F491845

General Info

Members Datasets Scaffolds Average Seq Length
1220 988 460 363

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0062880|Ga0451576_0062880_683_1795
Length 370
Sequence MTRSVLSRLSLALAAGIAVVGVSIGAAGAQDRAKTVRVWNWPDYMDKSALADFEKETGFKLEYDDTMPGNEELETAILGGKIEYDVVVPTATFLSRDIKAKAYQPLDKSKIPNLKNYWPEIAAKVTKYDPDNKYSINWMWGTVGIGYNVKKIKERLKDAPVDSWKLVYDPDNAKKLKDCGILMLDSPEDILPSILAYLGIDPDTRKIEDYRKATDHLKKIAPFVRKFQTQGYIEALAQGDYCAVVGYSGDIIQARAGAKDGVEIAYSVPKEGAQLWFDQMAIPAAAKNVDGAHAFINYVLKPEVHAAASNLTRYANGNIAAKPLIKEEITKDPTIYPDEAMMKHLFTVTTLDDKLQPQVTRLWTQAKRGK

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
8 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
9 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
10 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
11 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
12 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
13 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
14 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
15 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
16 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
17 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
18 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
19 2512875024 Mesorhizobium loti R88b Isolate Nodule
20 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
21 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
22 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
23 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
24 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
25 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
26 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
27 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
28 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
29 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
30 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
31 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
32 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
33 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
34 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
35 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
36 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
37 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
38 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
39 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
40 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
41 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
42 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
43 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
44 2516143018 Ensifer sp. BR816 Isolate Nodule
45 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
46 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
47 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
48 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
49 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
50 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
51 2519899620 Rhizobium sp. Pop5 Isolate Nodule
52 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
53 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
54 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
55 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
56 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
57 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
58 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
59 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
60 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
61 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
62 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
63 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
64 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
65 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
66 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
67 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
68 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
69 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
70 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
71 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
72 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
73 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
74 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
75 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
76 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
77 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
78 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
79 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
80 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
81 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
82 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
83 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
84 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
85 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
86 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
87 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
88 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
89 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
90 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
91 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
92 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
93 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
94 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
95 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
96 2643221557 Ensifer sp. Root558 Isolate Unclassified
97 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
98 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
99 2643221599 Rhizobium sp. Root708 Isolate Unclassified
100 2643221607 Rhizobium sp. Root73 Isolate Unclassified
101 2643221610 Ensifer sp. Root74 Isolate Unclassified
102 2643221618 Ensifer sp. Root231 Isolate Unclassified
103 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
104 2643221626 Ensifer sp. Root31 Isolate Unclassified
105 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
106 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
107 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
108 2643221655 Ensifer sp. Root1252 Isolate Unclassified
109 2643221659 Ensifer sp. Root127 Isolate Unclassified
110 2643221668 Ensifer sp. Root423 Isolate Unclassified
111 2643221675 Ensifer sp. Root1298 Isolate Unclassified
112 2643221680 Ensifer sp. Root1312 Isolate Unclassified
113 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
114 2643221688 Rhizobium sp. Root482 Isolate Unclassified
115 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
116 2643221698 Ensifer sp. Root142 Isolate Unclassified
117 2643221712 Ensifer sp. Root258 Isolate Unclassified
118 2643221718 Rhizobium sp. Root268 Isolate Unclassified
119 2643221723 Ensifer sp. Root278 Isolate Unclassified
120 2643221726 Ensifer sp. Root954 Isolate Unclassified
121 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
122 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
123 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
124 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
125 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
126 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
127 2718217882 Rhizobium sp. N741 Isolate Nodule
128 2718217927 Rhizobium sp. N324 Isolate Nodule
129 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
130 2718218009 Rhizobium sp. N561 Isolate Nodule
131 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
132 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
133 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
134 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
135 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
136 2718218363 Rhizobium sp. N113 Isolate Nodule
137 2718218365 Rhizobium sp. N731 Isolate Nodule
138 2718218366 Rhizobium sp. N621 Isolate Nodule
139 2718218423 Rhizobium sp. N941 Isolate Nodule
140 2721755514 Rhizobium sp. N6212 Isolate Nodule
141 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
142 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
143 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
144 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
145 2721755809 Rhizobium sp. N541 Isolate Nodule
146 2721755810 Rhizobium sp. N871 Isolate Nodule
147 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
148 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
149 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
150 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
151 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
152 2728369365 Rhizobium sp. N1341 Isolate Nodule
153 2728369397 Rhizobium sp. N1314 Isolate Nodule
154 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
155 2738543024 Aminobacter sp. AP02 Isolate Unclassified
156 2751185800 Brucella pituitosa AA2 Isolate Unclassified
157 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
158 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
159 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
160 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
161 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
162 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
163 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
164 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
165 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
166 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
167 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
168 2791355256 Rhizobium sp. M10 Isolate Nodule
169 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
170 2791355260 Rhizobium sp. L9 Isolate Nodule
171 2791355261 Rhizobium sp. J15 Isolate Nodule
172 2791355262 Rhizobium sp. M1 Isolate Nodule
173 2791355264 Rhizobium sp. S9 Isolate Nodule
174 2791355265 Rhizobium sp. H4 Isolate Nodule
175 2791355266 Rhizobium sp. L43 Isolate Nodule
176 2791355267 Rhizobium sp. L18 Isolate Nodule
177 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
178 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
179 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
180 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
181 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
182 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
183 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
184 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
185 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
186 2802429633 Rhizobium anhuiense J3 Isolate Nodule
187 2802429634 Rhizobium anhuiense S10 Isolate Nodule
188 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
189 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
190 2802429637 Rhizobium anhuiense C15 Isolate Nodule
191 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
192 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
193 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
194 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
195 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
196 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
197 2838048938 Rhizobium pisi 27/80 Isolate Nodule
198 2838061910 Rhizobium phaseoli L15 Isolate Nodule
199 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
200 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
201 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
202 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
203 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
204 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
205 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
206 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
207 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
208 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
209 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
210 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
211 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
212 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
213 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
214 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
215 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
216 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
217 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
218 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
219 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
220 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
