Ga0439466_0027146 3300041411 Bacteria 1984
286 Ga0439466_0041445 3300041411 Bacteria 1535
287 Ga0439466_0049342 3300041411 Bacteria 1382
288 Ga0439466_0055545 3300041411 Bacteria 1286
289 Ga0439466_0077459 3300041411 Bacteria 1051
290 Ga0439466_0080895 3300041411 Bacteria 1024
291 Ga0439466_0087877 3300041411 Bacteria 976
292 Ga0439465_0041559 3300041413 Bacteria 1489
293 Ga0439431_0007196 3300041997 Bacteria 2478
294 Ga0439445_0000723 3300042004 Bacteria 6898
295 Ga0439432_001349 3300042006 Bacteria 9281
296 Ga0439432_003835 3300042006 Bacteria 5543
297 Ga0439432_006042 3300042006 Bacteria 4344
298 Ga0439432_008801 3300042006 Bacteria 3531
299 Ga0439432_011027 3300042006 Bacteria 3116
300 Ga0439432_011908 3300042006 Bacteria 2988
301 Ga0439451_000415 3300042009 Bacteria 8332
302 Ga0439451_005311 3300042009 Bacteria 2624
303 Ga0439451_008671 3300042009 Bacteria 2061
304 Ga0439451_013430 3300042009 Bacteria 1655
305 Ga0439451_013772 3300042009 Bacteria 1632
306 Ga0439451_014764 3300042009 Bacteria 1575
307 Ga0439451_020635 3300042009 Bacteria 1327
308 Ga0439452_000228 3300042010 Bacteria 39646
309 Ga0439452_002118 3300042010 Bacteria 7516
310 Ga0439452_003047 3300042010 Bacteria 5960
311 Ga0439452_004970 3300042010 Bacteria 4354
312 Ga0439452_010820 3300042010 Bacteria 2639
313 Ga0439452_012013 3300042010 Bacteria 2474
314 Ga0439452_012111 3300042010 Bacteria 2462
315 Ga0439452_019291 3300042010 Bacteria 1805
316 Ga0439452_026474 3300042010 Bacteria 1463
317 Ga0439456_000775 3300042013 Bacteria 6500
318 Ga0439456_000846 3300042013 Bacteria 6187
319 Ga0439456_005592 3300042013 Bacteria 2552
320 Ga0439456_005965 3300042013 Bacteria 2481
321 Ga0439456_014339 3300042013 Bacteria 1652
322 Ga0439456_015698 3300042013 Bacteria 1582
323 Ga0439456_033756 3300042013 Bacteria 1101
324 Ga0439456_043206 3300042013 Bacteria 979
325 Ga0439463_000504 3300042016 Bacteria 10962
326 Ga0439463_003653 3300042016 Bacteria 3879
327 Ga0439463_031917 3300042016 Bacteria 1330
328 Ga0439463_036482 3300042016 Bacteria 1245
329 Ga0439463_051263 3300042016 Bacteria 1052
330 Ga0450911_000586 3300042115 Bacteria 11210
331 Ga0450911_000664 3300042115 Bacteria 10293
332 Ga0450911_001017 3300042115 Bacteria 7151
333 Ga0450911_003254 3300042115 Bacteria 2909
334 Ga0450919_000346 3300042121 Bacteria 5583
335 Ga0450920_000197 3300042122 Bacteria 8742
336 Ga0450922_000479 3300042124 Bacteria 4240
337 Ga0450922_003693 3300042124 Bacteria 1406
338 Ga0450890_008359 3300042127 Bacteria 1324
339 Ga0450900_005041 3300042136 Bacteria 1546
340 Ga0450902_004186 3300042137 Bacteria 2139
341 Ga0450903_000824 3300042138 Bacteria 6047
342 Ga0450903_006308 3300042138 Bacteria 1973
343 Ga0450903_007925 3300042138 Bacteria 1741
344 Ga0450903_012440 3300042138 Bacteria 1360
345 Ga0450903_013665 3300042138 Bacteria 1290
346 Ga0450903_013722 3300042138 Bacteria 1287
347 Ga0450904_001251 3300042139 Bacteria 3782
348 Ga0450904_005264 3300042139 Bacteria 1316
349 Ga0450905_001391 3300042142 Bacteria 3078
350 Ga0450889_004455 3300042144 Bacteria 1385
351 Ga0450906_000113 3300042145 Bacteria 14042
352 Ga0450906_001726 3300042145 Bacteria 4780
353 Ga0450906_014044 3300042145 Bacteria 1470
354 Ga0450907_000056 3300042146 Bacteria 44042
355 Ga0450907_000865 3300042146 Bacteria 7258
356 Ga0450910_000399 3300042147 Bacteria 5123
357 Ga0450910_002656 3300042147 Bacteria 2350
358 Ga0439446_0001140 3300042156 Bacteria 5887
359 Ga0439446_0012538 3300042156 Bacteria 2315
360 Ga0439446_0017353 3300042156 Bacteria 2011
361 Ga0450908_003710 3300042184 Bacteria 2959
362 Ga0450908_013293 3300042184 Bacteria 1485
363 Ga0450909_000047 3300042185 Bacteria 10237
364 Ga0450909_002054 3300042185 Bacteria 2841
365 Ga0439434_0000537 3300042435 Bacteria 10833
366 Ga0439464_0003354 3300042439 Bacteria 4031
367 Ga0439464_0006878 3300042439 Bacteria 2968
368 Ga0439460_0000372 3300042461 Bacteria 9508
369 Ga0439460_0004869 3300042461 Bacteria 3280
370 Ga0450918_000958 3300042531 Bacteria 6011
371 Ga0450918_014198 3300042531 Bacteria 1384
372 Ga0450918_014980 3300042531 Bacteria 1348
373 Ga0450893_0015023 3300042532 Bacteria 1303
374 Ga0439440_0005849 3300042993 Bacteria 2453
375 Ga0495617_000480 3300046452 Bacteria 21257
376 Ga0495617_003653 3300046452 Bacteria 5738
377 Ga0495617_005747 3300046452 Bacteria 4380
378 Ga0495617_017954 3300046452 Bacteria 2391
379 Ga0495617_023738 3300046452 Bacteria 2070
380 Ga0495617_026823 3300046452 Bacteria 1939
381 Ga0495617_036515 3300046452 Bacteria 1647
382 Ga0495617_038258 3300046452 Bacteria 1605
383 Ga0495617_042212 3300046452 Bacteria 1524
384 Ga0495617_043440 3300046452 Bacteria 1500
385 Ga0495617_071359 3300046452 Bacteria 1142
386 Ga0495627_000294 3300046453 Bacteria 49457
387 Ga0495627_001723 3300046453 Bacteria 11931
388 Ga0495627_003307 3300046453 Bacteria 7191
389 Ga0495627_005477 3300046453 Bacteria 5113
390 Ga0495627_006142 3300046453 Bacteria 4735
391 Ga0495627_026479 3300046453 Bacteria 1869
392 Ga0495627_051758 3300046453 Bacteria 1233
393 Ga0495627_060684 3300046453 Bacteria 1120
394 Ga0495592_0060890 3300046454 Bacteria 2775
395 Ga0495603_0003336 3300046455 Bacteria 9564
396 Ga0495603_0023969 3300046455 Bacteria 3691
397 Ga0495603_0158898 3300046455 Bacteria 1311
398 Ga0495603_0244441 3300046455 Bacteria 1033
399 Ga0495590_0000805 3300046457 Bacteria 14253
400 Ga0495590_0004330 3300046457 Bacteria 5738
401 Ga0495590_0005571 3300046457 Bacteria 4981
402 Ga0495590_0007997 3300046457 Bacteria 4056
403 Ga0495590_0017134 3300046457 Bacteria 2611
404 Ga0495590_0036037 3300046457 Bacteria 1726
405 Ga0495590_0041646 3300046457 Bacteria 1601
406 Ga0495590_0079395 3300046457 Bacteria 1155
407 Ga0495591_000264 3300046458 Bacteria 49787
408 Ga0495591_001542 3300046458 Bacteria 14133
409 Ga0495591_001583 3300046458 Bacteria 13825
410 Ga0495591_006348 3300046458 Bacteria 5246
411 Ga0495591_006728 3300046458 Bacteria 5013
412 Ga0495591_006851 3300046458 Bacteria 4949
413 Ga0495591_007655 3300046458 Bacteria 4554
414 Ga0495591_007918 3300046458 Bacteria 4430
415 Ga0495591_009889 3300046458 Bacteria 3748
416 Ga0495591_010118 3300046458 Bacteria 3684
417 Ga0495591_026557 3300046458 Bacteria 1796
418 Ga0495591_030902 3300046458 Bacteria 1612
419 Ga0495629_0012607 3300046459 Bacteria 6122
420 Ga0495629_0332204 3300046459 Bacteria 1038
421 Ga0495638_0004020 3300046460 Bacteria 11286
422 Ga0495638_0004376 3300046460 Bacteria 10696
423 Ga0495638_0007343 3300046460 Bacteria 7910
424 Ga0495638_0010464 3300046460 Bacteria 6434
425 Ga0495638_0010596 3300046460 Bacteria 6387
426 Ga0495638_0011054 3300046460 Bacteria 6239
427 Ga0495638_0011461 3300046460 Bacteria 6108
428 Ga0495638_0015252 3300046460 Bacteria 5164
429 Ga0495638_0017011 3300046460 Bacteria 4859
430 Ga0495638_0024749 3300046460 Bacteria 3908
431 Ga0495638_0055246 3300046460 Bacteria 2466
432 Ga0495638_0065658 3300046460 Bacteria 2232
433 Ga0495638_0073616 3300046460 Bacteria 2084
434 Ga0495638_0107767 3300046460 Bacteria 1658
435 Ga0495638_0110623 3300046460 Bacteria 1632
436 Ga0495638_0131424 3300046460 Bacteria 1470
437 Ga0495638_0143657 3300046460 Bacteria 1390
438 Ga0495638_0200332 3300046460 Bacteria 1127
439 Ga0495638_0230559 3300046460 Bacteria 1030
440 Ga0495653_0002572 3300046463 Bacteria 14461
441 Ga0495653_0238110 3300046463 Bacteria 1214
442 Ga0495653_0280910 3300046463 Bacteria 1092
443 Ga0495650_0004225 3300046471 Bacteria 9946
444 Ga0495650_0005746 3300046471 Bacteria 7922
445 Ga0495650_0006190 3300046471 Bacteria 7513
446 Ga0495650_0010175 3300046471 Bacteria 5270
447 Ga0495650_0013627 3300046471 Bacteria 4287
448 Ga0495650_0013926 3300046471 Bacteria 4222
449 Ga0495650_0034465 3300046471 Bacteria 2240
450 Ga0495650_0039985 3300046471 Bacteria 2018
451 Ga0495650_0101196 3300046471 Bacteria 1082
452 Ga0495580_0287808 3300046472 Bacteria 1120
453 Ga0495582_0004652 3300046473 Bacteria 7717
454 Ga0495605_0000742 3300046474 Bacteria 23945
455 Ga0495605_0000943 3300046474 Bacteria 19846
456 Ga0495605_0001812 3300046474 Bacteria 13680
457 Ga0495605_0003981 3300046474 Bacteria 8731
458 Ga0495605_0005609 3300046474 Bacteria 7293
459 Ga0495605_0009712 3300046474 Bacteria 5406
460 Ga0495605_0052566 3300046474 Bacteria 1979
461 Ga0495605_0149874 3300046474 Bacteria 1041
462 Ga0495605_0186109 3300046474 Bacteria 911
463 Ga0495639_0000074 3300046475 Bacteria 46843
464 Ga0495639_0061262 3300046475 Bacteria 1725
465 Ga0495584_0000894 3300046491 Bacteria 19123
466 Ga0495584_0003081 3300046491 Bacteria 9267
467 Ga0495584_0003555 3300046491 Bacteria 8521
468 Ga0495584_0003597 3300046491 Bacteria 8453
469 Ga0495584_0011758 3300046491 Bacteria 4475
470 Ga0495584_0012361 3300046491 Bacteria 4357
471 Ga0495584_0021233 3300046491 Bacteria 3298
472 Ga0495584_0040578 3300046491 Bacteria 2350
473 Ga0495584_0040772 3300046491 Bacteria 2344
474 Ga0495584_0090136 3300046491 Bacteria 1546
475 Ga0495584_0187352 3300046491 Bacteria 1051
476 Ga0495585_0001397 3300046492 Bacteria 19044
477 Ga0495585_0004553 3300046492 Bacteria 8966
478 Ga0495585_0008495 3300046492 Bacteria 6221
479 Ga0495585_0014496 3300046492 Bacteria 4591
480 Ga0495585_0014588 3300046492 Bacteria 4572
481 Ga0495585_0044742 3300046492 Bacteria 2472
482 Ga0495585_0071210 3300046492 Bacteria 1895
483 Ga0495585_0106044 3300046492 Bacteria 1498
484 Ga0495585_0109858 3300046492 Bacteria 1467
485 Ga0495585_0118533 3300046492 Bacteria 1402
486 Ga0495585_0156705 3300046492 Bacteria 1184
487 Ga0495585_0260633 3300046492 Bacteria 862
488 Ga0495594_0008317 3300046499 Bacteria 5343
489 Ga0495594_0081474 3300046499 Bacteria 1807
490 Ga0495594_0288682 3300046499 Bacteria 935
491 Ga0495596_0000004 3300046500 Bacteria 163832
492 Ga0495596_0028721 3300046500 Bacteria 2231
493 Ga0495596_0039133 3300046500 Bacteria 1873
494 Ga0495596_0088290 3300046500 Bacteria 1203
495 Ga0495607_0002691 3300046501 Bacteria 14180
496 Ga0495607_0004869 3300046501 Bacteria 9787
497 Ga0495607_0011331 3300046501 Bacteria 5942
498 Ga0495607_0012839 3300046501 Bacteria 5508
499 Ga0495607_0013812 3300046501 Bacteria 5277
500 Ga0495607_0013818 3300046501 Bacteria 5276
501 Ga0495607_0014702 3300046501 Bacteria 5088
502 Ga0495607_0017127 3300046501 Bacteria 4660
503 Ga0495607_0020174 3300046501 Bacteria 4218
504 Ga0495607_0042263 3300046501 Bacteria 2703
505 Ga0495607_0069005 3300046501 Bacteria 1980
506 Ga0495607_0075425 3300046501 Bacteria 1869
507 Ga0495607_0116468 3300046501 Bacteria 1409
508 Ga0495607_0138076 3300046501 Bacteria 1260
509 Ga0495607_0146210 3300046501 Bacteria 1214
510 Ga0495607_0165942 3300046501 Bacteria 1118
511 Ga0495583_0000400 3300046506 Bacteria 65891
512 Ga0495583_0004374 3300046506 Bacteria 10173
513 Ga0495583_0005442 3300046506 Bacteria 8650
514 Ga0495583_0068389 3300046506 Bacteria 1566
515 Ga0495606_0001600 3300046507 Bacteria 29532
516 Ga0495606_0004330 3300046507 Bacteria 14273
517 Ga0495606_0004584 3300046507 Bacteria 13708
518 Ga0495606_0008054 3300046507 Bacteria 9247
519 Ga0495606_0035106 3300046507 Bacteria 3432
520 Ga0495606_0037898 3300046507 Bacteria 3268
521 Ga0495606_0051641 3300046507 Bacteria 2680
522 Ga0495606_0055539 3300046507 Bacteria 2560
523 Ga0495606_0137669 3300046507 Bacteria 1444
524 Ga0495606_0164605 3300046507 Bacteria 1291
525 Ga0495606_0278958 3300046507 Bacteria 914
526 Ga0495610_0001754 3300046512 Bacteria 18984
527 Ga0495610_0004292 3300046512 Bacteria 10605
528 Ga0495610_0004342 3300046512 Bacteria 10526
529 Ga0495610_0005652 3300046512 Bacteria 8814
530 Ga0495610_0007283 3300046512 Bacteria 7405
531 Ga0495610_0029448 3300046512 Bacteria 2891
532 Ga0495610_0063913 3300046512 Bacteria 1741
533 Ga0495610_0069666 3300046512 Bacteria 1645
534 Ga0495610_0096222 3300046512 Bacteria 1333
535 Ga0495610_0132963 3300046512 Bacteria 1078
536 Ga0495610_0179222 3300046512 Bacteria 882
537 Ga0495616_0001186 3300046513 Bacteria 18376
538 Ga0495616_0002308 3300046513 Bacteria 12756
539 Ga0495616_0003473 3300046513 Bacteria 10080
540 Ga0495616_0008345 3300046513 Bacteria 6142
541 Ga0495616_0010604 3300046513 Bacteria 5325
542 Ga0495616_0012448 3300046513 Bacteria 4829
543 Ga0495616_0013424 3300046513 Bacteria 4619
544 Ga0495616_0018182 3300046513 Bacteria 3863
545 Ga0495616_0039813 3300046513 Bacteria 2404
546 Ga0495616_0090709 3300046513 Bacteria 1447
547 Ga0495616_0120119 3300046513 Bacteria 1214
548 Ga0495616_0127498 3300046513 Bacteria 1169
549 Ga0495616_0160452 3300046513 Bacteria 1012
550 Ga0495620_0002293 3300046515 Bacteria 11076
551 Ga0495620_0003879 3300046515 Bacteria 8530
552 Ga0495620_0004015 3300046515 Bacteria 8355
553 Ga0495620_0004328 3300046515 Bacteria 8024
554 Ga0495620_0011024 3300046515 Bacteria 4736
555 Ga0495620_0014432 3300046515 Bacteria 4016
556 Ga0495620_0039305 3300046515 Bacteria 2092
557 Ga0495620_0084344 3300046515 Bacteria 1281
558 Ga0495620_0097047 3300046515 Bacteria 1177
559 Ga0495628_0183653 3300046516 Bacteria 1581
560 Ga0495628_0234101 3300046516 Bacteria 1376
561 Ga0495630_0156532 3300046517 Bacteria 1734
562 Ga0495630_0178036 3300046517 Bacteria 1621
563 Ga0495631_0000149 3300046518 Bacteria 47491
564 Ga0495631_0002305 3300046518 Bacteria 10884
565 Ga0495631_0004457 3300046518 Bacteria 7459
566 Ga0495631_0028759 3300046518 Bacteria 2534
567 Ga0495631_0086802 3300046518 Bacteria 1347
568 Ga0495631_0088858 3300046518 Bacteria 1330
569 Ga0495631_0125928 3300046518 Bacteria 1101
570 Ga0495631_0140041 3300046518 Bacteria 1038
571 Ga0495632_0000996 3300046519 Bacteria 24735
572 Ga0495632_0002108 3300046519 Bacteria 15553
573 Ga0495632_0007412 3300046519 Bacteria 6891
574 Ga0495632_0009160 3300046519 Bacteria 5982
575 Ga0495632_0011888 3300046519 Bacteria 5056
576 Ga0495632_0012162 3300046519 Bacteria 4975
577 Ga0495632_0022705 3300046519 Bacteria 3358
578 Ga0495632_0037472 3300046519 Bacteria 2460
579 Ga0495632_0050218 3300046519 Bacteria 2058
580 Ga0495632_0079396 3300046519 Bacteria 1566
581 Ga0495632_0087707 3300046519 Bacteria 1478
582 Ga0495632_0139424 3300046519 Bacteria 1125
583 Ga0495632_0164037 3300046519 Bacteria 1022
584 Ga0495637_0000654 3300046520 Bacteria 24163
585 Ga0495637_0002446 3300046520 Bacteria 10261
586 Ga0495637_0002618 3300046520 Bacteria 9869
587 Ga0495637_0004911 3300046520 Bacteria 6885
588 Ga0495637_0005285 3300046520 Bacteria 6604
589 Ga0495637_0006863 3300046520 Bacteria 5690
590 Ga0495637_0008264 3300046520 Bacteria 5117
591 Ga0495637_0010206 3300046520 Bacteria 4551
592 Ga0495637_0010283 3300046520 Bacteria 4533
593 Ga0495637_0010616 3300046520 Bacteria 4448
594 Ga0495637_0013219 3300046520 Bacteria 3923
595 Ga0495637_0015416 3300046520 Bacteria 3583
596 Ga0495637_0015761 3300046520 Bacteria 3541
597 Ga0495637_0028141 3300046520 Bacteria 2511
598 Ga0495637_0060704 3300046520 Bacteria 1551
599 Ga0495643_0002834 3300046522 Bacteria 13196
600 Ga0495643_0005148 3300046522 Bacteria 8932
601 Ga0495643_0021755 3300046522 Bacteria 3671
602 Ga0495643_0038725 3300046522 Bacteria 2610
603 Ga0495643_0062145 3300046522 Bacteria 1978
604 Ga0495643_0082212 3300046522 Bacteria 1674
605 Ga0495643_0093804 3300046522 Bacteria 1545
606 Ga0495643_0099545 3300046522 Bacteria 1491
607 Ga0495643_0100879 3300046522 Bacteria 1479
608 Ga0495643_0144049 3300046522 Bacteria 1185
609 Ga0495644_0001358 3300046523 Bacteria 9996
610 Ga0495644_0003157 3300046523 Bacteria 6516
611 Ga0495644_0020678 3300046523 Bacteria 2511
612 Ga0495644_0038194 3300046523 Bacteria 1811
613 Ga0495644_0047768 3300046523 Bacteria 1607
614 Ga0495648_0000984 3300046524 Bacteria 29405
615 Ga0495648_0005805 3300046524 Bacteria 10172
616 Ga0495648_0007492 3300046524 Bacteria 8730
617 Ga0495648_0008126 3300046524 Bacteria 8285
618 Ga0495648_0009616 3300046524 Bacteria 7458
619 Ga0495648_0010259 3300046524 Bacteria 7153
620 Ga0495648_0011151 3300046524 Bacteria 6793
621 Ga0495648_0042581 3300046524 Bacteria 2855
622 Ga0495648_0045078 3300046524 Bacteria 2746
623 Ga0495648_0052797 3300046524 Bacteria 2466
624 Ga0495648_0060129 3300046524 Bacteria 2262
625 Ga0495648_0078613 3300046524 Bacteria 1886
626 Ga0495648_0110442 3300046524 Bacteria 1497
627 Ga0495648_0121499 3300046524 Bacteria 1403
628 Ga0495648_0227907 3300046524 Bacteria 914
629 Ga0495666_0014896 3300046526 Bacteria 3871
630 Ga0495666_0026223 3300046526 Bacteria 2875
631 Ga0495666_0073413 3300046526 Bacteria 1623
632 Ga0495642_0000055 3300046528 Bacteria 69106
633 Ga0495642_0000416 3300046528 Bacteria 22798
634 Ga0495642_0001808 3300046528 Bacteria 9175
635 Ga0495654_0000562 3300046530 Bacteria 29977
636 Ga0495654_0002377 3300046530 Bacteria 12142
637 Ga0495654_0002891 3300046530 Bacteria 10773
638 Ga0495654_0003492 3300046530 Bacteria 9597
639 Ga0495654_0004181 3300046530 Bacteria 8646
640 Ga0495654_0006522 3300046530 Bacteria 6617
641 Ga0495654_0006736 3300046530 Bacteria 6496
642 Ga0495654_0008472 3300046530 Bacteria 5676
643 Ga0495654_0009346 3300046530 Bacteria 5373
644 Ga0495654_0009983 3300046530 Bacteria 5184
645 Ga0495654_0020496 3300046530 Bacteria 3444
646 Ga0495654_0022941 3300046530 Bacteria 3235
647 Ga0495654_0025678 3300046530 Bacteria 3033
648 Ga0495654_0055879 3300046530 Bacteria 1910
649 Ga0495654_0068458 3300046530 Bacteria 1687
650 Ga0495654_0078212 3300046530 Bacteria 1555
651 Ga0495654_0081666 3300046530 Bacteria 1514
652 Ga0495586_0006486 3300046535 Bacteria 6247
653 Ga0495587_0001172 3300046536 Bacteria 17282
654 Ga0495587_0010938 3300046536 Bacteria 5756
655 Ga0495587_0067757 3300046536 Bacteria 2080
656 Ga0495609_0007889 3300046538 Bacteria 5261
657 Ga0495609_0010937 3300046538 Bacteria 4334
658 Ga0495609_0015306 3300046538 Bacteria 3591
659 Ga0495609_0019322 3300046538 Bacteria 3154
660 Ga0495609_0048076 3300046538 Bacteria 1907
661 Ga0495609_0052823 3300046538 Bacteria 1807
662 Ga0495609_0090416 3300046538 Bacteria 1331
663 Ga0495609_0092638 3300046538 Bacteria 1313
664 Ga0495609_0100346 3300046538 Bacteria 1254
665 Ga0495609_0102429 3300046538 Bacteria 1240
666 Ga0495609_0136587 3300046538 Bacteria 1048
667 Ga0495597_0003183 3300046542 Bacteria 9806
668 Ga0495597_0009364 3300046542 Bacteria 4845
669 Ga0495597_0012216 3300046542 Bacteria 4150
670 Ga0495597_0020369 3300046542 Bacteria 3090
671 Ga0495597_0026335 3300046542 Bacteria 2671
672 Ga0495597_0034991 3300046542 Bacteria 2267
673 Ga0495597_0040225 3300046542 Bacteria 2090
674 Ga0495597_0049648 3300046542 Bacteria 1853
675 Ga0495597_0055808 3300046542 Bacteria 1731
676 Ga0495597_0061063 3300046542 Bacteria 1642
677 Ga0495597_0082881 3300046542 Bacteria 1370
678 Ga0495597_0083555 3300046542 Bacteria 1363
679 Ga0495597_0086881 3300046542 Bacteria 1331
680 Ga0495597_0102379 3300046542 Bacteria 1206
681 Ga0495597_0133248 3300046542 Bacteria 1029
682 Ga0495645_0045704 3300046543 Bacteria 3195
683 Ga0495645_0062413 3300046543 Bacteria 2699
684 Ga0495622_0001087 3300046557 Bacteria 14206
685 Ga0495622_0006158 3300046557 Bacteria 5574
686 Ga0495622_0043356 3300046557 Bacteria 2091
687 Ga0495622_0057241 3300046557 Bacteria 1807
688 Ga0495622_0072924 3300046557 Bacteria 1584
689 Ga0495622_0095043 3300046557 Bacteria 1368
690 Ga0495622_0103015 3300046557 Bacteria 1307
691 Ga0495622_0164578 3300046557 Bacteria 999
692 Ga0495633_0001003 3300046558 Bacteria 23142
693 Ga0495633_0002568 3300046558 Bacteria 12719
694 Ga0495633_0068535 3300046558 Bacteria 1656
695 Ga0495656_0010317 3300046615 Bacteria 3392
696 Ga0495656_0015874 3300046615 Bacteria 2850
697 Ga0495668_0000940 3300046616 Bacteria 32529
698 Ga0495668_0003395 3300046616 Bacteria 11971
699 Ga0495668_0137751 3300046616 Bacteria 1336
700 Ga0495668_0210937 3300046616 Bacteria 1063
701 Ga0495634_0003536 3300046642 Bacteria 12501
702 Ga0495634_0010517 3300046642 Bacteria 6778
703 Ga0495611_0000389 3300046648 Bacteria 27902
704 Ga0495611_0005561 3300046648 Bacteria 5378
705 Ga0495611_0009723 3300046648 Bacteria 4066
706 Ga0495611_0023957 3300046648 Bacteria 2652
707 Ga0495611_0024930 3300046648 Bacteria 2603
708 Ga0495611_0035807 3300046648 Bacteria 2200
709 Ga0495611_0117537 3300046648 Bacteria 1239
710 Ga0495625_0010148 3300046660 Bacteria 7821
711 Ga0495625_0011342 3300046660 Bacteria 7277
712 Ga0495625_0023743 3300046660 Bacteria 4680
713 Ga0495625_0025523 3300046660 Bacteria 4480
714 Ga0495625_0026918 3300046660 Bacteria 4336
715 Ga0495625_0043260 3300046660 Bacteria 3267
716 Ga0495625_0067561 3300046660 Bacteria 2515
717 Ga0495625_0079531 3300046660 Bacteria 2285
718 Ga0495625_0104974 3300046660 Bacteria 1936
719 Ga0495625_0118073 3300046660 Bacteria 1807
720 Ga0495625_0176036 3300046660 Bacteria 1425
721 Ga0495625_0206211 3300046660 Bacteria 1294
722 Ga0495635_0004967 3300046663 Bacteria 9262
723 Ga0495635_0005882 3300046663 Bacteria 8550
724 Ga0495659_0000120 3300046664 Bacteria 34520
725 Ga0495659_0003177 3300046664 Bacteria 5267
726 Ga0495659_0045731 3300046664 Bacteria 1578
727 Ga0495659_0091258 3300046664 Bacteria 1170
728 Ga0495661_0008979 3300046665 Bacteria 6879
729 Ga0495661_0044729 3300046665 Bacteria 2711
730 Ga0495661_0047331 3300046665 Bacteria 2619
731 Ga0495661_0059852 3300046665 Bacteria 2265
732 Ga0495661_0150507 3300046665 Bacteria 1257
733 Ga0495661_0188618 3300046665 Bacteria 1087
734 Ga0495661_0203703 3300046665 Bacteria 1034
735 Ga0495588_0004571 3300046674 Bacteria 6117
736 Ga0495588_0031377 3300046674 Bacteria 2674
737 Ga0495588_0185077 3300046674 Bacteria 1100
738 Ga0495623_0058263 3300046679 Bacteria 2428
739 Ga0495646_0004661 3300046680 Bacteria 8632
740 Ga0495646_0018341 3300046680 Bacteria 4432
741 Ga0495646_0031320 3300046680 Bacteria 3315
742 Ga0495669_0007606 3300046684 Bacteria 4546
743 Ga0495613_0020167 3300046689 Bacteria 4967
744 Ga0495613_0020800 3300046689 Bacteria 4892
745 Ga0495624_0002320 3300046690 Bacteria 14490
746 Ga0495670_0001008 3300046691 Bacteria 13684
747 Ga0495670_0001827 3300046691 Bacteria 10464
748 Ga0495670_0009675 3300046691 Bacteria 4738
749 Ga0495670_0038629 3300046691 Bacteria 2380
750 Ga0495670_0045772 3300046691 Bacteria 2184
751 Ga0495670_0097679 3300046691 Bacteria 1509
752 Ga0495670_0099344 3300046691 Bacteria 1497
753 Ga0495670_0120305 3300046691 Bacteria 1363
754 Ga0495670_0283351 3300046691 Bacteria 886
755 Ga0495671_0000415 3300046692 Bacteria 34078
756 Ga0495671_0002908 3300046692 Bacteria 10683
757 Ga0495671_0011835 3300046692 Bacteria 4782
758 Ga0495671_0031111 3300046692 Bacteria 2729
759 Ga0495671_0032779 3300046692 Bacteria 2650
760 Ga0495671_0032798 3300046692 Bacteria 2649
761 Ga0495671_0064917 3300046692 Bacteria 1796
762 Ga0495671_0092210 3300046692 Bacteria 1482
763 Ga0495671_0096145 3300046692 Bacteria 1449
764 Ga0495671_0208610 3300046692 Bacteria 947
765 Ga0495649_0001071 3300046694 Bacteria 21366
766 Ga0495649_0002749 3300046694 Bacteria 12244
767 Ga0495649_0003235 3300046694 Bacteria 11117
768 Ga0495649_0004821 3300046694 Bacteria 8732
769 Ga0495649_0004928 3300046694 Bacteria 8607
770 Ga0495649_0012055 3300046694 Bacteria 5045
771 Ga0495649_0013691 3300046694 Bacteria 4674
772 Ga0495649_0015332 3300046694 Bacteria 4363
773 Ga0495649_0015879 3300046694 Bacteria 4277
774 Ga0495649_0021277 3300046694 Bacteria 3634
775 Ga0495649_0021899 3300046694 Bacteria 3579
776 Ga0495649_0030263 3300046694 Bacteria 2990
777 Ga0495649_0042553 3300046694 Bacteria 2481
778 Ga0495649_0043272 3300046694 Bacteria 2458
779 Ga0495649_0065165 3300046694 Bacteria 1955
780 Ga0495649_0081201 3300046694 Bacteria 1733
781 Ga0495649_0159288 3300046694 Bacteria 1184
782 Ga0495589_0001040 3300046794 Bacteria 16709
783 Ga0495589_0001085 3300046794 Bacteria 16223
784 Ga0495589_0006048 3300046794 Bacteria 6392
785 Ga0495589_0011262 3300046794 Bacteria 4642
786 Ga0495589_0012023 3300046794 Bacteria 4488
787 Ga0495589_0012890 3300046794 Bacteria 4320
788 Ga0495589_0016049 3300046794 Bacteria 3848
789 Ga0495589_0025990 3300046794 Bacteria 2968
790 Ga0495589_0079168 3300046794 Bacteria 1599
791 Ga0495589_0108393 3300046794 Bacteria 1341
792 Ga0495600_0110137 3300046809 Bacteria 1793
793 Ga0495660_0002844 3300046810 Bacteria 10874
794 Ga0495660_0004613 3300046810 Bacteria 8313
795 Ga0495660_0005773 3300046810 Bacteria 7393
796 Ga0495660_0006869 3300046810 Bacteria 6703
797 Ga0495660_0017007 3300046810 Bacteria 4188
798 Ga0495660_0037062 3300046810 Bacteria 2717
799 Ga0495660_0037656 3300046810 Bacteria 2693
800 Ga0495660_0059217 3300046810 Bacteria 2060
801 Ga0495660_0069063 3300046810 Bacteria 1878
802 Ga0495660_0069209 3300046810 Bacteria 1876
803 Ga0495660_0096017 3300046810 Bacteria 1532
804 Ga0495660_0097387 3300046810 Bacteria 1519
805 Ga0495660_0107161 3300046810 Bacteria 1430
806 Ga0495660_0108713 3300046810 Bacteria 1417
807 Ga0495660_0113841 3300046810 Bacteria 1377
808 Ga0495660_0118322 3300046810 Bacteria 1343
809 Ga0495660_0128236 3300046810 Bacteria 1275
810 Ga0495581_0051677 3300047315 Bacteria 2373
811 Ga0495581_0129163 3300047315 Bacteria 1472
812 Ga0495604_0003901 3300047317 Bacteria 11877
813 Ga0495604_0008008 3300047317 Bacteria 8370
814 Ga0495604_0058134 3300047317 Bacteria 2970
815 Ga0495636_0002568 3300047318 Bacteria 6976
816 Ga0495636_0018810 3300047318 Bacteria 2772
817 Ga0495674_0038248 3300047319 Bacteria 4308
818 Ga0495672_0002750 3300047320 Bacteria 15768
819 Ga0495672_0003070 3300047320 Bacteria 14616
820 Ga0495672_0003397 3300047320 Bacteria 13683
821 Ga0495672_0003663 3300047320 Bacteria 12999
822 Ga0495672_0004039 3300047320 Bacteria 12260
823 Ga0495672_0005137 3300047320 Bacteria 10445
824 Ga0495672_0011290 3300047320 Bacteria 6313
825 Ga0495672_0011419 3300047320 Bacteria 6270
826 Ga0495672_0013225 3300047320 Bacteria 5703
827 Ga0495672_0016074 3300047320 Bacteria 5059
828 Ga0495672_0064192 3300047320 Bacteria 2103
829 Ga0495672_0111857 3300047320 Bacteria 1464
830 Ga0495672_0112084 3300047320 Bacteria 1462
831 Ga0495672_0115897 3300047320 Bacteria 1431
832 Ga0495672_0122837 3300047320 Bacteria 1377
833 Ga0495672_0212695 3300047320 Bacteria 959
834 Ga0495676_0005024 3300047321 Bacteria 12131
835 Ga0495676_0027525 3300047321 Bacteria 4872
836 Ga0495680_0006104 3300047322 Bacteria 11249
837 Ga0495680_0007570 3300047322 Bacteria 9929
838 Ga0495680_0044813 3300047322 Bacteria 3495
839 Ga0495680_0148474 3300047322 Bacteria 1710
840 Ga0495683_0000217 3300047323 Bacteria 54243
841 Ga0495683_0000464 3300047323 Bacteria 31750
842 Ga0495683_0004447 3300047323 Bacteria 7959
843 Ga0495683_0008973 3300047323 Bacteria 5335
844 Ga0495683_0018735 3300047323 Bacteria 3576
845 Ga0495683_0039798 3300047323 Bacteria 2375
846 Ga0495683_0051085 3300047323 Bacteria 2068
847 Ga0495683_0052111 3300047323 Bacteria 2043
848 Ga0495683_0056707 3300047323 Bacteria 1948
849 Ga0495683_0058175 3300047323 Bacteria 1920
850 Ga0495683_0138268 3300047323 Bacteria 1143
851 Ga0495683_0179958 3300047323 Bacteria 966
852 Ga0495683_0192837 3300047323 Bacteria 923
853 Ga0495687_000808 3300047443 Bacteria 33677
854 Ga0495687_003204 3300047443 Bacteria 12126
855 Ga0495687_006913 3300047443 Bacteria 6831
856 Ga0495675_0000981 3300047444 Bacteria 17308
857 Ga0495675_0161668 3300047444 Bacteria 1378
858 Ga0495675_0166675 3300047444 Bacteria 1355
859 Ga0495677_0003975 3300047445 Bacteria 5713
860 Ga0495677_0116804 3300047445 Bacteria 1016
861 Ga0495679_001426 3300047446 Bacteria 13611
862 Ga0495679_002236 3300047446 Bacteria 10052
863 Ga0495679_004803 3300047446 Bacteria 6116
864 Ga0495679_005676 3300047446 Bacteria 5504
865 Ga0495679_005855 3300047446 Bacteria 5395
866 Ga0495679_006205 3300047446 Bacteria 5183
867 Ga0495679_008371 3300047446 Bacteria 4211
868 Ga0495679_012925 3300047446 Bacteria 3156
869 Ga0495685_008168 3300047447 Bacteria 3469
870 Ga0495685_021090 3300047447 Bacteria 2241
871 Ga0495673_0001075 3300047469 Bacteria 23963
872 Ga0495673_0002192 3300047469 Bacteria 14155
873 Ga0495673_0003526 3300047469 Bacteria 10297