221 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
222 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
223 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
224 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
225 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
226 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
227 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
228 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
229 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
230 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
231 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
232 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
233 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
234 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
235 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
236 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
237 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
238 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
239 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
240 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
241 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
242 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
243 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
244 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
245 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
246 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
247 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
248 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
249 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
250 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
251 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
252 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
253 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
254 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
255 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
256 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
257 2842694124 Methylopila sp. R-72369 Isolate Unclassified
258 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
259 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
260 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
261 2844163670 Ensifer sp. 1H6 Isolate Unclassified
262 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
263 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
264 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
265 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
266 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
267 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
268 2854911287 Brucella lupini LUP21 Isolate Unclassified
269 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
270 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
271 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
272 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
273 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
274 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
275 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
276 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
277 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
278 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
279 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
280 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
281 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
282 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
283 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
284 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
285 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
286 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
287 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
288 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
289 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
290 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
291 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
292 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
293 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
294 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
295 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
296 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
297 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
298 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
299 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
300 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
301 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
302 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
303 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
304 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
305 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
306 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
307 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
308 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
309 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
310 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
311 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
312 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
313 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
314 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
315 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
316 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
317 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
318 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
319 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
320 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
321 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
322 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
323 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
324 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
325 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
326 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
327 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
328 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
329 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
330 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
331 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
332 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
333 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
334 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
335 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
336 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
337 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
338 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
339 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
340 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
341 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
342 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
343 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
344 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
345 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
346 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
347 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
348 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
349 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
350 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
351 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
352 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
353 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
354 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
355 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
356 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
357 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
358 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
359 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
360 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
361 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
362 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
363 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
364 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
365 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
366 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
367 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
368 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
369 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
370 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
371 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
372 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
373 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
374 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
375 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
376 2909042592 Labrys sp. LIt4 Isolate Nodule
377 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
378 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
379 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
380 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
381 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
382 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
383 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
384 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
385 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
386 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
387 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
388 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
389 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
390 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
391 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
392 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
393 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
394 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
395 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
396 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
397 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
398 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
399 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
400 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
401 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
402 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
403 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
404 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
405 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
406 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
407 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
408 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
409 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
410 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
411 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
412 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
413 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
414 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
415 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
416 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
417 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
418 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
419 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
420 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
421 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
422 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
423 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
424 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
425 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
426 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
427 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
428 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
429 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
430 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
431 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
432 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
433 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
434 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
435 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
436 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
437 2933599457 Rhizobium phaseoli M3 Isolate Nodule