874 Ga0495673_0004319 3300047469 Bacteria 8948
875 Ga0495673_0005488 3300047469 Bacteria 7659
876 Ga0495673_0005695 3300047469 Bacteria 7485
877 Ga0495673_0005830 3300047469 Bacteria 7367
878 Ga0495673_0006017 3300047469 Bacteria 7212
879 Ga0495673_0007446 3300047469 Bacteria 6292
880 Ga0495673_0015503 3300047469 Bacteria 3926
881 Ga0495673_0017676 3300047469 Bacteria 3612
882 Ga0495673_0044389 3300047469 Bacteria 1982
883 Ga0495673_0047806 3300047469 Bacteria 1889
884 Ga0495673_0049996 3300047469 Bacteria 1837
885 Ga0495673_0071114 3300047469 Bacteria 1463
886 Ga0495673_0107374 3300047469 Bacteria 1120
887 Ga0495681_0000937 3300047470 Bacteria 22507
888 Ga0495681_0003361 3300047470 Bacteria 11135
889 Ga0495681_0004841 3300047470 Bacteria 9109
890 Ga0495681_0008258 3300047470 Bacteria 6541
891 Ga0495681_0008523 3300047470 Bacteria 6418
892 Ga0495681_0008572 3300047470 Bacteria 6395
893 Ga0495681_0008798 3300047470 Bacteria 6286
894 Ga0495681_0009250 3300047470 Bacteria 6091
895 Ga0495681_0010160 3300047470 Bacteria 5722
896 Ga0495681_0011225 3300047470 Bacteria 5354
897 Ga0495681_0015123 3300047470 Bacteria 4379
898 Ga0495681_0027620 3300047470 Bacteria 2932
899 Ga0495681_0044062 3300047470 Bacteria 2147
900 Ga0495681_0097407 3300047470 Bacteria 1290
901 Ga0495681_0172592 3300047470 Bacteria 893
902 Ga0495684_0028188 3300047471 Bacteria 4312
903 Ga0495686_0003379 3300047472 Bacteria 13896
904 Ga0495686_0007931 3300047472 Bacteria 7881
905 Ga0495686_0042420 3300047472 Bacteria 2893
906 Ga0495686_0053891 3300047472 Bacteria 2519
907 Ga0495686_0140007 3300047472 Bacteria 1428
908 Ga0495593_0003244 3300047673 Bacteria 9752
909 Ga0495593_0057509 3300047673 Bacteria 2041
910 Ga0495602_0008372 3300048088 Bacteria 10809
911 Ga0495614_0077361 3300048089 Bacteria 1439
912 Ga0495614_0129021 3300048089 Bacteria 1118
913 Ga0495626_0000172 3300048091 Bacteria 79971
914 Ga0495626_0001853 3300048091 Bacteria 15869
915 Ga0495626_0002202 3300048091 Bacteria 13987
916 Ga0495626_0002695 3300048091 Bacteria 12005
917 Ga0495626_0006356 3300048091 Bacteria 6736
918 Ga0495626_0007749 3300048091 Bacteria 5949
919 Ga0495626_0011599 3300048091 Bacteria 4655
920 Ga0495626_0011815 3300048091 Bacteria 4599
921 Ga0495626_0035316 3300048091 Bacteria 2386
922 Ga0495626_0040126 3300048091 Bacteria 2212
923 Ga0495626_0052893 3300048091 Bacteria 1870
924 Ga0495626_0068960 3300048091 Bacteria 1593
925 Ga0495626_0100721 3300048091 Bacteria 1259
926 Ga0496102_0000654 3300048905 Bacteria 34908
927 Ga0496102_0392581 3300048905 Bacteria 1305
928 Ga0496103_0002886 3300048906 Bacteria 10665
929 Ga0496104_0349663 3300048907 Bacteria 1391
930 Ga0496106_0241478 3300048909 Bacteria 1443
931 Ga0496107_0171508 3300048910 Bacteria 1610
932 Ga0496110_0170723 3300048913 Bacteria 1973
933 Ga0496111_0128527 3300048914 Bacteria 1874
934 Ga0496112_0166220 3300048915 Bacteria 2172
935 Ga0496116_0000085 3300048919 Bacteria 219553
936 Ga0496116_0000936 3300048919 Bacteria 35925
937 Ga0496116_0005600 3300048919 Bacteria 11573
938 Ga0496116_0008001 3300048919 Bacteria 9256
939 Ga0496116_0106783 3300048919 Bacteria 1656
940 Ga0496117_0000332 3300048920 Bacteria 83405
941 Ga0496117_0009105 3300048920 Bacteria 9327
942 Ga0496117_0019291 3300048920 Bacteria 5608
943 Ga0496117_0089990 3300048920 Bacteria 1979
944 Ga0496117_0098201 3300048920 Bacteria 1862
945 Ga0496117_0124851 3300048920 Bacteria 1573
946 Ga0496117_0127567 3300048920 Bacteria 1549
947 Ga0496117_0226088 3300048920 Bacteria 1037
948 Ga0496118_0007664 3300048921 Bacteria 11363
949 Ga0496118_0013821 3300048921 Bacteria 7601
950 Ga0496118_0015541 3300048921 Bacteria 7040
951 Ga0496118_0019898 3300048921 Bacteria 5977
952 Ga0496118_0021559 3300048921 Bacteria 5666
953 Ga0496118_0024485 3300048921 Bacteria 5206
954 Ga0496118_0037451 3300048921 Bacteria 3902
955 Ga0496118_0052537 3300048921 Bacteria 3107
956 Ga0496119_0064184 3300048922 Bacteria 2181
957 Ga0496120_0033134 3300048923 Bacteria 3107
958 Ga0496120_0039182 3300048923 Bacteria 2798
959 Ga0496121_0000179 3300048924 Bacteria 141214
960 Ga0496121_0009905 3300048924 Bacteria 10850
961 Ga0496121_0014310 3300048924 Bacteria 8434
962 Ga0496121_0022248 3300048924 Bacteria 6165
963 Ga0496121_0027821 3300048924 Bacteria 5280
964 Ga0496121_0084132 3300048924 Bacteria 2509
965 Ga0496122_0009989 3300048925 Bacteria 9880
966 Ga0496122_0011043 3300048925 Bacteria 9218
967 Ga0496122_0051696 3300048925 Bacteria 3119
968 Ga0496122_0051995 3300048925 Bacteria 3106
969 Ga0496122_0155696 3300048925 Bacteria 1402
970 Ga0496123_0004588 3300048926 Bacteria 14389
971 Ga0496123_0013820 3300048926 Bacteria 6736
972 Ga0496123_0018644 3300048926 Bacteria 5505
973 Ga0496123_0072506 3300048926 Bacteria 2142
974 Ga0496123_0136342 3300048926 Bacteria 1350
975 Ga0496124_0008970 3300048927 Bacteria 10351
976 Ga0496124_0020565 3300048927 Bacteria 6093
977 Ga0496124_0034086 3300048927 Bacteria 4473
978 Ga0496124_0048578 3300048927 Bacteria 3625
979 Ga0496124_0094334 3300048927 Bacteria 2434
980 Ga0496124_0138186 3300048927 Bacteria 1926
981 Ga0496124_0157213 3300048927 Bacteria 1776
982 Ga0496124_0250598 3300048927 Bacteria 1310
983 Ga0496124_0275222 3300048927 Bacteria 1230
984 Ga0496125_0009085 3300048928 Bacteria 10281
985 Ga0496125_0021049 3300048928 Bacteria 6096
986 Ga0496125_0023272 3300048928 Bacteria 5722
987 Ga0496125_0028904 3300048928 Bacteria 4993
988 Ga0496125_0064296 3300048928 Bacteria 2916
989 Ga0496125_0133247 3300048928 Bacteria 1744
990 Ga0496126_0024107 3300048929 Bacteria 5877
991 Ga0496126_0055192 3300048929 Bacteria 3595
992 Ga0495678_002211 3300049459 Bacteria 13640
993 Ga0495678_002245 3300049459 Bacteria 13452
994 Ga0495678_002671 3300049459 Bacteria 11803
995 Ga0495678_004787 3300049459 Bacteria 7704
996 Ga0495678_009716 3300049459 Bacteria 4726
997 Ga0495678_010990 3300049459 Bacteria 4357
998 Ga0495678_012004 3300049459 Bacteria 4122
999 Ga0495678_012309 3300049459 Bacteria 4060
1000 Ga0495678_020457 3300049459 Bacteria 2929
1001 Ga0495678_025421 3300049459 Bacteria 2542
1002 Ga0495678_030569 3300049459 Bacteria 2252
1003 Ga0495678_032688 3300049459 Bacteria 2153
1004 Ga0495678_032789 3300049459 Bacteria 2149
1005 Ga0495678_066860 3300049459 Bacteria 1329
1006 Ga0495678_077512 3300049459 Bacteria 1202
1007 Ga0495678_096519 3300049459 Bacteria 1031
1008 Ga0495678_100236 3300049459 Bacteria 1004
1009 Ga0495682_0003144 3300049460 Bacteria 7454
1010 Ga0495682_0003548 3300049460 Bacteria 6902
1011 Ga0495682_0005657 3300049460 Bacteria 5165
1012 Ga0495682_0028956 3300049460 Bacteria 2051
1013 Ga0495682_0036648 3300049460 Bacteria 1805
1014 Ga0495682_0059723 3300049460 Bacteria 1377
1015 Ga0495682_0102520 3300049460 Bacteria 1026
1016 Ga0495682_0144445 3300049460 Bacteria 849
1017 Ga0501222_002448 3300049662 Bacteria 2573
1018 Ga0501241_003240 3300049758 Bacteria 3088
1019 nmdc:mga03683_40049_c2 3300050489 Bacteria 1275
1020 nmdc:mga03683_8835_c1 3300050489 Bacteria 3560
1021 nmdc:mga00v17_138601_c1 3300050491 Bacteria 1559
1022 nmdc:mga00v17_169359_c1 3300050491 Bacteria 1408
1023 nmdc:mga00v17_25258_c2 3300050491 Bacteria 1976
1024 nmdc:mga00v17_327776_c1 3300050491 Bacteria 995
1025 nmdc:mga00v17_385593_c1 3300050491 Bacteria 911
1026 Ga0500651_0306606 3300053093 Bacteria 910
1027 Ga0500572_001081 3300053111 Bacteria 8023
1028 Ga0500621_138299 3300053126 Bacteria 926
1029 Ga0500586_050880 3300053145 Bacteria 1428
1030 Ga0500634_0005519 3300053161 Bacteria 6014

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046691 Ga0495670_0038629 Ga0495670_0038629_1648_2367 239
2 3300031911 Ga0307412_10014522 Ga0307412_100145225 243
3 3300032004 Ga0307414_10095031 Ga0307414_100950311 243
4 iso_pu_bacteria 2511231156 2511823508 245
5 iso_pu_bacteria 2597489889 2597871013 245
6 iso_pu_bacteria 2599185167 2599400284 245
7 iso_pu_bacteria 2599185179 2599451385 245
8 iso_pu_bacteria 2599185189 2599508700 245
9 iso_pu_bacteria 2599185190 2599512559 245
10 iso_pu_bacteria 2599185191 2599519908 245
11 iso_pu_bacteria 2599185212 2599615628 245
12 iso_pu_bacteria 2599185248 2599773687 245
13 iso_pu_bacteria 2599185288 2599878494 245
14 iso_pu_bacteria 2599185289 2599887705 245
15 iso_pu_bacteria 2599185290 2599891235 245
16 iso_pu_bacteria 2599185291 2599899816 245
17 iso_pu_bacteria 2599185302 2599941967 245
18 iso_pu_bacteria 2599185303 2599947697 245
19 iso_pu_bacteria 2599185304 2599952513 245
20 iso_pu_bacteria 2599185305 2599960392 245
21 iso_pu_bacteria 2599185306 2599965302 245
22 iso_pu_bacteria 2599185308 2599978559 245
23 iso_pu_bacteria 2599185309 2599982131 245
24 iso_pu_bacteria 2599185310 2599988043 245
25 iso_pu_bacteria 2599185311 2599995744 245
26 iso_pu_bacteria 2599185312 2599998069 245
27 iso_pu_bacteria 2599185313 2600009180 245
28 iso_pu_bacteria 2599185314 2600010534 245
29 iso_pu_bacteria 2599185315 2600017567 245
30 iso_pu_bacteria 2599185316 2600025436 245
31 iso_pu_bacteria 2599185317 2600030313 245
32 iso_pu_bacteria 2599185318 2600034579 245
33 iso_pu_bacteria 2599185319 2600041582 245
34 iso_pu_bacteria 2599185320 2600046369 245
35 iso_pu_bacteria 2599185321 2600052391 245
36 iso_pu_bacteria 2599185322 2600057747 245
37 iso_pu_bacteria 2599185323 2600065046 245
38 iso_pu_bacteria 2599185324 2600070333 245
39 iso_pu_bacteria 2599185325 2600078858 245
40 iso_pu_bacteria 2600254930 2600360745 245
41 iso_pu_bacteria 2600255296 2601689590 245
42 iso_pu_bacteria 2643221571 2643874249 245
43 iso_pu_bacteria 2643221650 2644281791 245
44 iso_pu_bacteria 2643221713 2644621986 245
45 iso_pu_bacteria 2651869719 2652545817 245
46 iso_pu_bacteria 2667528170 2671090366 245
47 iso_pu_bacteria 2667528176 2671125837 245
48 iso_pu_bacteria 2675903420 2677899936 245
49 iso_pu_bacteria 2675903515 2678262443 245
50 iso_pu_bacteria 2721755607 2723249906 245
51 iso_pu_bacteria 2738541294 2738808421 245
52 iso_pu_bacteria 2738541309 2738895781 245
53 iso_pu_bacteria 2744054620 2745008787 245
54 iso_pu_bacteria 2808606361 2808856050 245
55 iso_pu_bacteria 2808606376 2808923517 245
56 iso_pu_bacteria 2808606378 2808936199 245
57 iso_pu_bacteria 2808606380 2808945720 245
58 iso_pu_bacteria 2808606383 2808964555 245
59 iso_pu_bacteria 2808606385 2808977861 245
60 iso_pu_bacteria 2808606388 2808993341 245
61 iso_pu_bacteria 2808606389 2808999443 245
62 iso_pu_bacteria 2825651385 2825653207 245
63 iso_pu_bacteria 2834028612 2834031843 245
64 iso_pu_bacteria 2842826826 2842827622 245
65 iso_pu_bacteria 2842837860 2842841269 245
66 iso_pu_bacteria 2842854478 2842854487 245
67 iso_pu_bacteria 2852612431 2852613068 245
68 iso_pu_bacteria 2852667396 2852669197 245
69 iso_pu_bacteria 2908446538 2908451061 245
70 iso_pu_bacteria 2913036834 2913038416 245
71 iso_pu_bacteria 2919481497 2919481684 245
72 iso_pu_bacteria 2923586266 2923587464 245
73 iso_pu_bacteria 2929144301 2929145859 245
74 iso_pu_bacteria 2931369376 2931370795 245
75 iso_pu_bacteria 2931390751 2931395018 245
76 iso_pu_bacteria 2945928738 2945932290 245
77 iso_pu_bacteria 2946006987 2946008479 245
78 iso_pu_bacteria 2947233263 2947238992 245
79 iso_pu_bacteria 2988728565 2988733402 245
80 iso_pu_bacteria 3007866637 3007870495 245
81 iso_pu_bacteria 651053060 651176441 245
82 iso_pu_bacteria 8054285046 8054290529 245
83 iso_pu_bacteria 8054347763 8054350723 245
84 iso_pu_bacteria 8054503363 8054507525 245
85 iso_pu_bacteria 8056143049 8056147426 245
86 iso_pu_bacteria 8056148874 8056153248 245
87 iso_pu_bacteria 8056161164 8056162131 245
88 iso_pu_bacteria 2619619299 2621298290 246
89 iso_pu_bacteria 2738541265 2738671325 246
90 iso_pu_bacteria 2738541282 2738749719 246
91 iso_pu_bacteria 2738541303 2738858759 246
92 iso_pu_bacteria 2816332298 2817492565 246
93 iso_pu_bacteria 3007252601 3007256851 246
94 iso_pu_bacteria 3007315729 3007318909 246
95 iso_pu_bacteria 3007419365 3007421177 246
96 iso_pu_bacteria 8055817908 8055822467 246
97 3300015265 Ga0182005_1056848 Ga0182005_10568481 247
98 3300041405 Ga0439438_000506 Ga0439438_000506_12060_12803 247
99 3300041405 Ga0439438_002209 Ga0439438_002209_7270_8013 247
100 3300042185 Ga0450909_002054 Ga0450909_002054_158_901 247
101 iso_pu_bacteria 2511231006 2511267594 248
102 iso_pu_bacteria 2511231007 2511271988 248
103 iso_pu_bacteria 2511231008 2511280222 248
104 iso_pu_bacteria 2511231016 2511327115 248
105 iso_pu_bacteria 2511231018 2511339070 248
106 iso_pu_bacteria 2511231019 2511346797 248
107 iso_pu_bacteria 2511231020 2511351162 248
108 iso_pu_bacteria 2511231021 2511354313 248
109 iso_pu_bacteria 2511231022 2511365249 248
110 iso_pu_bacteria 2512047018 2512324998 248
111 iso_pu_bacteria 2582580891 2583791122 248
112 iso_pu_bacteria 2597489887 2597856733 248
113 iso_pu_bacteria 2599185185 2599483756 248
114 iso_pu_bacteria 2599185257 2599801402 248
115 iso_pu_bacteria 2600254931 2600365703 248
116 iso_pu_bacteria 2623620446 2624493686 248
117 iso_pu_bacteria 2643221565 2643841855 248
118 iso_pu_bacteria 2643221589 2643952462 248
119 iso_pu_bacteria 2643221602 2644022224 248
120 iso_pu_bacteria 2671180172 2671768351 248
121 iso_pu_bacteria 2740892503 2743736161 248
122 iso_pu_bacteria 2808606382 2808957571 248
123 iso_pu_bacteria 2919456309 2919457227 248
124 iso_pu_bacteria 2919697872 2919703614 248
125 iso_pu_bacteria 2923153595 2923155175 248
126 iso_pu_bacteria 2939636861 2939639855 248
127 iso_pu_bacteria 2984286254 2984290863 248
128 iso_pu_bacteria 3007395558 3007400716 248
129 iso_pu_bacteria 3007511990 3007512897 248
130 iso_pu_bacteria 8015687852 8015689394 248
131 iso_pu_bacteria 8019775933 8019781189 248
132 iso_pu_bacteria 8055770955 8055772530 248
133 iso_pu_bacteria 8056155041 8056156754 248
134 iso_pu_bacteria 8056177738 8056181037 248
135 2162886007 SwRhRL2b_contig_1281804 SwRhRL2b_0732.00001080 249
136 3300002738 JGI25154J39366_1004045 JGI25154J39366_10040453 249
137 3300003751 Ga0055538_1000086 Ga0055538_100008623 249
138 3300003752 Ga0055539_1000128 Ga0055539_100012823 249
139 3300003756 Ga0055533_1000270 Ga0055533_100027024 249
140 3300003759 Ga0055525_1000195 Ga0055525_100019550 249
141 3300003791 Ga0055530_10000660 Ga0055530_1000066020 249
142 3300003841 Ga0055541_1000184 Ga0055541_100018424 249
143 3300005288 Ga0065714_10004358 Ga0065714_100043587 249
144 3300005288 Ga0065714_10004643 Ga0065714_100046434 249
145 3300005331 Ga0070670_100003837 Ga0070670_1000038378 249
146 3300005353 Ga0070669_100000272 Ga0070669_10000027215 249
147 3300005539 Ga0068853_100067423 Ga0068853_1000674232 249
148 3300005564 Ga0070664_100053152 Ga0070664_1000531523 249
149 3300005578 Ga0068854_100052237 Ga0068854_1000522373 249
150 3300005834 Ga0068851_10000028 Ga0068851_1000002897 249
151 3300006946 Ga0079104_1000559 Ga0079104_100055922 249
152 3300006948 Ga0099826_10038410 Ga0099826_100384103 249
153 3300009011 Ga0105251_10001124 Ga0105251_100011249 249
154 3300009092 Ga0105250_10000261 Ga0105250_1000026138 249
155 3300009177 Ga0105248_10103715 Ga0105248_101037153 249
156 3300013100 Ga0157373_10003758 Ga0157373_100037585 249
157 3300013100 Ga0157373_10009739 Ga0157373_100097396 249
158 3300013102 Ga0157371_10064150 Ga0157371_100641502 249
159 3300013104 Ga0157370_10070976 Ga0157370_100709763 249
160 3300013105 Ga0157369_10012309 Ga0157369_100123098 249
161 3300013308 Ga0157375_10066119 Ga0157375_100661192 249
162 3300014497 Ga0182008_10003354 Ga0182008_100033543 249
163 3300014497 Ga0182008_10187995 Ga0182008_101879951 249
164 3300015261 Ga0182006_1002581 Ga0182006_10025817 249
165 3300015261 Ga0182006_1003687 Ga0182006_10036875 249
166 3300015262 Ga0182007_10003579 Ga0182007_100035796 249
167 3300017792 Ga0163161_10022653 Ga0163161_100226531 249
168 3300017792 Ga0163161_10165295 Ga0163161_101652952 249
169 3300017792 Ga0163161_10486772 Ga0163161_104867721 249
170 3300025206 Ga0209435_100480 Ga0209435_1004804 249
171 3300025224 Ga0209784_100017 Ga0209784_100017222 249
172 3300025225 Ga0209566_100014 Ga0209566_100014222 249
173 3300025226 Ga0209674_100028 Ga0209674_100028222 249
174 3300025229 Ga0209147_100038 Ga0209147_10003877 249
175 3300025230 Ga0209563_100032 Ga0209563_100032222 249
176 3300025233 Ga0209437_106252 Ga0209437_1062522 249
177 3300025242 Ga0209258_100197 Ga0209258_1001972 249
178 3300025246 Ga0209646_1000377 Ga0209646_10003776 249
179 3300025253 Ga0209677_100018 Ga0209677_100018222 249
180 3300025256 Ga0209759_1019689 Ga0209759_10196891 249
181 3300025292 Ga0209676_1004876 Ga0209676_10048765 249
182 3300025298 Ga0209050_1000009 Ga0209050_1000009186 249
183 3300025303 Ga0209051_1000053 Ga0209051_1000053186 249
184 3300025304 Ga0209257_1015422 Ga0209257_10154224 249
185 3300025321 Ga0207656_10000095 Ga0207656_100000957 249
186 3300025711 Ga0207696_1000043 Ga0207696_1000043158 249
187 3300025735 Ga0207713_1005711 Ga0207713_10057117 249
188 3300025923 Ga0207681_10002444 Ga0207681_1000244410 249
189 3300025925 Ga0207650_10000180 Ga0207650_1000018030 249
190 3300025933 Ga0207706_10001223 Ga0207706_1000122324 249
191 3300025945 Ga0207679_10199053 Ga0207679_101990532 249
192 3300025981 Ga0207640_10039885 Ga0207640_100398854 249
193 3300026041 Ga0207639_10048093 Ga0207639_100480932 249
194 3300027111 Ga0209281_1000018 Ga0209281_1000018509 249
195 3300027666 Ga0209282_1105366 Ga0209282_11053662 249
196 3300028379 Ga0268266_10166407 Ga0268266_101664073 249
197 3300028786 Ga0307517_10060304 Ga0307517_100603041 249
198 3300030521 Ga0307511_10139188 Ga0307511_101391882 249
199 3300031507 Ga0307509_10190435 Ga0307509_101904352 249
200 3300031548 Ga0307408_100164061 Ga0307408_1001640612 249
201 3300031548 Ga0307408_100404070 Ga0307408_1004040702 249
202 3300031731 Ga0307405_10001198 Ga0307405_100011982 249
203 3300031731 Ga0307405_10001406 Ga0307405_100014067 249
204 3300031824 Ga0307413_10039227 Ga0307413_100392272 249
205 3300031901 Ga0307406_10018838 Ga0307406_100188382 249
206 3300031901 Ga0307406_10081360 Ga0307406_100813602 249
207 3300031911 Ga0307412_10001319 Ga0307412_100013197 249
208 3300031911 Ga0307412_10014797 Ga0307412_100147974 249
209 3300031911 Ga0307412_10027034 Ga0307412_100270342 249
210 3300032002 Ga0307416_100227288 Ga0307416_1002272882 249
211 3300041405 Ga0439438_001212 Ga0439438_001212_3071_3880 249
212 3300041407 Ga0439447_011203 Ga0439447_011203_1480_2229 249
213 3300041407 Ga0439447_013685 Ga0439447_013685_526_1335 249
214 3300041411 Ga0439466_0025700 Ga0439466_0025700_23_772 249
215 3300041411 Ga0439466_0080895 Ga0439466_0080895_142_951 249
216 3300041997 Ga0439431_0007196 Ga0439431_0007196_1369_2178 249
217 3300042004 Ga0439445_0000723 Ga0439445_0000723_3200_4009 249
218 3300042006 Ga0439432_008801 Ga0439432_008801_2724_3473 249
219 3300042006 Ga0439432_011908 Ga0439432_011908_595_1344 249
220 3300042009 Ga0439451_000415 Ga0439451_000415_860_1609 249
221 3300042009 Ga0439451_014764 Ga0439451_014764_809_1558 249
222 3300042010 Ga0439452_012013 Ga0439452_012013_337_1128 249
223 3300042010 Ga0439452_012111 Ga0439452_012111_702_1451 249
224 3300042013 Ga0439456_014339 Ga0439456_014339_130_879 249
225 3300042016 Ga0439463_003653 Ga0439463_003653_1630_2379 249
226 3300042124 Ga0450922_003693 Ga0450922_003693_240_989 249
227 3300042147 Ga0450910_002656 Ga0450910_002656_1265_2074 249
228 3300042156 Ga0439446_0017353 Ga0439446_0017353_1042_1851 249
229 3300046507 Ga0495606_0051641 Ga0495606_0051641_1866_2615 249
230 3300046507 Ga0495606_0137669 Ga0495606_0137669_26_775 249
231 3300046512 Ga0495610_0004342 Ga0495610_0004342_2508_3257 249
232 3300046512 Ga0495610_0069666 Ga0495610_0069666_775_1524 249
233 3300046512 Ga0495610_0132963 Ga0495610_0132963_22_771 249
234 3300046518 Ga0495631_0086802 Ga0495631_0086802_218_967 249
235 3300046530 Ga0495654_0008472 Ga0495654_0008472_2136_2885 249
236 3300046557 Ga0495622_0057241 Ga0495622_0057241_740_1489 249
237 3300046664 Ga0495659_0091258 Ga0495659_0091258_219_968 249
238 3300046692 Ga0495671_0208610 Ga0495671_0208610_130_879 249
239 3300047320 Ga0495672_0212695 Ga0495672_0212695_45_794 249
240 3300047446 Ga0495679_004803 Ga0495679_004803_2237_2986 249
241 3300047446 Ga0495679_005676 Ga0495679_005676_2293_3042 249
242 3300048920 Ga0496117_0089990 Ga0496117_0089990_665_1414 249
243 3300048920 Ga0496117_0127567 Ga0496117_0127567_721_1482 249
244 3300048920 Ga0496117_0226088 Ga0496117_0226088_111_860 249
245 3300048921 Ga0496118_0037451 Ga0496118_0037451_2489_3238 249
246 3300048921 Ga0496118_0052537 Ga0496118_0052537_215_964 249
247 3300048923 Ga0496120_0039182 Ga0496120_0039182_40_789 249
248 3300048924 Ga0496121_0022248 Ga0496121_0022248_2057_2806 249
249 3300048924 Ga0496121_0027821 Ga0496121_0027821_2741_3490 249
250 3300048925 Ga0496122_0051696 Ga0496122_0051696_371_1120 249
251 3300048925 Ga0496122_0155696 Ga0496122_0155696_146_895 249
252 3300048926 Ga0496123_0013820 Ga0496123_0013820_5971_6720 249
253 3300048926 Ga0496123_0072506 Ga0496123_0072506_676_1425 249
254 3300048927 Ga0496124_0138186 Ga0496124_0138186_1097_1846 249
255 3300048928 Ga0496125_0009085 Ga0496125_0009085_7127_7876 249
256 3300048928 Ga0496125_0064296 Ga0496125_0064296_1990_2739 249
257 3300048929 Ga0496126_0024107 Ga0496126_0024107_178_927 249
258 3300049662 Ga0501222_002448 Ga0501222_002448_1630_2379 249
259 3300053093 Ga0500651_0306606 Ga0500651_0306606_95_844 249
260 3300053161 Ga0500634_0005519 Ga0500634_0005519_3041_3790 249
261 iso_pu_bacteria 2599185188 2599504003 249
262 iso_pu_bacteria 2599185300 2599931959 249
263 iso_pu_bacteria 2791355520 2794596236 249
264 3300013100 Ga0157373_10175828 Ga0157373_101758282 250
265 3300013105 Ga0157369_10059231 Ga0157369_100592312 250
266 3300027312 Ga0209371_1000397 Ga0209371_10003974 250
267 3300030500 Ga0268256_1000340 Ga0268256_100034042 250
268 3300042439 Ga0439464_0003354 Ga0439464_0003354_1699_2514 250
269 3300042439 Ga0439464_0006878 Ga0439464_0006878_456_1214 250
270 3300046530 Ga0495654_0002891 Ga0495654_0002891_6449_7294 250
271 3300048929 Ga0496126_0055192 Ga0496126_0055192_2593_3345 250
272 iso_pu_bacteria 2511231004 2511252773 250
273 iso_pu_bacteria 2511231010 2511292094 250
274 iso_pu_bacteria 2511231011 2511296644 250
275 iso_pu_bacteria 2511231012 2511302117 250
276 iso_pu_bacteria 2511231014 2511312563 250
277 iso_pu_bacteria 2511231015 2511322498 250
278 iso_pu_bacteria 2511231017 2511335594 250
279 iso_pu_bacteria 2511231023 2511371942 250
280 iso_pu_bacteria 2511231031 2511416180 250
281 iso_pu_bacteria 2554235231 2555248647 250
282 iso_pu_bacteria 2554235341 2555668562 250
283 iso_pu_bacteria 2599185160 2599356934 250
284 iso_pu_bacteria 2599185161 2599362279 250
285 iso_pu_bacteria 2599185162 2599368599 250
286 iso_pu_bacteria 2599185163 2599375388 250
287 iso_pu_bacteria 2599185164 2599382039 250
288 iso_pu_bacteria 2599185165 2599388486 250
289 iso_pu_bacteria 2599185166 2599394246 250
290 iso_pu_bacteria 2599185168 2599406011 250
291 iso_pu_bacteria 2599185181 2599464561 250
292 iso_pu_bacteria 2599185182 2599468885 250
293 iso_pu_bacteria 2599185186 2599493584 250
294 iso_pu_bacteria 2599185356 2600216838 250
295 iso_pu_bacteria 2600255313 2601776565 250
296 iso_pu_bacteria 2600255318 2601801140 250
297 iso_pu_bacteria 2603880185 2606073234 250
298 iso_pu_bacteria 2603880199 2606126109 250
299 iso_pu_bacteria 2623620443 2624479317 250
300 iso_pu_bacteria 2643221633 2644187275 250
301 iso_pu_bacteria 2667528171 2671098918 250
302 iso_pu_bacteria 2713897149 2715754888 250
303 iso_pu_bacteria 2738543004 2739200746 250
304 iso_pu_bacteria 2738543015 2739256413 250
305 iso_pu_bacteria 2738543025 2739314224 250
306 iso_pu_bacteria 2773857670 2774122760 250
307 iso_pu_bacteria 2773857673 2774137473 250
308 iso_pu_bacteria 2784132063 2784259921 250
309 iso_pu_bacteria 2784132072 2784315118 250
310 iso_pu_bacteria 2808606377 2808929912 250
311 iso_pu_bacteria 2808606381 2808952013 250
312 iso_pu_bacteria 2808606445 2809216264 250
313 iso_pu_bacteria 2818991456 2819654126 250
314 iso_pu_bacteria 2818991464 2819704039 250
315 iso_pu_bacteria 2844665904 2844669060 250
316 iso_pu_bacteria 2852657418 2852658790 250
317 iso_pu_bacteria 2860339153 2860340137 250
318 iso_pu_bacteria 2878029506 2878031326 250
319 iso_pu_bacteria 2880230671 2880232180 250
320 iso_pu_bacteria 2904518522 2904521918 250
321 iso_pu_bacteria 2904550169 2904553310 250
322 iso_pu_bacteria 2917070673 2917072333 250
323 iso_pu_bacteria 2919063839 2919064205 250
324 iso_pu_bacteria 2931396565 2931399969 250
325 iso_pu_bacteria 2935353572 2935354497 250
326 iso_pu_bacteria 2939651529 2939656694 250
327 iso_pu_bacteria 2969304461 2969306094 250
328 iso_pu_bacteria 3007614139 3007618927 250
329 iso_pu_bacteria 3007619802 3007620304 250
330 iso_pu_bacteria 3007718800 3007723178 250
331 iso_pu_bacteria 637000220 637318923 250
332 iso_pu_bacteria 8019769354 8019771102 250
333 iso_pu_bacteria 8029995093 8029999253 250
334 iso_pu_bacteria 8056125926 8056130299 250
335 iso_pu_bacteria 8056172158 8056175671 250
336 iso_pu_bacteria 8056569372 8056573345 250
337 iso_pu_bacteria 8057798959 8057803850 250
338 3300005564 Ga0070664_100000075 Ga0070664_10000007546 251
339 3300009036 Ga0105244_10000558 Ga0105244_100005589 251
340 3300009176 Ga0105242_10000418 Ga0105242_1000041821 251
341 3300009545 Ga0105237_10000856 Ga0105237_1000085637 251
342 3300011119 Ga0105246_10070068 Ga0105246_100700682 251
343 3300013100 Ga0157373_10051169 Ga0157373_100511694 251
344 3300013104 Ga0157370_10068821 Ga0157370_100688213 251
345 3300013105 Ga0157369_10004662 Ga0157369_100046628 251
346 3300013308 Ga0157375_10034056 Ga0157375_100340563 251
347 3300025728 Ga0207655_1000095 Ga0207655_100009564 251
348 3300025914 Ga0207671_10000035 Ga0207671_1000003564 251
349 3300025920 Ga0207649_10000017 Ga0207649_10000017113 251
350 3300025934 Ga0207686_10002363 Ga0207686_100023633 251
351 3300025945 Ga0207679_10000005 Ga0207679_10000005142 251
352 3300048928 Ga0496125_0028904 Ga0496125_0028904_2336_3103 251
353 2124908027 MRS2a_Contig_7032 MRS2a_00219460 252
354 3300002737 JGI25162J39368_1000087 JGI25162J39368_100008730 252
355 3300002771 JGI25163J39215_1000110 JGI25163J39215_100011011 252
356 3300002772 JGI25164J39214_1000065 JGI25164J39214_100006529 252
357 3300003214 JGI25165J46597_1000091 JGI25165J46597_1000091149 252
358 3300003781 Ga0055536_1000041 Ga0055536_100004150 252
359 3300003781 Ga0055536_1000042 Ga0055536_100004290 252
360 3300003791 Ga0055530_10000063 Ga0055530_1000006330 252
361 3300003792 Ga0055540_1000318 Ga0055540_100031821 252
362 3300005288 Ga0065714_10031195 Ga0065714_100311951 252
363 3300005288 Ga0065714_10066756 Ga0065714_100667561 252
364 3300005288 Ga0065714_10067840 Ga0065714_100678406 252
365 3300005288 Ga0065714_10084753 Ga0065714_100847533 252
366 3300006058 Ga0075432_10001831 Ga0075432_100018313 252
367 3300006058 Ga0075432_10003614 Ga0075432_100036141 252
368 3300006058 Ga0075432_10008785 Ga0075432_100087855 252
369 3300006058 Ga0075432_10054957 Ga0075432_100549572 252
370 3300006914 Ga0075436_100048899 Ga0075436_1000488993 252
371 3300006946 Ga0079104_1000224 Ga0079104_100022463 252
372 3300009011 Ga0105251_10002955 Ga0105251_1000295511 252
373 3300009011 Ga0105251_10015589 Ga0105251_100155892 252
374 3300009036 Ga0105244_10004359 Ga0105244_100043598 252
375 3300009036 Ga0105244_10014817 Ga0105244_100148172 252
376 3300011119 Ga0105246_10530884 Ga0105246_105308841 252
377 3300013104 Ga0157370_10017968 Ga0157370_100179686 252
378 3300013104 Ga0157370_10032424 Ga0157370_100324241 252
379 3300013306 Ga0163162_10003530 Ga0163162_100035306 252
380 3300014497 Ga0182008_10003253 Ga0182008_100032536 252
381 3300014497 Ga0182008_10003488 Ga0182008_100034888 252
382 3300015261 Ga0182006_1000531 Ga0182006_100053115 252
383 3300015262 Ga0182007_10000270 Ga0182007_1000027015 252
384 3300015265 Ga0182005_1000757 Ga0182005_10007576 252