438 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
439 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
440 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
441 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
442 2936381700 Rhizobium chutanense C16 Isolate Unclassified
443 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
444 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
445 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
446 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
447 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
448 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
449 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
450 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
451 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
452 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
453 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
454 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
455 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
456 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
457 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
458 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
459 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
460 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
461 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
462 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
463 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
464 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
465 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
466 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
467 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
468 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
469 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
470 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
471 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
472 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
473 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
474 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
475 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
476 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
477 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
478 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
479 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
480 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
481 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
482 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
483 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
484 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
485 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
486 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
487 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
488 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
489 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
490 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
491 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
492 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
493 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
494 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
495 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
496 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
497 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
498 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
499 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
500 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
501 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
502 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
503 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
504 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
505 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
506 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
507 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
508 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
509 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
510 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
511 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
512 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
513 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
514 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
515 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
516 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
517 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
518 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
519 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
520 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
521 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
522 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
523 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
524 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
525 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
526 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
527 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
528 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
529 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
530 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
531 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
532 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
533 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
534 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
535 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
536 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
537 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
538 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
539 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
540 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
541 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
542 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
543 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
544 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
545 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
546 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
547 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
548 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
549 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
550 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
551 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
552 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
553 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
554 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
555 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
556 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
557 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
558 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
559 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
560 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
561 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
562 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
563 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
564 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
565 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
566 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
567 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
568 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
569 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
570 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
571 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
572 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
573 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
574 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
575 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
576 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
577 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
578 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
579 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
580 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
581 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
582 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
583 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
584 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
585 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
586 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
587 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
588 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
589 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
590 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
591 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
592 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
593 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
594 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
595 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
596 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
597 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
598 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
599 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
600 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
601 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
602 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
603 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
604 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
605 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
606 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
607 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
608 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
609 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
610 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
611 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
612 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
613 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
614 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
615 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
616 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
617 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
618 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
619 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
620 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
621 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
622 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
623 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
624 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
625 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
626 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
627 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
628 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
629 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
630 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
631 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
632 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
633 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
634 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
635 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
636 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
637 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
638 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
639 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
640 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
641 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
642 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
643 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
644 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
645 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
646 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
647 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
648 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
649 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
650 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
651 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
652 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
653 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
654 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
655 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