385 3300015265 Ga0182005_1042069 Ga0182005_10420692 252
386 3300015265 Ga0182005_1056233 Ga0182005_10562332 252
387 3300017792 Ga0163161_10014264 Ga0163161_100142647 252
388 3300025207 Ga0209760_100022 Ga0209760_10002228 252
389 3300025231 Ga0207427_100047 Ga0207427_100047222 252
390 3300025233 Ga0209437_100009 Ga0209437_100009222 252
391 3300025261 Ga0209233_1000032 Ga0209233_1000032222 252
392 3300025292 Ga0209676_1000021 Ga0209676_1000021120 252
393 3300025298 Ga0209050_1000107 Ga0209050_1000107119 252
394 3300025303 Ga0209051_1000090 Ga0209051_100009037 252
395 3300025728 Ga0207655_1000019 Ga0207655_1000019388 252
396 3300025728 Ga0207655_1001700 Ga0207655_10017006 252
397 3300025728 Ga0207655_1019559 Ga0207655_10195594 252
398 3300025735 Ga0207713_1015236 Ga0207713_10152362 252
399 3300025735 Ga0207713_1018106 Ga0207713_10181065 252
400 3300027111 Ga0209281_1000174 Ga0209281_1000174142 252
401 3300027907 Ga0207428_10091126 Ga0207428_100911262 252
402 3300030521 Ga0307511_10039640 Ga0307511_100396404 252
403 3300032004 Ga0307414_10105978 Ga0307414_101059781 252
404 3300041405 Ga0439438_001117 Ga0439438_001117_4157_4915 252
405 3300041405 Ga0439438_004349 Ga0439438_004349_4366_5124 252
406 3300041405 Ga0439438_019460 Ga0439438_019460_1111_1869 252
407 3300041405 Ga0439438_022078 Ga0439438_022078_121_879 252
408 3300041407 Ga0439447_005834 Ga0439447_005834_348_1106 252
409 3300041411 Ga0439466_0004829 Ga0439466_0004829_2576_3334 252
410 3300041411 Ga0439466_0008806 Ga0439466_0008806_214_972 252
411 3300041411 Ga0439466_0012108 Ga0439466_0012108_607_1365 252
412 3300041411 Ga0439466_0017740 Ga0439466_0017740_1599_2357 252
413 3300041411 Ga0439466_0049342 Ga0439466_0049342_211_969 252
414 3300041411 Ga0439466_0055545 Ga0439466_0055545_204_962 252
415 3300041411 Ga0439466_0087877 Ga0439466_0087877_22_780 252
416 3300042006 Ga0439432_006042 Ga0439432_006042_407_1165 252
417 3300042009 Ga0439451_013772 Ga0439451_013772_204_962 252
418 3300042009 Ga0439451_020635 Ga0439451_020635_219_977 252
419 3300042010 Ga0439452_000228 Ga0439452_000228_29115_29873 252
420 3300042010 Ga0439452_010820 Ga0439452_010820_80_838 252
421 3300042010 Ga0439452_026474 Ga0439452_026474_473_1231 252
422 3300042013 Ga0439456_033756 Ga0439456_033756_219_977 252
423 3300042013 Ga0439456_043206 Ga0439456_043206_148_906 252
424 3300042016 Ga0439463_000504 Ga0439463_000504_6562_7320 252
425 3300042016 Ga0439463_031917 Ga0439463_031917_222_980 252
426 3300042115 Ga0450911_001017 Ga0450911_001017_3028_3786 252
427 3300042115 Ga0450911_003254 Ga0450911_003254_149_907 252
428 3300042122 Ga0450920_000197 Ga0450920_000197_4111_4869 252
429 3300042124 Ga0450922_000479 Ga0450922_000479_3323_4081 252
430 3300042127 Ga0450890_008359 Ga0450890_008359_445_1203 252
431 3300042138 Ga0450903_012440 Ga0450903_012440_207_965 252
432 3300042145 Ga0450906_001726 Ga0450906_001726_3597_4355 252
433 3300042145 Ga0450906_014044 Ga0450906_014044_398_1156 252
434 3300042146 Ga0450907_000865 Ga0450907_000865_6199_6957 252
435 3300042184 Ga0450908_013293 Ga0450908_013293_318_1076 252
436 3300042531 Ga0450918_014980 Ga0450918_014980_126_884 252
437 3300046452 Ga0495617_000480 Ga0495617_000480_13660_14418 252
438 3300046452 Ga0495617_043440 Ga0495617_043440_371_1129 252
439 3300046453 Ga0495627_003307 Ga0495627_003307_473_1231 252
440 3300046453 Ga0495627_026479 Ga0495627_026479_380_1138 252
441 3300046453 Ga0495627_051758 Ga0495627_051758_212_970 252
442 3300046455 Ga0495603_0023969 Ga0495603_0023969_502_1260 252
443 3300046455 Ga0495603_0158898 Ga0495603_0158898_201_959 252
444 3300046457 Ga0495590_0000805 Ga0495590_0000805_10935_11693 252
445 3300046457 Ga0495590_0004330 Ga0495590_0004330_2034_2792 252
446 3300046457 Ga0495590_0005571 Ga0495590_0005571_3606_4364 252
447 3300046457 Ga0495590_0007997 Ga0495590_0007997_1249_2007 252
448 3300046457 Ga0495590_0036037 Ga0495590_0036037_718_1476 252
449 3300046458 Ga0495591_000264 Ga0495591_000264_34265_35023 252
450 3300046458 Ga0495591_006728 Ga0495591_006728_3830_4588 252
451 3300046458 Ga0495591_009889 Ga0495591_009889_223_981 252
452 3300046460 Ga0495638_0004376 Ga0495638_0004376_5686_6444 252
453 3300046460 Ga0495638_0010464 Ga0495638_0010464_4718_5476 252
454 3300046460 Ga0495638_0010596 Ga0495638_0010596_4284_5042 252
455 3300046460 Ga0495638_0011054 Ga0495638_0011054_5310_6074 252
456 3300046460 Ga0495638_0024749 Ga0495638_0024749_2440_3198 252
457 3300046460 Ga0495638_0065658 Ga0495638_0065658_1340_2098 252
458 3300046460 Ga0495638_0107767 Ga0495638_0107767_478_1236 252
459 3300046460 Ga0495638_0131424 Ga0495638_0131424_639_1397 252
460 3300046471 Ga0495650_0004225 Ga0495650_0004225_2640_3404 252
461 3300046471 Ga0495650_0005746 Ga0495650_0005746_4633_5391 252
462 3300046471 Ga0495650_0006190 Ga0495650_0006190_2704_3462 252
463 3300046471 Ga0495650_0013926 Ga0495650_0013926_2020_2778 252
464 3300046471 Ga0495650_0101196 Ga0495650_0101196_28_786 252
465 3300046472 Ga0495580_0287808 Ga0495580_0287808_95_853 252
466 3300046474 Ga0495605_0000742 Ga0495605_0000742_14741_15499 252
467 3300046474 Ga0495605_0005609 Ga0495605_0005609_4104_4862 252
468 3300046474 Ga0495605_0009712 Ga0495605_0009712_4072_4830 252
469 3300046474 Ga0495605_0149874 Ga0495605_0149874_265_1023 252
470 3300046475 Ga0495639_0000074 Ga0495639_0000074_25249_26007 252
471 3300046475 Ga0495639_0061262 Ga0495639_0061262_721_1479 252
472 3300046491 Ga0495584_0011758 Ga0495584_0011758_267_1025 252
473 3300046491 Ga0495584_0012361 Ga0495584_0012361_1621_2379 252
474 3300046491 Ga0495584_0187352 Ga0495584_0187352_18_776 252
475 3300046492 Ga0495585_0001397 Ga0495585_0001397_8989_9747 252
476 3300046492 Ga0495585_0004553 Ga0495585_0004553_4830_5588 252
477 3300046492 Ga0495585_0008495 Ga0495585_0008495_466_1224 252
478 3300046492 Ga0495585_0014496 Ga0495585_0014496_252_1010 252
479 3300046492 Ga0495585_0118533 Ga0495585_0118533_439_1197 252
480 3300046492 Ga0495585_0156705 Ga0495585_0156705_18_776 252
481 3300046499 Ga0495594_0008317 Ga0495594_0008317_3604_4362 252
482 3300046499 Ga0495594_0081474 Ga0495594_0081474_521_1279 252
483 3300046500 Ga0495596_0000004 Ga0495596_0000004_147619_148377 252
484 3300046501 Ga0495607_0002691 Ga0495607_0002691_3440_4204 252
485 3300046501 Ga0495607_0011331 Ga0495607_0011331_4845_5603 252
486 3300046501 Ga0495607_0013812 Ga0495607_0013812_244_1002 252
487 3300046501 Ga0495607_0014702 Ga0495607_0014702_284_1042 252
488 3300046501 Ga0495607_0017127 Ga0495607_0017127_57_815 252
489 3300046501 Ga0495607_0020174 Ga0495607_0020174_2748_3506 252
490 3300046501 Ga0495607_0069005 Ga0495607_0069005_57_815 252
491 3300046507 Ga0495606_0055539 Ga0495606_0055539_1660_2418 252
492 3300046507 Ga0495606_0164605 Ga0495606_0164605_92_850 252
493 3300046512 Ga0495610_0004292 Ga0495610_0004292_6327_7085 252
494 3300046512 Ga0495610_0029448 Ga0495610_0029448_337_1095 252
495 3300046512 Ga0495610_0063913 Ga0495610_0063913_391_1149 252
496 3300046512 Ga0495610_0096222 Ga0495610_0096222_468_1226 252
497 3300046512 Ga0495610_0179222 Ga0495610_0179222_49_807 252
498 3300046513 Ga0495616_0001186 Ga0495616_0001186_13641_14399 252
499 3300046513 Ga0495616_0002308 Ga0495616_0002308_2818_3582 252
500 3300046513 Ga0495616_0003473 Ga0495616_0003473_5807_6565 252
501 3300046513 Ga0495616_0008345 Ga0495616_0008345_2554_3312 252
502 3300046513 Ga0495616_0039813 Ga0495616_0039813_1621_2379 252
503 3300046513 Ga0495616_0090709 Ga0495616_0090709_610_1368 252
504 3300046513 Ga0495616_0120119 Ga0495616_0120119_389_1147 252
505 3300046515 Ga0495620_0004015 Ga0495620_0004015_3082_3840 252
506 3300046515 Ga0495620_0004328 Ga0495620_0004328_4459_5217 252
507 3300046518 Ga0495631_0000149 Ga0495631_0000149_26194_26952 252
508 3300046518 Ga0495631_0004457 Ga0495631_0004457_2083_2841 252
509 3300046519 Ga0495632_0007412 Ga0495632_0007412_3580_4338 252
510 3300046519 Ga0495632_0011888 Ga0495632_0011888_1144_1902 252
511 3300046519 Ga0495632_0012162 Ga0495632_0012162_3129_3887 252
512 3300046519 Ga0495632_0022705 Ga0495632_0022705_1033_1791 252
513 3300046519 Ga0495632_0050218 Ga0495632_0050218_353_1111 252
514 3300046519 Ga0495632_0079396 Ga0495632_0079396_620_1378 252
515 3300046520 Ga0495637_0000654 Ga0495637_0000654_9778_10536 252
516 3300046520 Ga0495637_0002618 Ga0495637_0002618_6137_6895 252
517 3300046520 Ga0495637_0004911 Ga0495637_0004911_1219_1977 252
518 3300046520 Ga0495637_0008264 Ga0495637_0008264_155_913 252
519 3300046520 Ga0495637_0013219 Ga0495637_0013219_1916_2674 252
520 3300046520 Ga0495637_0015416 Ga0495637_0015416_2544_3302 252
521 3300046520 Ga0495637_0060704 Ga0495637_0060704_219_977 252
522 3300046522 Ga0495643_0021755 Ga0495643_0021755_255_1013 252
523 3300046522 Ga0495643_0062145 Ga0495643_0062145_847_1605 252
524 3300046522 Ga0495643_0093804 Ga0495643_0093804_399_1157 252
525 3300046523 Ga0495644_0001358 Ga0495644_0001358_3396_4154 252
526 3300046523 Ga0495644_0003157 Ga0495644_0003157_2609_3367 252
527 3300046523 Ga0495644_0038194 Ga0495644_0038194_722_1480 252
528 3300046523 Ga0495644_0047768 Ga0495644_0047768_289_1047 252
529 3300046524 Ga0495648_0000984 Ga0495648_0000984_25044_25805 252
530 3300046524 Ga0495648_0007492 Ga0495648_0007492_6146_6904 252
531 3300046524 Ga0495648_0078613 Ga0495648_0078613_785_1543 252
532 3300046524 Ga0495648_0110442 Ga0495648_0110442_361_1119 252
533 3300046526 Ga0495666_0026223 Ga0495666_0026223_1046_1804 252
534 3300046528 Ga0495642_0000055 Ga0495642_0000055_29515_30273 252
535 3300046530 Ga0495654_0003492 Ga0495654_0003492_3445_4203 252
536 3300046530 Ga0495654_0004181 Ga0495654_0004181_4072_4830 252
537 3300046530 Ga0495654_0006522 Ga0495654_0006522_3929_4687 252
538 3300046530 Ga0495654_0009983 Ga0495654_0009983_4333_5091 252
539 3300046530 Ga0495654_0020496 Ga0495654_0020496_342_1100 252
540 3300046530 Ga0495654_0022941 Ga0495654_0022941_419_1177 252
541 3300046530 Ga0495654_0025678 Ga0495654_0025678_582_1346 252
542 3300046530 Ga0495654_0068458 Ga0495654_0068458_224_982 252
543 3300046538 Ga0495609_0048076 Ga0495609_0048076_521_1279 252
544 3300046542 Ga0495597_0009364 Ga0495597_0009364_445_1203 252
545 3300046542 Ga0495597_0012216 Ga0495597_0012216_3081_3839 252
546 3300046542 Ga0495597_0026335 Ga0495597_0026335_1075_1833 252
547 3300046542 Ga0495597_0034991 Ga0495597_0034991_1194_1952 252
548 3300046542 Ga0495597_0049648 Ga0495597_0049648_423_1181 252
549 3300046542 Ga0495597_0055808 Ga0495597_0055808_655_1413 252
550 3300046542 Ga0495597_0082881 Ga0495597_0082881_396_1154 252
551 3300046542 Ga0495597_0086881 Ga0495597_0086881_75_839 252
552 3300046557 Ga0495622_0006158 Ga0495622_0006158_2900_3658 252
553 3300046557 Ga0495622_0072924 Ga0495622_0072924_44_802 252
554 3300046558 Ga0495633_0001003 Ga0495633_0001003_3785_4543 252
555 3300046558 Ga0495633_0068535 Ga0495633_0068535_839_1597 252
556 3300046616 Ga0495668_0000940 Ga0495668_0000940_28126_28884 252
557 3300046616 Ga0495668_0137751 Ga0495668_0137751_235_993 252
558 3300046648 Ga0495611_0005561 Ga0495611_0005561_313_1071 252
559 3300046648 Ga0495611_0009723 Ga0495611_0009723_576_1334 252
560 3300046660 Ga0495625_0010148 Ga0495625_0010148_516_1274 252
561 3300046660 Ga0495625_0011342 Ga0495625_0011342_3179_3937 252
562 3300046660 Ga0495625_0206211 Ga0495625_0206211_22_780 252
563 3300046664 Ga0495659_0000120 Ga0495659_0000120_9363_10121 252
564 3300046664 Ga0495659_0045731 Ga0495659_0045731_404_1162 252
565 3300046665 Ga0495661_0008979 Ga0495661_0008979_288_1046 252
566 3300046665 Ga0495661_0203703 Ga0495661_0203703_214_972 252
567 3300046674 Ga0495588_0031377 Ga0495588_0031377_339_1097 252
568 3300046684 Ga0495669_0007606 Ga0495669_0007606_3455_4213 252
569 3300046691 Ga0495670_0001827 Ga0495670_0001827_5419_6177 252
570 3300046691 Ga0495670_0045772 Ga0495670_0045772_910_1668 252
571 3300046691 Ga0495670_0097679 Ga0495670_0097679_455_1213 252
572 3300046691 Ga0495670_0120305 Ga0495670_0120305_556_1314 252
573 3300046692 Ga0495671_0031111 Ga0495671_0031111_1712_2470 252
574 3300046692 Ga0495671_0032779 Ga0495671_0032779_26_784 252
575 3300046692 Ga0495671_0064917 Ga0495671_0064917_345_1103 252
576 3300046692 Ga0495671_0092210 Ga0495671_0092210_366_1124 252
577 3300046692 Ga0495671_0096145 Ga0495671_0096145_563_1321 252
578 3300046694 Ga0495649_0004821 Ga0495649_0004821_4169_4927 252
579 3300046694 Ga0495649_0004928 Ga0495649_0004928_5542_6300 252
580 3300046694 Ga0495649_0013691 Ga0495649_0013691_3605_4363 252
581 3300046694 Ga0495649_0021277 Ga0495649_0021277_332_1090 252
582 3300046694 Ga0495649_0021899 Ga0495649_0021899_1708_2466 252
583 3300046694 Ga0495649_0030263 Ga0495649_0030263_243_1001 252
584 3300046794 Ga0495589_0006048 Ga0495589_0006048_1279_2037 252
585 3300046794 Ga0495589_0011262 Ga0495589_0011262_3207_3965 252
586 3300046794 Ga0495589_0012023 Ga0495589_0012023_3267_4025 252
587 3300046794 Ga0495589_0012890 Ga0495589_0012890_433_1191 252
588 3300046794 Ga0495589_0016049 Ga0495589_0016049_2916_3674 252
589 3300046794 Ga0495589_0079168 Ga0495589_0079168_533_1291 252
590 3300046810 Ga0495660_0017007 Ga0495660_0017007_452_1210 252
591 3300046810 Ga0495660_0069209 Ga0495660_0069209_357_1115 252
592 3300046810 Ga0495660_0096017 Ga0495660_0096017_397_1155 252
593 3300046810 Ga0495660_0108713 Ga0495660_0108713_639_1397 252
594 3300046810 Ga0495660_0113841 Ga0495660_0113841_175_933 252
595 3300046810 Ga0495660_0128236 Ga0495660_0128236_110_868 252
596 3300047315 Ga0495581_0129163 Ga0495581_0129163_43_801 252
597 3300047318 Ga0495636_0002568 Ga0495636_0002568_1905_2663 252
598 3300047320 Ga0495672_0002750 Ga0495672_0002750_1896_2654 252
599 3300047320 Ga0495672_0003070 Ga0495672_0003070_5894_6652 252
600 3300047320 Ga0495672_0003397 Ga0495672_0003397_6204_6962 252
601 3300047320 Ga0495672_0003663 Ga0495672_0003663_2869_3627 252
602 3300047320 Ga0495672_0005137 Ga0495672_0005137_5745_6503 252
603 3300047320 Ga0495672_0011290 Ga0495672_0011290_5261_6100 252
604 3300047320 Ga0495672_0013225 Ga0495672_0013225_3220_3978 252
605 3300047320 Ga0495672_0111857 Ga0495672_0111857_607_1365 252
606 3300047323 Ga0495683_0000217 Ga0495683_0000217_17746_18504 252
607 3300047323 Ga0495683_0004447 Ga0495683_0004447_4823_5581 252
608 3300047323 Ga0495683_0039798 Ga0495683_0039798_396_1154 252
609 3300047323 Ga0495683_0051085 Ga0495683_0051085_625_1383 252
610 3300047323 Ga0495683_0052111 Ga0495683_0052111_1254_2012 252
611 3300047323 Ga0495683_0058175 Ga0495683_0058175_956_1714 252
612 3300047323 Ga0495683_0192837 Ga0495683_0192837_27_785 252
613 3300047445 Ga0495677_0116804 Ga0495677_0116804_30_788 252
614 3300047447 Ga0495685_021090 Ga0495685_021090_73_831 252
615 3300047469 Ga0495673_0001075 Ga0495673_0001075_13373_14131 252
616 3300047469 Ga0495673_0004319 Ga0495673_0004319_1783_2541 252
617 3300047469 Ga0495673_0005695 Ga0495673_0005695_3293_4051 252
618 3300047469 Ga0495673_0006017 Ga0495673_0006017_5858_6616 252
619 3300047469 Ga0495673_0015503 Ga0495673_0015503_40_798 252
620 3300047469 Ga0495673_0071114 Ga0495673_0071114_484_1242 252
621 3300047470 Ga0495681_0000937 Ga0495681_0000937_6087_6845 252
622 3300047470 Ga0495681_0003361 Ga0495681_0003361_6895_7659 252
623 3300047470 Ga0495681_0004841 Ga0495681_0004841_5950_6708 252
624 3300047470 Ga0495681_0008258 Ga0495681_0008258_4678_5436 252
625 3300047470 Ga0495681_0008798 Ga0495681_0008798_5392_6150 252
626 3300047470 Ga0495681_0011225 Ga0495681_0011225_3752_4510 252
627 3300047470 Ga0495681_0027620 Ga0495681_0027620_295_1053 252
628 3300047470 Ga0495681_0044062 Ga0495681_0044062_557_1315 252
629 3300047470 Ga0495681_0172592 Ga0495681_0172592_100_858 252
630 3300047472 Ga0495686_0007931 Ga0495686_0007931_4621_5379 252
631 3300047472 Ga0495686_0140007 Ga0495686_0140007_377_1135 252
632 3300048089 Ga0495614_0129021 Ga0495614_0129021_49_807 252
633 3300048091 Ga0495626_0001853 Ga0495626_0001853_10245_11003 252
634 3300048091 Ga0495626_0002202 Ga0495626_0002202_3891_4649 252
635 3300048910 Ga0496107_0171508 Ga0496107_0171508_353_1111 252
636 3300048913 Ga0496110_0170723 Ga0496110_0170723_770_1528 252
637 3300048915 Ga0496112_0166220 Ga0496112_0166220_988_1746 252
638 3300048921 Ga0496118_0019898 Ga0496118_0019898_3514_4272 252
639 3300048924 Ga0496121_0014310 Ga0496121_0014310_5123_5881 252
640 3300048924 Ga0496121_0084132 Ga0496121_0084132_693_1451 252
641 3300048925 Ga0496122_0009989 Ga0496122_0009989_4008_4766 252
642 3300048926 Ga0496123_0136342 Ga0496123_0136342_25_783 252
643 3300048927 Ga0496124_0008970 Ga0496124_0008970_3554_4312 252
644 3300048927 Ga0496124_0048578 Ga0496124_0048578_713_1471 252
645 3300048927 Ga0496124_0094334 Ga0496124_0094334_1030_1788 252
646 3300048928 Ga0496125_0021049 Ga0496125_0021049_719_1477 252
647 3300048928 Ga0496125_0133247 Ga0496125_0133247_660_1418 252
648 3300049459 Ga0495678_002671 Ga0495678_002671_382_1140 252
649 3300049459 Ga0495678_020457 Ga0495678_020457_425_1183 252
650 3300049459 Ga0495678_025421 Ga0495678_025421_125_883 252
651 3300049459 Ga0495678_030569 Ga0495678_030569_1023_1781 252
652 3300049459 Ga0495678_096519 Ga0495678_096519_180_938 252
653 3300049460 Ga0495682_0003144 Ga0495682_0003144_270_1034 252
654 3300049460 Ga0495682_0028956 Ga0495682_0028956_16_774 252
655 3300049460 Ga0495682_0102520 Ga0495682_0102520_130_888 252
656 3300050489 nmdc:mga03683_40049_c2 nmdc:mga03683_40049_c2_325_1083 252
657 3300050489 nmdc:mga03683_8835_c1 nmdc:mga03683_8835_c1_2576_3334 252
658 3300050491 nmdc:mga00v17_25258_c2 nmdc:mga00v17_25258_c2_971_1729 252
659 3300050491 nmdc:mga00v17_327776_c1 nmdc:mga00v17_327776_c1_64_822 252
660 3300050491 nmdc:mga00v17_385593_c1 nmdc:mga00v17_385593_c1_69_827 252
661 iso_pu_bacteria 2806310737 2807409580 252
662 iso_pu_bacteria 2806310745 2807457882 252
663 iso_pu_bacteria 640427133 640488406 252
664 iso_pu_bacteria 8056115690 8056119889 252
665 iso_pu_bacteria 8056120720 8056122243 252
666 3300046526 Ga0495666_0073413 Ga0495666_0073413_565_1326 253
667 3300046809 Ga0495600_0110137 Ga0495600_0110137_139_900 253
668 3300047322 Ga0495680_0148474 Ga0495680_0148474_288_1049 253
669 2124908027 MRS2a_Contig_223 MRS2a_00125750 254
670 3300002737 JGI25162J39368_1000037 JGI25162J39368_1000037139 254
671 3300002771 JGI25163J39215_1000066 JGI25163J39215_100006632 254
672 3300002772 JGI25164J39214_1000020 JGI25164J39214_1000020139 254
673 3300003214 JGI25165J46597_1000077 JGI25165J46597_1000077139 254
674 3300003781 Ga0055536_1000360 Ga0055536_100036012 254
675 3300003791 Ga0055530_10002068 Ga0055530_100020687 254
676 3300003792 Ga0055540_1000278 Ga0055540_100027833 254
677 3300003794 Ga0055531_10000412 Ga0055531_1000041212 254
678 3300005288 Ga0065714_10000391 Ga0065714_100003912 254
679 3300005288 Ga0065714_10007024 Ga0065714_100070245 254
680 3300005288 Ga0065714_10068009 Ga0065714_100680091 254
681 3300005288 Ga0065714_10072754 Ga0065714_100727542 254
682 3300005289 Ga0065704_10095815 Ga0065704_100958152 254
683 3300005290 Ga0065712_10002466 Ga0065712_100024666 254
684 3300005293 Ga0065715_10002811 Ga0065715_100028114 254
685 3300005353 Ga0070669_100045051 Ga0070669_1000450514 254
686 3300005548 Ga0070665_100079480 Ga0070665_1000794803 254
687 3300006051 Ga0075364_10239458 Ga0075364_102394581 254
688 3300006058 Ga0075432_10029252 Ga0075432_100292522 254
689 3300006186 Ga0075369_10057680 Ga0075369_100576802 254
690 3300009011 Ga0105251_10038998 Ga0105251_100389982 254
691 3300009011 Ga0105251_10236447 Ga0105251_102364471 254
692 3300009036 Ga0105244_10003184 Ga0105244_100031847 254
693 3300009036 Ga0105244_10044085 Ga0105244_100440852 254
694 3300009036 Ga0105244_10057435 Ga0105244_100574352 254
695 3300009036 Ga0105244_10162129 Ga0105244_101621292 254
696 3300009092 Ga0105250_10001013 Ga0105250_100010138 254
697 3300009092 Ga0105250_10002353 Ga0105250_100023535 254
698 3300009092 Ga0105250_10071526 Ga0105250_100715262 254
699 3300009148 Ga0105243_10000162 Ga0105243_1000016213 254
700 3300009148 Ga0105243_10000313 Ga0105243_1000031332 254
701 3300009148 Ga0105243_10041924 Ga0105243_100419242 254
702 3300009176 Ga0105242_10324487 Ga0105242_103244872 254
703 3300011119 Ga0105246_10000155 Ga0105246_1000015533 254
704 3300011119 Ga0105246_10072397 Ga0105246_100723972 254
705 3300012498 Ga0157345_1000143 Ga0157345_10001436 254
706 3300013100 Ga0157373_10003502 Ga0157373_100035027 254
707 3300013100 Ga0157373_10011310 Ga0157373_100113105 254
708 3300013100 Ga0157373_10171413 Ga0157373_101714132 254
709 3300013100 Ga0157373_10214420 Ga0157373_102144202 254
710 3300013102 Ga0157371_10000827 Ga0157371_1000082713 254
711 3300013102 Ga0157371_10001450 Ga0157371_1000145011 254
712 3300013104 Ga0157370_10509361 Ga0157370_105093611 254
713 3300013104 Ga0157370_10509363 Ga0157370_105093631 254
714 3300013104 Ga0157370_10560701 Ga0157370_105607012 254
715 3300013104 Ga0157370_10584349 Ga0157370_105843491 254
716 3300013104 Ga0157370_10760348 Ga0157370_107603481 254
717 3300013105 Ga0157369_10007063 Ga0157369_100070636 254
718 3300013306 Ga0163162_10001228 Ga0163162_1000122817 254
719 3300013307 Ga0157372_10004887 Ga0157372_100048878 254
720 3300013308 Ga0157375_10171863 Ga0157375_101718631 254
721 3300013308 Ga0157375_10629976 Ga0157375_106299761 254
722 3300014497 Ga0182008_10001796 Ga0182008_1000179611 254
723 3300014497 Ga0182008_10002331 Ga0182008_100023317 254
724 3300014497 Ga0182008_10016925 Ga0182008_100169253 254
725 3300015261 Ga0182006_1001588 Ga0182006_10015885 254
726 3300015261 Ga0182006_1003027 Ga0182006_10030275 254
727 3300015261 Ga0182006_1037126 Ga0182006_10371262 254
728 3300015265 Ga0182005_1000848 Ga0182005_100084813 254
729 3300015265 Ga0182005_1010493 Ga0182005_10104934 254
730 3300017792 Ga0163161_10001988 Ga0163161_100019886 254
731 3300017792 Ga0163161_10013134 Ga0163161_100131344 254
732 3300017792 Ga0163161_10181352 Ga0163161_101813521 254
733 3300017792 Ga0163161_10550864 Ga0163161_105508641 254
734 3300025207 Ga0209760_100262 Ga0209760_10026218 254
735 3300025231 Ga0207427_100001 Ga0207427_100001817 254
736 3300025233 Ga0209437_100003 Ga0209437_100003555 254
737 3300025261 Ga0209233_1000007 Ga0209233_1000007817 254
738 3300025292 Ga0209676_1000016 Ga0209676_1000016423 254
739 3300025292 Ga0209676_1001520 Ga0209676_100152018 254
740 3300025298 Ga0209050_1000036 Ga0209050_1000036135 254
741 3300025298 Ga0209050_1001096 Ga0209050_100109618 254
742 3300025303 Ga0209051_1000043 Ga0209051_1000043207 254
743 3300025304 Ga0209257_1000098 Ga0209257_1000098106 254
744 3300025711 Ga0207696_1000101 Ga0207696_1000101153 254
745 3300025711 Ga0207696_1001999 Ga0207696_10019998 254
746 3300025711 Ga0207696_1003232 Ga0207696_10032324 254
747 3300025711 Ga0207696_1012410 Ga0207696_10124102 254
748 3300025711 Ga0207696_1037105 Ga0207696_10371052 254
749 3300025728 Ga0207655_1000297 Ga0207655_100029724 254
750 3300025728 Ga0207655_1005351 Ga0207655_10053515 254
751 3300025728 Ga0207655_1005951 Ga0207655_10059514 254
752 3300025728 Ga0207655_1010618 Ga0207655_10106185 254
753 3300025728 Ga0207655_1061410 Ga0207655_10614102 254
754 3300025735 Ga0207713_1000904 Ga0207713_100090412 254
755 3300025735 Ga0207713_1002172 Ga0207713_10021727 254
756 3300025735 Ga0207713_1011373 Ga0207713_10113734 254
757 3300025735 Ga0207713_1103822 Ga0207713_11038221 254
758 3300025735 Ga0207713_1116754 Ga0207713_11167541 254
759 3300025923 Ga0207681_10010392 Ga0207681_100103926 254
760 3300025933 Ga0207706_10043140 Ga0207706_100431402 254
761 3300025934 Ga0207686_10196515 Ga0207686_101965152 254
762 3300025935 Ga0207709_10000053 Ga0207709_1000005313 254
763 3300025935 Ga0207709_10000502 Ga0207709_1000050217 254
764 3300025935 Ga0207709_10097183 Ga0207709_100971831 254
765 3300027907 Ga0207428_10027476 Ga0207428_100274766 254
766 3300027907 Ga0207428_10068562 Ga0207428_100685622 254
767 3300027907 Ga0207428_10104097 Ga0207428_101040972 254
768 3300027907 Ga0207428_10204616 Ga0207428_102046162 254
769 3300027907 Ga0207428_10231218 Ga0207428_102312182 254
770 3300028379 Ga0268266_10040819 Ga0268266_100408195 254
771 3300031456 Ga0307513_10403434 Ga0307513_104034341 254
772 3300031548 Ga0307408_100003620 Ga0307408_1000036207 254
773 3300031548 Ga0307408_100057172 Ga0307408_1000571723 254
774 3300031731 Ga0307405_10210348 Ga0307405_102103482 254
775 3300031901 Ga0307406_10459735 Ga0307406_104597351 254
776 3300031911 Ga0307412_10133427 Ga0307412_101334271 254
777 3300033180 Ga0307510_10001493 Ga0307510_1000149316 254
778 3300038705 Ga0237819_02368 Ga0237819_02368_1454_2218 254
779 3300041405 Ga0439438_000923 Ga0439438_000923_9211_9975 254
780 3300041405 Ga0439438_008140 Ga0439438_008140_2680_3444 254
781 3300041405 Ga0439438_028734 Ga0439438_028734_665_1429 254
782 3300041405 Ga0439438_062666 Ga0439438_062666_110_916 254
783 3300041407 Ga0439447_000230 Ga0439447_000230_3350_4114 254
784 3300041407 Ga0439447_000659 Ga0439447_000659_6801_7607 254
785 3300041407 Ga0439447_003511 Ga0439447_003511_2264_3049 254
786 3300041411 Ga0439466_0001972 Ga0439466_0001972_1364_2170 254
787 3300041411 Ga0439466_0002200 Ga0439466_0002200_4059_4823 254
788 3300041411 Ga0439466_0010147 Ga0439466_0010147_1772_2536 254
789 3300041411 Ga0439466_0013494 Ga0439466_0013494_213_977 254
790 3300041411 Ga0439466_0027146 Ga0439466_0027146_1027_1791 254
791 3300041411 Ga0439466_0041445 Ga0439466_0041445_525_1310 254
792 3300041411 Ga0439466_0077459 Ga0439466_0077459_25_789 254
793 3300041413 Ga0439465_0041559 Ga0439465_0041559_29_835 254
794 3300042006 Ga0439432_001349 Ga0439432_001349_1249_2034 254
795 3300042006 Ga0439432_003835 Ga0439432_003835_971_1735 254
796 3300042006 Ga0439432_011027 Ga0439432_011027_1594_2400 254
797 3300042009 Ga0439451_005311 Ga0439451_005311_1621_2406 254
798 3300042009 Ga0439451_008671 Ga0439451_008671_955_1719 254
799 3300042009 Ga0439451_013430 Ga0439451_013430_536_1300 254
800 3300042010 Ga0439452_002118 Ga0439452_002118_3017_3823 254
801 3300042010 Ga0439452_003047 Ga0439452_003047_4591_5355 254
802 3300042010 Ga0439452_004970 Ga0439452_004970_1188_1952 254
803 3300042010 Ga0439452_019291 Ga0439452_019291_768_1553 254
804 3300042013 Ga0439456_000775 Ga0439456_000775_4604_5410 254
805 3300042013 Ga0439456_000846 Ga0439456_000846_2960_3724 254
806 3300042013 Ga0439456_005592 Ga0439456_005592_403_1167 254
807 3300042013 Ga0439456_005965 Ga0439456_005965_222_1007 254
808 3300042013 Ga0439456_015698 Ga0439456_015698_265_1071 254
809 3300042016 Ga0439463_036482 Ga0439463_036482_202_966 254
810 3300042016 Ga0439463_051263 Ga0439463_051263_25_831 254
811 3300042115 Ga0450911_000586 Ga0450911_000586_7214_7978 254
812 3300042115 Ga0450911_000664 Ga0450911_000664_4427_5212 254
813 3300042121 Ga0450919_000346 Ga0450919_000346_95_880 254
814 3300042136 Ga0450900_005041 Ga0450900_005041_632_1396 254
815 3300042137 Ga0450902_004186 Ga0450902_004186_1178_1942 254
816 3300042138 Ga0450903_000824 Ga0450903_000824_521_1285 254
817 3300042138 Ga0450903_006308 Ga0450903_006308_318_1124 254
818 3300042138 Ga0450903_007925 Ga0450903_007925_868_1632 254
819 3300042138 Ga0450903_013665 Ga0450903_013665_424_1188 254
820 3300042138 Ga0450903_013722 Ga0450903_013722_260_1045 254
821 3300042139 Ga0450904_001251 Ga0450904_001251_98_862 254
822 3300042139 Ga0450904_005264 Ga0450904_005264_216_980 254
823 3300042142 Ga0450905_001391 Ga0450905_001391_40_804 254
824 3300042144 Ga0450889_004455 Ga0450889_004455_123_887 254
825 3300042145 Ga0450906_000113 Ga0450906_000113_10707_11492 254
826 3300042146 Ga0450907_000056 Ga0450907_000056_26192_26998 254
827 3300042147 Ga0450910_000399 Ga0450910_000399_4211_4996 254
828 3300042156 Ga0439446_0001140 Ga0439446_0001140_222_1007 254
829 3300042156 Ga0439446_0012538 Ga0439446_0012538_362_1168 254
830 3300042184 Ga0450908_003710 Ga0450908_003710_485_1270 254