656 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
657 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
658 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
659 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
660 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
661 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
662 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
663 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
664 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
665 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
666 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
667 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
668 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
669 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
670 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
671 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
672 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
673 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
674 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
675 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
676 2996893221 Rhizobium sp. R635 Isolate Nodule
677 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
678 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
679 3004167301 Mesorhizobium loti 582 Isolate Unclassified
680 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
681 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
682 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
683 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
684 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
685 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
686 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
687 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
688 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
689 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
690 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
691 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
692 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
693 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
694 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
695 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
696 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
697 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
698 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
699 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
700 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
701 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
702 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
703 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
704 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
705 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
706 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
707 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
708 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
709 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
710 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
711 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
712 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
713 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
714 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
715 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
716 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
717 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
718 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
719 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
720 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
721 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
722 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
723 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
724 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
725 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
726 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
727 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
728 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
729 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
730 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
731 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
732 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
733 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
734 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
735 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
736 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
737 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
738 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
739 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
740 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
741 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
742 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
743 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
744 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
745 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
746 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
747 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
748 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
749 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
750 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
751 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
752 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
753 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
754 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
755 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
756 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
757 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
758 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
759 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
760 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
761 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
762 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
763 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
764 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
765 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
766 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
767 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
768 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
769 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
770 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
771 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
772 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
773 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
774 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
775 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
776 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
777 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
778 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
779 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
780 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
781 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
782 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
783 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
784 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
785 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
786 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
787 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
788 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
789 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
790 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
791 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
792 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
793 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
794 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
795 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
796 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
797 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
798 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
799 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
800 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
801 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
802 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
803 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
804 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
805 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
806 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
807 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
808 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
809 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
810 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
811 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
812 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
813 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
814 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
815 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
816 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
817 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
818 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
819 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
820 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
821 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
822 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
823 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
824 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
825 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
826 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
827 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
828 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
829 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
830 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
831 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
832 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
833 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
834 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
835 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
836 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
837 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
838 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
839 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
840 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
841 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
842 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
843 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
844 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
845 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
846 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
847 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
848 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
849 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
850 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
851 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
852 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
853 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
854 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
855 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
856 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
857 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
858 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
859 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
860 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
861 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
862 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
863 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
864 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
865 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
866 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
867 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
868 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
869 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
870 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
871 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
872 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