831 3300042185 Ga0450909_000047 Ga0450909_000047_3074_3880 254
832 3300042435 Ga0439434_0000537 Ga0439434_0000537_6585_7391 254
833 3300042461 Ga0439460_0000372 Ga0439460_0000372_4356_5120 254
834 3300042461 Ga0439460_0004869 Ga0439460_0004869_704_1489 254
835 3300042531 Ga0450918_000958 Ga0450918_000958_4956_5741 254
836 3300042531 Ga0450918_014198 Ga0450918_014198_524_1288 254
837 3300042532 Ga0450893_0015023 Ga0450893_0015023_430_1194 254
838 3300042993 Ga0439440_0005849 Ga0439440_0005849_298_1083 254
839 3300046452 Ga0495617_003653 Ga0495617_003653_2640_3404 254
840 3300046452 Ga0495617_005747 Ga0495617_005747_149_913 254
841 3300046452 Ga0495617_017954 Ga0495617_017954_1315_2079 254
842 3300046452 Ga0495617_023738 Ga0495617_023738_1158_1922 254
843 3300046452 Ga0495617_026823 Ga0495617_026823_351_1115 254
844 3300046452 Ga0495617_036515 Ga0495617_036515_686_1450 254
845 3300046452 Ga0495617_038258 Ga0495617_038258_500_1264 254
846 3300046452 Ga0495617_042212 Ga0495617_042212_212_976 254
847 3300046452 Ga0495617_071359 Ga0495617_071359_78_842 254
848 3300046453 Ga0495627_000294 Ga0495627_000294_39065_39829 254
849 3300046453 Ga0495627_001723 Ga0495627_001723_7564_8328 254
850 3300046453 Ga0495627_005477 Ga0495627_005477_201_965 254
851 3300046453 Ga0495627_006142 Ga0495627_006142_2441_3205 254
852 3300046453 Ga0495627_060684 Ga0495627_060684_250_1014 254
853 3300046454 Ga0495592_0060890 Ga0495592_0060890_1758_2522 254
854 3300046455 Ga0495603_0003336 Ga0495603_0003336_1132_1896 254
855 3300046455 Ga0495603_0244441 Ga0495603_0244441_148_912 254
856 3300046457 Ga0495590_0017134 Ga0495590_0017134_1409_2173 254
857 3300046457 Ga0495590_0041646 Ga0495590_0041646_492_1256 254
858 3300046457 Ga0495590_0079395 Ga0495590_0079395_81_845 254
859 3300046458 Ga0495591_001542 Ga0495591_001542_3843_4607 254
860 3300046458 Ga0495591_001583 Ga0495591_001583_3607_4371 254
861 3300046458 Ga0495591_006348 Ga0495591_006348_238_1002 254
862 3300046458 Ga0495591_006851 Ga0495591_006851_1969_2733 254
863 3300046458 Ga0495591_007655 Ga0495591_007655_3595_4359 254
864 3300046458 Ga0495591_007918 Ga0495591_007918_1420_2184 254
865 3300046458 Ga0495591_010118 Ga0495591_010118_2090_2854 254
866 3300046458 Ga0495591_026557 Ga0495591_026557_921_1685 254
867 3300046458 Ga0495591_030902 Ga0495591_030902_515_1279 254
868 3300046459 Ga0495629_0012607 Ga0495629_0012607_4398_5162 254
869 3300046459 Ga0495629_0332204 Ga0495629_0332204_134_898 254
870 3300046460 Ga0495638_0004020 Ga0495638_0004020_7198_7962 254
871 3300046460 Ga0495638_0007343 Ga0495638_0007343_2075_2839 254
872 3300046460 Ga0495638_0011461 Ga0495638_0011461_1035_1799 254
873 3300046460 Ga0495638_0015252 Ga0495638_0015252_4011_4775 254
874 3300046460 Ga0495638_0017011 Ga0495638_0017011_3885_4649 254
875 3300046460 Ga0495638_0055246 Ga0495638_0055246_278_1042 254
876 3300046460 Ga0495638_0073616 Ga0495638_0073616_907_1671 254
877 3300046460 Ga0495638_0110623 Ga0495638_0110623_399_1163 254
878 3300046460 Ga0495638_0143657 Ga0495638_0143657_533_1297 254
879 3300046460 Ga0495638_0200332 Ga0495638_0200332_253_1017 254
880 3300046460 Ga0495638_0230559 Ga0495638_0230559_235_999 254
881 3300046463 Ga0495653_0002572 Ga0495653_0002572_9251_10015 254
882 3300046463 Ga0495653_0238110 Ga0495653_0238110_380_1144 254
883 3300046463 Ga0495653_0280910 Ga0495653_0280910_156_920 254
884 3300046471 Ga0495650_0010175 Ga0495650_0010175_279_1043 254
885 3300046471 Ga0495650_0013627 Ga0495650_0013627_2021_2785 254
886 3300046471 Ga0495650_0034465 Ga0495650_0034465_283_1047 254
887 3300046471 Ga0495650_0039985 Ga0495650_0039985_284_1048 254
888 3300046473 Ga0495582_0004652 Ga0495582_0004652_4692_5456 254
889 3300046474 Ga0495605_0000943 Ga0495605_0000943_11504_12289 254
890 3300046474 Ga0495605_0001812 Ga0495605_0001812_3439_4203 254
891 3300046474 Ga0495605_0003981 Ga0495605_0003981_4777_5541 254
892 3300046474 Ga0495605_0052566 Ga0495605_0052566_1154_1918 254
893 3300046474 Ga0495605_0186109 Ga0495605_0186109_106_870 254
894 3300046491 Ga0495584_0000894 Ga0495584_0000894_6103_6888 254
895 3300046491 Ga0495584_0003081 Ga0495584_0003081_5031_5795 254
896 3300046491 Ga0495584_0003555 Ga0495584_0003555_1558_2343 254
897 3300046491 Ga0495584_0003597 Ga0495584_0003597_4130_4894 254
898 3300046491 Ga0495584_0021233 Ga0495584_0021233_1867_2631 254
899 3300046491 Ga0495584_0040578 Ga0495584_0040578_1566_2330 254
900 3300046491 Ga0495584_0040772 Ga0495584_0040772_212_976 254
901 3300046491 Ga0495584_0090136 Ga0495584_0090136_345_1109 254
902 3300046492 Ga0495585_0014588 Ga0495585_0014588_2236_3000 254
903 3300046492 Ga0495585_0044742 Ga0495585_0044742_1321_2085 254
904 3300046492 Ga0495585_0071210 Ga0495585_0071210_366_1130 254
905 3300046492 Ga0495585_0106044 Ga0495585_0106044_525_1289 254
906 3300046492 Ga0495585_0109858 Ga0495585_0109858_541_1305 254
907 3300046492 Ga0495585_0260633 Ga0495585_0260633_60_824 254
908 3300046499 Ga0495594_0288682 Ga0495594_0288682_63_827 254
909 3300046500 Ga0495596_0028721 Ga0495596_0028721_139_903 254
910 3300046500 Ga0495596_0039133 Ga0495596_0039133_196_960 254
911 3300046500 Ga0495596_0088290 Ga0495596_0088290_331_1095 254
912 3300046501 Ga0495607_0004869 Ga0495607_0004869_1401_2165 254
913 3300046501 Ga0495607_0012839 Ga0495607_0012839_311_1075 254
914 3300046501 Ga0495607_0013818 Ga0495607_0013818_3511_4275 254
915 3300046501 Ga0495607_0042263 Ga0495607_0042263_77_841 254
916 3300046501 Ga0495607_0075425 Ga0495607_0075425_175_939 254
917 3300046501 Ga0495607_0116468 Ga0495607_0116468_317_1081 254
918 3300046501 Ga0495607_0138076 Ga0495607_0138076_365_1129 254
919 3300046501 Ga0495607_0146210 Ga0495607_0146210_320_1084 254
920 3300046501 Ga0495607_0165942 Ga0495607_0165942_277_1041 254
921 3300046506 Ga0495583_0000400 Ga0495583_0000400_7052_7816 254
922 3300046506 Ga0495583_0004374 Ga0495583_0004374_6592_7356 254
923 3300046506 Ga0495583_0005442 Ga0495583_0005442_3601_4365 254
924 3300046506 Ga0495583_0068389 Ga0495583_0068389_194_958 254
925 3300046507 Ga0495606_0001600 Ga0495606_0001600_3166_3930 254
926 3300046507 Ga0495606_0004330 Ga0495606_0004330_9244_10014 254
927 3300046507 Ga0495606_0004584 Ga0495606_0004584_4025_4789 254
928 3300046507 Ga0495606_0008054 Ga0495606_0008054_3269_4033 254
929 3300046507 Ga0495606_0035106 Ga0495606_0035106_807_1571 254
930 3300046507 Ga0495606_0037898 Ga0495606_0037898_1444_2208 254
931 3300046507 Ga0495606_0278958 Ga0495606_0278958_87_851 254
932 3300046512 Ga0495610_0001754 Ga0495610_0001754_9348_10118 254
933 3300046512 Ga0495610_0005652 Ga0495610_0005652_3524_4288 254
934 3300046512 Ga0495610_0007283 Ga0495610_0007283_4335_5099 254
935 3300046513 Ga0495616_0010604 Ga0495616_0010604_3003_3767 254
936 3300046513 Ga0495616_0012448 Ga0495616_0012448_149_913 254
937 3300046513 Ga0495616_0013424 Ga0495616_0013424_1617_2381 254
938 3300046513 Ga0495616_0018182 Ga0495616_0018182_2951_3715 254
939 3300046513 Ga0495616_0127498 Ga0495616_0127498_45_809 254
940 3300046513 Ga0495616_0160452 Ga0495616_0160452_103_867 254
941 3300046515 Ga0495620_0002293 Ga0495620_0002293_1076_1840 254
942 3300046515 Ga0495620_0003879 Ga0495620_0003879_5118_5882 254
943 3300046515 Ga0495620_0011024 Ga0495620_0011024_3370_4134 254
944 3300046515 Ga0495620_0014432 Ga0495620_0014432_918_1682 254
945 3300046515 Ga0495620_0039305 Ga0495620_0039305_1287_2051 254
946 3300046515 Ga0495620_0084344 Ga0495620_0084344_436_1200 254
947 3300046515 Ga0495620_0097047 Ga0495620_0097047_282_1046 254
948 3300046516 Ga0495628_0183653 Ga0495628_0183653_274_1038 254
949 3300046516 Ga0495628_0234101 Ga0495628_0234101_84_848 254
950 3300046517 Ga0495630_0156532 Ga0495630_0156532_451_1215 254
951 3300046517 Ga0495630_0178036 Ga0495630_0178036_730_1494 254
952 3300046518 Ga0495631_0002305 Ga0495631_0002305_6382_7146 254
953 3300046518 Ga0495631_0028759 Ga0495631_0028759_1443_2207 254
954 3300046518 Ga0495631_0088858 Ga0495631_0088858_212_976 254
955 3300046518 Ga0495631_0125928 Ga0495631_0125928_230_994 254
956 3300046518 Ga0495631_0140041 Ga0495631_0140041_15_779 254
957 3300046519 Ga0495632_0000996 Ga0495632_0000996_10862_11647 254
958 3300046519 Ga0495632_0002108 Ga0495632_0002108_3437_4201 254
959 3300046519 Ga0495632_0009160 Ga0495632_0009160_4582_5346 254
960 3300046519 Ga0495632_0037472 Ga0495632_0037472_396_1160 254
961 3300046519 Ga0495632_0087707 Ga0495632_0087707_148_912 254
962 3300046519 Ga0495632_0139424 Ga0495632_0139424_284_1048 254
963 3300046519 Ga0495632_0164037 Ga0495632_0164037_225_989 254
964 3300046520 Ga0495637_0002446 Ga0495637_0002446_3819_4583 254
965 3300046520 Ga0495637_0005285 Ga0495637_0005285_339_1103 254
966 3300046520 Ga0495637_0006863 Ga0495637_0006863_436_1200 254
967 3300046520 Ga0495637_0010206 Ga0495637_0010206_1756_2520 254
968 3300046520 Ga0495637_0010283 Ga0495637_0010283_1660_2424 254
969 3300046520 Ga0495637_0010616 Ga0495637_0010616_3426_4190 254
970 3300046520 Ga0495637_0015761 Ga0495637_0015761_2420_3184 254
971 3300046520 Ga0495637_0028141 Ga0495637_0028141_484_1248 254
972 3300046522 Ga0495643_0002834 Ga0495643_0002834_9421_10185 254
973 3300046522 Ga0495643_0005148 Ga0495643_0005148_4777_5541 254
974 3300046522 Ga0495643_0038725 Ga0495643_0038725_459_1223 254
975 3300046522 Ga0495643_0082212 Ga0495643_0082212_574_1338 254
976 3300046522 Ga0495643_0099545 Ga0495643_0099545_197_961 254
977 3300046522 Ga0495643_0100879 Ga0495643_0100879_406_1170 254
978 3300046522 Ga0495643_0144049 Ga0495643_0144049_114_878 254
979 3300046523 Ga0495644_0020678 Ga0495644_0020678_393_1157 254
980 3300046524 Ga0495648_0005805 Ga0495648_0005805_3332_4096 254
981 3300046524 Ga0495648_0008126 Ga0495648_0008126_2114_2878 254
982 3300046524 Ga0495648_0009616 Ga0495648_0009616_734_1498 254
983 3300046524 Ga0495648_0010259 Ga0495648_0010259_6003_6767 254
984 3300046524 Ga0495648_0011151 Ga0495648_0011151_2483_3247 254
985 3300046524 Ga0495648_0042581 Ga0495648_0042581_2050_2835 254
986 3300046524 Ga0495648_0045078 Ga0495648_0045078_1690_2454 254
987 3300046524 Ga0495648_0052797 Ga0495648_0052797_329_1093 254
988 3300046524 Ga0495648_0060129 Ga0495648_0060129_298_1062 254
989 3300046524 Ga0495648_0121499 Ga0495648_0121499_21_806 254
990 3300046524 Ga0495648_0227907 Ga0495648_0227907_94_858 254
991 3300046526 Ga0495666_0014896 Ga0495666_0014896_1325_2089 254
992 3300046528 Ga0495642_0000416 Ga0495642_0000416_4785_5549 254
993 3300046528 Ga0495642_0001808 Ga0495642_0001808_4853_5638 254
994 3300046530 Ga0495654_0000562 Ga0495654_0000562_25382_26146 254
995 3300046530 Ga0495654_0002377 Ga0495654_0002377_4727_5491 254
996 3300046530 Ga0495654_0006736 Ga0495654_0006736_360_1124 254
997 3300046530 Ga0495654_0009346 Ga0495654_0009346_334_1098 254
998 3300046530 Ga0495654_0055879 Ga0495654_0055879_590_1354 254
999 3300046530 Ga0495654_0078212 Ga0495654_0078212_160_924 254
1000 3300046530 Ga0495654_0081666 Ga0495654_0081666_402_1166 254
1001 3300046535 Ga0495586_0006486 Ga0495586_0006486_4165_4929 254
1002 3300046536 Ga0495587_0001172 Ga0495587_0001172_15784_16548 254
1003 3300046536 Ga0495587_0010938 Ga0495587_0010938_2661_3425 254
1004 3300046536 Ga0495587_0067757 Ga0495587_0067757_155_919 254
1005 3300046538 Ga0495609_0007889 Ga0495609_0007889_2090_2854 254
1006 3300046538 Ga0495609_0010937 Ga0495609_0010937_2026_2790 254
1007 3300046538 Ga0495609_0015306 Ga0495609_0015306_384_1148 254
1008 3300046538 Ga0495609_0019322 Ga0495609_0019322_493_1257 254
1009 3300046538 Ga0495609_0052823 Ga0495609_0052823_454_1218 254
1010 3300046538 Ga0495609_0090416 Ga0495609_0090416_149_913 254
1011 3300046538 Ga0495609_0092638 Ga0495609_0092638_194_958 254
1012 3300046538 Ga0495609_0100346 Ga0495609_0100346_190_954 254
1013 3300046538 Ga0495609_0102429 Ga0495609_0102429_77_841 254
1014 3300046538 Ga0495609_0136587 Ga0495609_0136587_88_852 254
1015 3300046542 Ga0495597_0003183 Ga0495597_0003183_3468_4232 254
1016 3300046542 Ga0495597_0020369 Ga0495597_0020369_1996_2781 254
1017 3300046542 Ga0495597_0040225 Ga0495597_0040225_1159_1923 254
1018 3300046542 Ga0495597_0061063 Ga0495597_0061063_783_1547 254
1019 3300046542 Ga0495597_0083555 Ga0495597_0083555_230_994 254
1020 3300046542 Ga0495597_0102379 Ga0495597_0102379_409_1173 254
1021 3300046542 Ga0495597_0133248 Ga0495597_0133248_86_850 254
1022 3300046543 Ga0495645_0045704 Ga0495645_0045704_1921_2685 254
1023 3300046543 Ga0495645_0062413 Ga0495645_0062413_725_1489 254
1024 3300046557 Ga0495622_0001087 Ga0495622_0001087_3774_4538 254
1025 3300046557 Ga0495622_0043356 Ga0495622_0043356_546_1310 254
1026 3300046557 Ga0495622_0095043 Ga0495622_0095043_117_881 254
1027 3300046557 Ga0495622_0103015 Ga0495622_0103015_460_1224 254
1028 3300046557 Ga0495622_0164578 Ga0495622_0164578_59_823 254
1029 3300046558 Ga0495633_0002568 Ga0495633_0002568_8524_9288 254
1030 3300046615 Ga0495656_0010317 Ga0495656_0010317_290_1054 254
1031 3300046615 Ga0495656_0015874 Ga0495656_0015874_839_1603 254
1032 3300046616 Ga0495668_0003395 Ga0495668_0003395_6996_7760 254
1033 3300046616 Ga0495668_0210937 Ga0495668_0210937_241_1005 254
1034 3300046642 Ga0495634_0003536 Ga0495634_0003536_6987_7751 254
1035 3300046642 Ga0495634_0010517 Ga0495634_0010517_5990_6754 254
1036 3300046648 Ga0495611_0000389 Ga0495611_0000389_9575_10339 254
1037 3300046648 Ga0495611_0023957 Ga0495611_0023957_1690_2454 254
1038 3300046648 Ga0495611_0024930 Ga0495611_0024930_212_976 254
1039 3300046648 Ga0495611_0035807 Ga0495611_0035807_272_1036 254
1040 3300046648 Ga0495611_0117537 Ga0495611_0117537_380_1144 254
1041 3300046660 Ga0495625_0023743 Ga0495625_0023743_3742_4506 254
1042 3300046660 Ga0495625_0025523 Ga0495625_0025523_90_854 254
1043 3300046660 Ga0495625_0026918 Ga0495625_0026918_341_1105 254
1044 3300046660 Ga0495625_0043260 Ga0495625_0043260_445_1209 254
1045 3300046660 Ga0495625_0067561 Ga0495625_0067561_1359_2123 254
1046 3300046660 Ga0495625_0079531 Ga0495625_0079531_1333_2097 254
1047 3300046660 Ga0495625_0104974 Ga0495625_0104974_839_1603 254
1048 3300046660 Ga0495625_0118073 Ga0495625_0118073_276_1040 254
1049 3300046660 Ga0495625_0176036 Ga0495625_0176036_627_1391 254
1050 3300046663 Ga0495635_0004967 Ga0495635_0004967_1707_2471 254
1051 3300046663 Ga0495635_0005882 Ga0495635_0005882_4285_5049 254
1052 3300046664 Ga0495659_0003177 Ga0495659_0003177_3231_3995 254
1053 3300046665 Ga0495661_0044729 Ga0495661_0044729_256_1020 254
1054 3300046665 Ga0495661_0047331 Ga0495661_0047331_1708_2472 254
1055 3300046665 Ga0495661_0059852 Ga0495661_0059852_1261_2025 254
1056 3300046665 Ga0495661_0150507 Ga0495661_0150507_312_1076 254
1057 3300046665 Ga0495661_0188618 Ga0495661_0188618_147_911 254
1058 3300046674 Ga0495588_0004571 Ga0495588_0004571_733_1497 254
1059 3300046674 Ga0495588_0185077 Ga0495588_0185077_132_896 254
1060 3300046679 Ga0495623_0058263 Ga0495623_0058263_1127_1891 254
1061 3300046680 Ga0495646_0004661 Ga0495646_0004661_2576_3340 254
1062 3300046680 Ga0495646_0018341 Ga0495646_0018341_3432_4196 254
1063 3300046680 Ga0495646_0031320 Ga0495646_0031320_1617_2381 254
1064 3300046689 Ga0495613_0020167 Ga0495613_0020167_716_1480 254
1065 3300046689 Ga0495613_0020800 Ga0495613_0020800_121_885 254
1066 3300046690 Ga0495624_0002320 Ga0495624_0002320_4428_5192 254
1067 3300046691 Ga0495670_0001008 Ga0495670_0001008_9534_10298 254
1068 3300046691 Ga0495670_0009675 Ga0495670_0009675_363_1127 254
1069 3300046691 Ga0495670_0099344 Ga0495670_0099344_676_1440 254
1070 3300046691 Ga0495670_0283351 Ga0495670_0283351_54_818 254
1071 3300046692 Ga0495671_0000415 Ga0495671_0000415_26653_27438 254
1072 3300046692 Ga0495671_0002908 Ga0495671_0002908_7498_8262 254
1073 3300046692 Ga0495671_0011835 Ga0495671_0011835_375_1139 254
1074 3300046692 Ga0495671_0032798 Ga0495671_0032798_1737_2501 254
1075 3300046694 Ga0495649_0001071 Ga0495649_0001071_14394_15179 254
1076 3300046694 Ga0495649_0002749 Ga0495649_0002749_2079_2843 254
1077 3300046694 Ga0495649_0003235 Ga0495649_0003235_6176_6940 254
1078 3300046694 Ga0495649_0012055 Ga0495649_0012055_664_1428 254
1079 3300046694 Ga0495649_0015332 Ga0495649_0015332_2091_2855 254
1080 3300046694 Ga0495649_0015879 Ga0495649_0015879_3303_4067 254
1081 3300046694 Ga0495649_0042553 Ga0495649_0042553_1484_2248 254
1082 3300046694 Ga0495649_0043272 Ga0495649_0043272_319_1083 254
1083 3300046694 Ga0495649_0065165 Ga0495649_0065165_958_1722 254
1084 3300046694 Ga0495649_0081201 Ga0495649_0081201_849_1613 254
1085 3300046694 Ga0495649_0159288 Ga0495649_0159288_183_947 254
1086 3300046794 Ga0495589_0001040 Ga0495589_0001040_9216_9980 254
1087 3300046794 Ga0495589_0001085 Ga0495589_0001085_14777_15562 254
1088 3300046794 Ga0495589_0025990 Ga0495589_0025990_1159_1923 254
1089 3300046794 Ga0495589_0108393 Ga0495589_0108393_307_1071 254
1090 3300046810 Ga0495660_0002844 Ga0495660_0002844_3970_4734 254
1091 3300046810 Ga0495660_0004613 Ga0495660_0004613_7188_7952 254
1092 3300046810 Ga0495660_0005773 Ga0495660_0005773_5579_6343 254
1093 3300046810 Ga0495660_0006869 Ga0495660_0006869_340_1104 254
1094 3300046810 Ga0495660_0037062 Ga0495660_0037062_394_1158 254
1095 3300046810 Ga0495660_0037656 Ga0495660_0037656_266_1030 254
1096 3300046810 Ga0495660_0059217 Ga0495660_0059217_1241_2005 254
1097 3300046810 Ga0495660_0069063 Ga0495660_0069063_397_1161 254
1098 3300046810 Ga0495660_0097387 Ga0495660_0097387_318_1082 254
1099 3300046810 Ga0495660_0107161 Ga0495660_0107161_578_1342 254
1100 3300046810 Ga0495660_0118322 Ga0495660_0118322_566_1330 254
1101 3300047315 Ga0495581_0051677 Ga0495581_0051677_26_790 254
1102 3300047317 Ga0495604_0003901 Ga0495604_0003901_10521_11285 254
1103 3300047317 Ga0495604_0008008 Ga0495604_0008008_2563_3327 254
1104 3300047317 Ga0495604_0058134 Ga0495604_0058134_921_1685 254
1105 3300047318 Ga0495636_0018810 Ga0495636_0018810_1942_2727 254
1106 3300047319 Ga0495674_0038248 Ga0495674_0038248_592_1356 254
1107 3300047320 Ga0495672_0004039 Ga0495672_0004039_7050_7814 254
1108 3300047320 Ga0495672_0011419 Ga0495672_0011419_5070_5834 254
1109 3300047320 Ga0495672_0016074 Ga0495672_0016074_4224_4988 254
1110 3300047320 Ga0495672_0064192 Ga0495672_0064192_743_1507 254
1111 3300047320 Ga0495672_0112084 Ga0495672_0112084_285_1049 254
1112 3300047320 Ga0495672_0115897 Ga0495672_0115897_504_1268 254
1113 3300047320 Ga0495672_0122837 Ga0495672_0122837_348_1112 254
1114 3300047321 Ga0495676_0005024 Ga0495676_0005024_8301_9065 254
1115 3300047321 Ga0495676_0027525 Ga0495676_0027525_1846_2610 254
1116 3300047322 Ga0495680_0006104 Ga0495680_0006104_6977_7741 254
1117 3300047322 Ga0495680_0007570 Ga0495680_0007570_5737_6501 254
1118 3300047322 Ga0495680_0044813 Ga0495680_0044813_657_1421 254
1119 3300047323 Ga0495683_0000464 Ga0495683_0000464_4145_4909 254
1120 3300047323 Ga0495683_0008973 Ga0495683_0008973_204_968 254
1121 3300047323 Ga0495683_0018735 Ga0495683_0018735_1787_2551 254
1122 3300047323 Ga0495683_0056707 Ga0495683_0056707_429_1193 254
1123 3300047323 Ga0495683_0138268 Ga0495683_0138268_231_995 254
1124 3300047323 Ga0495683_0179958 Ga0495683_0179958_160_924 254
1125 3300047443 Ga0495687_000808 Ga0495687_000808_4366_5130 254
1126 3300047443 Ga0495687_003204 Ga0495687_003204_4032_4817 254
1127 3300047443 Ga0495687_006913 Ga0495687_006913_2606_3370 254
1128 3300047444 Ga0495675_0000981 Ga0495675_0000981_4852_5616 254
1129 3300047444 Ga0495675_0161668 Ga0495675_0161668_29_793 254
1130 3300047444 Ga0495675_0166675 Ga0495675_0166675_131_895 254
1131 3300047445 Ga0495677_0003975 Ga0495677_0003975_422_1186 254
1132 3300047446 Ga0495679_001426 Ga0495679_001426_9324_10088 254
1133 3300047446 Ga0495679_002236 Ga0495679_002236_7564_8328 254
1134 3300047446 Ga0495679_005855 Ga0495679_005855_607_1371 254
1135 3300047446 Ga0495679_006205 Ga0495679_006205_4209_4973 254
1136 3300047446 Ga0495679_008371 Ga0495679_008371_82_846 254
1137 3300047446 Ga0495679_012925 Ga0495679_012925_1670_2434 254
1138 3300047447 Ga0495685_008168 Ga0495685_008168_1532_2296 254
1139 3300047469 Ga0495673_0002192 Ga0495673_0002192_9440_10204 254
1140 3300047469 Ga0495673_0003526 Ga0495673_0003526_3449_4213 254
1141 3300047469 Ga0495673_0005488 Ga0495673_0005488_1720_2484 254
1142 3300047469 Ga0495673_0005830 Ga0495673_0005830_2299_3063 254
1143 3300047469 Ga0495673_0007446 Ga0495673_0007446_2692_3456 254
1144 3300047469 Ga0495673_0017676 Ga0495673_0017676_2755_3519 254
1145 3300047469 Ga0495673_0044389 Ga0495673_0044389_144_908 254
1146 3300047469 Ga0495673_0047806 Ga0495673_0047806_153_917 254
1147 3300047469 Ga0495673_0049996 Ga0495673_0049996_284_1048 254
1148 3300047469 Ga0495673_0107374 Ga0495673_0107374_128_892 254
1149 3300047470 Ga0495681_0008523 Ga0495681_0008523_5432_6196 254
1150 3300047470 Ga0495681_0008572 Ga0495681_0008572_3662_4426 254
1151 3300047470 Ga0495681_0009250 Ga0495681_0009250_3760_4524 254
1152 3300047470 Ga0495681_0010160 Ga0495681_0010160_259_1023 254
1153 3300047470 Ga0495681_0015123 Ga0495681_0015123_1728_2492 254
1154 3300047470 Ga0495681_0097407 Ga0495681_0097407_418_1182 254
1155 3300047471 Ga0495684_0028188 Ga0495684_0028188_1559_2323 254
1156 3300047472 Ga0495686_0003379 Ga0495686_0003379_9532_10296 254
1157 3300047472 Ga0495686_0042420 Ga0495686_0042420_59_823 254
1158 3300047472 Ga0495686_0053891 Ga0495686_0053891_274_1038 254
1159 3300047673 Ga0495593_0003244 Ga0495593_0003244_2206_2970 254
1160 3300047673 Ga0495593_0057509 Ga0495593_0057509_1127_1891 254
1161 3300048088 Ga0495602_0008372 Ga0495602_0008372_2727_3491 254
1162 3300048089 Ga0495614_0077361 Ga0495614_0077361_470_1234 254
1163 3300048091 Ga0495626_0000172 Ga0495626_0000172_69317_70081 254
1164 3300048091 Ga0495626_0002695 Ga0495626_0002695_7299_8084 254
1165 3300048091 Ga0495626_0006356 Ga0495626_0006356_5526_6290 254
1166 3300048091 Ga0495626_0007749 Ga0495626_0007749_3622_4386 254
1167 3300048091 Ga0495626_0011599 Ga0495626_0011599_691_1455 254
1168 3300048091 Ga0495626_0011815 Ga0495626_0011815_3282_4067 254
1169 3300048091 Ga0495626_0035316 Ga0495626_0035316_1411_2175 254
1170 3300048091 Ga0495626_0040126 Ga0495626_0040126_827_1591 254
1171 3300048091 Ga0495626_0052893 Ga0495626_0052893_809_1573 254
1172 3300048091 Ga0495626_0068960 Ga0495626_0068960_551_1315 254
1173 3300048091 Ga0495626_0100721 Ga0495626_0100721_266_1030 254
1174 3300048905 Ga0496102_0000654 Ga0496102_0000654_9132_9896 254
1175 3300048905 Ga0496102_0392581 Ga0496102_0392581_277_1041 254
1176 3300048906 Ga0496103_0002886 Ga0496103_0002886_6579_7343 254
1177 3300048907 Ga0496104_0349663 Ga0496104_0349663_358_1122 254
1178 3300048909 Ga0496106_0241478 Ga0496106_0241478_52_816 254
1179 3300048914 Ga0496111_0128527 Ga0496111_0128527_874_1638 254
1180 3300048919 Ga0496116_0000085 Ga0496116_0000085_84897_85784 254
1181 3300048919 Ga0496116_0000936 Ga0496116_0000936_3605_4369 254
1182 3300048919 Ga0496116_0005600 Ga0496116_0005600_6443_7207 254
1183 3300048919 Ga0496116_0008001 Ga0496116_0008001_2527_3291 254
1184 3300048919 Ga0496116_0106783 Ga0496116_0106783_278_1042 254
1185 3300048920 Ga0496117_0000332 Ga0496117_0000332_23526_24413 254
1186 3300048920 Ga0496117_0009105 Ga0496117_0009105_6075_6839 254
1187 3300048920 Ga0496117_0019291 Ga0496117_0019291_4600_5364 254
1188 3300048920 Ga0496117_0098201 Ga0496117_0098201_159_923 254
1189 3300048920 Ga0496117_0124851 Ga0496117_0124851_549_1313 254
1190 3300048921 Ga0496118_0007664 Ga0496118_0007664_3613_4377 254
1191 3300048921 Ga0496118_0013821 Ga0496118_0013821_6173_6937 254
1192 3300048921 Ga0496118_0015541 Ga0496118_0015541_4106_4993 254
1193 3300048921 Ga0496118_0021559 Ga0496118_0021559_4382_5146 254
1194 3300048921 Ga0496118_0024485 Ga0496118_0024485_423_1187 254
1195 3300048922 Ga0496119_0064184 Ga0496119_0064184_117_881 254
1196 3300048923 Ga0496120_0033134 Ga0496120_0033134_1051_1815 254
1197 3300048924 Ga0496121_0000179 Ga0496121_0000179_81954_82841 254
1198 3300048924 Ga0496121_0009905 Ga0496121_0009905_3536_4300 254
1199 3300048925 Ga0496122_0011043 Ga0496122_0011043_4871_5758 254
1200 3300048925 Ga0496122_0051995 Ga0496122_0051995_1887_2651 254
1201 3300048926 Ga0496123_0004588 Ga0496123_0004588_3584_4471 254
1202 3300048926 Ga0496123_0018644 Ga0496123_0018644_286_1050 254
1203 3300048927 Ga0496124_0020565 Ga0496124_0020565_1733_2527 254
1204 3300048927 Ga0496124_0034086 Ga0496124_0034086_3599_4363 254
1205 3300048927 Ga0496124_0157213 Ga0496124_0157213_567_1331 254
1206 3300048927 Ga0496124_0250598 Ga0496124_0250598_143_907 254
1207 3300048927 Ga0496124_0275222 Ga0496124_0275222_215_979 254
1208 3300048928 Ga0496125_0023272 Ga0496125_0023272_505_1269 254
1209 3300049459 Ga0495678_002211 Ga0495678_002211_3492_4256 254
1210 3300049459 Ga0495678_002245 Ga0495678_002245_3874_4638 254
1211 3300049459 Ga0495678_004787 Ga0495678_004787_5556_6320 254
1212 3300049459 Ga0495678_009716 Ga0495678_009716_532_1317 254
1213 3300049459 Ga0495678_010990 Ga0495678_010990_1350_2114 254
1214 3300049459 Ga0495678_012004 Ga0495678_012004_2809_3573 254
1215 3300049459 Ga0495678_012309 Ga0495678_012309_2036_2800 254
1216 3300049459 Ga0495678_032688 Ga0495678_032688_44_808 254
1217 3300049459 Ga0495678_032789 Ga0495678_032789_956_1720 254
1218 3300049459 Ga0495678_066860 Ga0495678_066860_241_1005 254
1219 3300049459 Ga0495678_077512 Ga0495678_077512_350_1114 254
1220 3300049459 Ga0495678_100236 Ga0495678_100236_93_857 254
1221 3300049460 Ga0495682_0003548 Ga0495682_0003548_3879_4643 254
1222 3300049460 Ga0495682_0005657 Ga0495682_0005657_4182_4946 254
1223 3300049460 Ga0495682_0036648 Ga0495682_0036648_238_1002 254
1224 3300049460 Ga0495682_0059723 Ga0495682_0059723_306_1070 254
1225 3300049460 Ga0495682_0144445 Ga0495682_0144445_70_834 254
1226 3300049758 Ga0501241_003240 Ga0501241_003240_1851_2615 254
1227 3300050491 nmdc:mga00v17_138601_c1 nmdc:mga00v17_138601_c1_100_864 254
1228 3300050491 nmdc:mga00v17_169359_c1 nmdc:mga00v17_169359_c1_337_1101 254
1229 3300053111 Ga0500572_001081 Ga0500572_001081_3710_4474 254
1230 3300053126 Ga0500621_138299 Ga0500621_138299_77_841 254
1231 3300053145 Ga0500586_050880 Ga0500586_050880_521_1285 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

193

272

0.97

PF07883

Cupin_2

Cupin domain

30

97

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mkl-assembly2.cif.gz_B crystal structure of dna-binding transcriptional dual regulator from escherichia coli k-12 0.9005 146 246
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.8975 2 70
3rns-assembly1.cif.gz_A cupin 2 conserved barrel domain protein from leptotrichia buccalis 0.8973 2 71
3oio-assembly1.cif.gz_A crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum 0.8966 135 244
1gqh-assembly1.cif.gz_B quercetin 2,3-dioxygenase in complex with the inhibitor kojic acid 0.8953 2 69
ID Description Score Start End Superfamily
1d5yD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9852 195 242 1.10.10.60
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.981 199 241 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9732 195 247 1.10.10.60
1bl0A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9541 198 241 1.10.10.60
3lsgB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9363 197 241 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A519W2Y2-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9645 144 244 GO:0000155
GO:0003700
GO:0016020
GO:0043565
AF-A0A7C1V772-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9611 144 242 GO:0000155
GO:0003700
GO:0016020
GO:0043565
AF-R6L9L8-F1-model_v4 deleted 0.9439 144 246
AF-A0A7V6AK44-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9438 144 244 GO:0000155
GO:0003700
GO:0043565
AF-A0A651G7K3-F1-model_v4 AraC family transcriptional regulator 0.9373 144 248 GO:0003700
GO:0043565

Feature Viewer

pLDDT pTM Quality
85.67 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map