873 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
874 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
875 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
876 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
877 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
878 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
879 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
880 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
881 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
882 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
883 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
884 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
885 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
886 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
887 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
888 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
889 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
890 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
891 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
892 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
893 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
894 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
895 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
896 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
897 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
898 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
899 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
900 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
901 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
902 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
903 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
904 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
905 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
906 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
907 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
908 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
909 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
910 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
911 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
912 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
913 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
914 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
915 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
916 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
917 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
918 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
919 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
920 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
921 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
922 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
923 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
924 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
925 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
926 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
927 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
928 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
929 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
930 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
931 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
932 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
933 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
934 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
935 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
936 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
937 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
938 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
939 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
940 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
941 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
942 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
943 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
944 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
945 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
946 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
947 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
948 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
949 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
950 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
951 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
952 8005275841 Rhizobium sp. N4311 Isolate Nodule
953 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
954 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
955 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
956 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
957 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
958 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
959 8005382845 Rhizobium sp. R634 Isolate Nodule
960 8005395548 Rhizobium sp. R339 Isolate Nodule
961 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
962 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
963 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
964 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
965 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
966 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
967 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
968 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
969 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
970 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
971 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
972 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
973 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
974 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
975 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
976 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
977 8018176218 Rhizobium sp. N122 Isolate Nodule
978 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
979 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
980 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
981 8024501048 Rhizobium sp. H4 Isolate Nodule
982 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
983 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
984 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
985 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
986 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
987 8056382006 Rhizobium croatiense 13T Isolate Nodule
988 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 37.38
Metatranscriptomes 0.33
Isolates 62.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.3
Nodule 52.7
Rhizoplane 1.15
Rhizosphere 21.64
Stem 0
Stem Tuber 0
Unclassified 12.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000180 3300001979 Bacteria 25592
2 JGI24740J21852_10033550 3300001979 Bacteria 1627
3 JGI25155J39150_1000023 3300002704 Bacteria 136961
4 JGI25156J39149_1000029 3300002705 Bacteria 126505
5 JGI25162J39368_1000557 3300002737 Bacteria 27462
6 JGI25162J39368_1000680 3300002737 Bacteria 23782
7 JGI25154J39366_1000067 3300002738 Bacteria 100452
8 JGI25157J39369_1000043 3300002741 Bacteria 122537
9 JGI25157J39369_1002049 3300002741 Bacteria 5765
10 JGI25152J39213_1001989 3300002773 Bacteria 8067
11 JGI25152J39213_1003556 3300002773 Bacteria 5273
12 JGI25152J39213_1007450 3300002773 Bacteria 2832
13 JGI25150J39212_1000635 3300002774 Bacteria 13309
14 JGI25159J45721_1000016 3300002987 Bacteria 139656
15 JGI25159J45721_1002498 3300002987 Bacteria 6931
16 JGI25151J46595_10005451 3300003187 Bacteria 6570
17 JGI25151J46595_10006576 3300003187 Bacteria 5822
18 JGI25151J46595_10008996 3300003187 Bacteria 4761
19 JGI25406J46586_10003471 3300003203 Bacteria 7412
20 JGI25406J46586_10004531 3300003203 Bacteria 6469
21 JGI25165J46597_1000020 3300003214 Bacteria 370477
22 JGI25165J46597_1000341 3300003214 Bacteria 53973
23 JGI25165J46597_1000685 3300003214 Bacteria 27199
24 JGI25165J46597_1002415 3300003214 Bacteria 6084
25 JGI25153J46596_10008486 3300003215 Bacteria 4902
26 JGI25153J46596_10017393 3300003215 Bacteria 2833
27 JGI25153J46596_10017407 3300003215 Bacteria 2832
28 rootH2_10167695 3300003320 Bacteria 2222
29 rootH1_10142434 3300003323 Bacteria 2387
30 JGI25160J50197_1000002 3300003354 Bacteria 561707
31 JGI25160J50197_1002474 3300003354 Bacteria 8582
32 JGI25160J50197_1008833 3300003354 Bacteria 3796
33 JGI25161J50226_1000074 3300003374 Bacteria 85547
34 JGI25161J50226_1000397 3300003374 Bacteria 21635
35 JGI25161J50226_1003864 3300003374 Bacteria 3284
36 Ga0006562J51391_1007706 3300003578 Bacteria 2505
37 Ga0055542_1000391 3300003762 Bacteria 44080
38 Ga0055529_1003631 3300003763 Bacteria 2504
39 Ga0055526_1001675 3300003771 Bacteria 15546
40 Ga0055526_1002163 3300003771 Bacteria 13474
41 Ga0055526_1003529 3300003771 Bacteria 9876
42 Ga0055526_1015631 3300003771 Bacteria 3035
43 Ga0055526_1019861 3300003771 Bacteria 2425
44 Ga0055524_1000384 3300003775 Bacteria 38108
45 Ga0055524_1005117 3300003775 Bacteria 5927
46 Ga0055524_1013288 3300003775 Bacteria 3111
47 Ga0055524_1016207 3300003775 Bacteria 2684
48 Ga0055524_1016318 3300003775 Bacteria 2669
49 Ga0055536_1008133 3300003781 Bacteria 4569
50 Ga0055528_1000642 3300003790 Bacteria 25591
51 Ga0055528_1000866 3300003790 Bacteria 20524
52 Ga0055528_1001522 3300003790 Bacteria 13999
53 Ga0055540_1002010 3300003792 Bacteria 11314
54 Ga0055540_1017728 3300003792 Bacteria 1977
55 Ga0055531_10008927 3300003794 Bacteria 5196
56 Ga0058692_1015609 3300003856 Bacteria 1707
57 Ga0055543_1000022 3300004625 Bacteria 140745
58 Ga0055543_1000141 3300004625 Bacteria 60055
59 Ga0055543_1001242 3300004625 Bacteria 10604
60 Ga0058861_10929188 3300004800 Bacteria 1214
61 Ga0065165_1000058 3300005262 Bacteria 184784
62 Ga0065165_1006709 3300005262 Bacteria 5920
63 Ga0065165_1009515 3300005262 Bacteria 4345
64 Ga0065704_10120625 3300005289 Bacteria 1779
65 Ga0070658_10057249 3300005327 Bacteria 3170
66 Ga0068869_100080741 3300005334 Bacteria 2427
67 Ga0070682_100006740 3300005337 Bacteria 6443
68 Ga0070660_100051633 3300005339 Bacteria 3167
69 Ga0070691_10020262 3300005341 Bacteria 3072
70 Ga0070661_100241988 3300005344 Bacteria 1390
71 Ga0070668_100203763 3300005347 Bacteria 1625
72 Ga0070659_100015565 3300005366 Bacteria 5697
73 Ga0070705_100003435 3300005440 Bacteria 7768
74 Ga0070663_100035546 3300005455 Bacteria 3457
75 Ga0070681_10006028 3300005458 Bacteria 11744
76 Ga0068867_100093470 3300005459 Bacteria 2286
77 Ga0070679_100014502 3300005530 Bacteria 7570
78 Ga0068853_100015631 3300005539 Bacteria 6235
79 Ga0068853_100073032 3300005539 Bacteria 2990
80 Ga0070695_100026551 3300005545 Bacteria 3584
81 Ga0070696_100047010 3300005546 Bacteria 2994
82 Ga0070693_100043144 3300005547 Bacteria 2546
83 Ga0070665_100003769 3300005548 Bacteria 16042
84 Ga0070665_100059986 3300005548 Bacteria 3813
85 Ga0070665_100212633 3300005548 Bacteria 1935
86 Ga0070665_100333213 3300005548 Bacteria 1522
87 Ga0070704_100045011 3300005549 Bacteria 3070
88 Ga0068855_100173114 3300005563 Bacteria 2444
89 Ga0068855_100336449 3300005563 Bacteria 1665
90 Ga0068856_100010830 3300005614 Bacteria 8853
91 Ga0068851_10013108 3300005834 Bacteria 3922
92 Ga0068858_100033410 3300005842 Bacteria 4774
93 Ga0068860_100092421 3300005843 Bacteria 2883
94 Ga0081540_1008678 3300005983 Bacteria 7077
95 Ga0081539_10000881 3300005985 Bacteria 57379
96 Ga0075365_10003480 3300006038 Bacteria 8122
97 Ga0075365_10009006 3300006038 Bacteria 5708
98 Ga0075365_10031740 3300006038 Bacteria 3390
99 Ga0075365_10065914 3300006038 Bacteria 2428
100 Ga0075365_10066519 3300006038 Bacteria 2418
101 Ga0075365_10223540 3300006038 Bacteria 1321
102 Ga0075363_100010408 3300006048 Bacteria 4417
103 Ga0075363_100033536 3300006048 Bacteria 2674
104 Ga0075364_10148354 3300006051 Bacteria 1580
105 Ga0075362_10041002 3300006177 Bacteria 2040
106 Ga0075362_10055641 3300006177 Bacteria 1779
107 Ga0075367_10045438 3300006178 Bacteria 2577
108 Ga0075369_10008616 3300006186 Bacteria 3933
109 Ga0075370_10013935 3300006353 Bacteria 4279
110 Ga0075370_10014582 3300006353 Bacteria 4195
111 Ga0075370_10038960 3300006353 Bacteria 2676
112 Ga0075370_10103900 3300006353 Bacteria 1646
113 Ga0068865_100244837 3300006881 Bacteria 1412
114 Ga0079104_1000876 3300006946 Bacteria 24701
115 Ga0079104_1006701 3300006946 Bacteria 4295
116 Ga0099826_10102133 3300006948 Bacteria 1727
117 Ga0105240_10000278 3300009093 Bacteria 101540
118 Ga0105240_10167846 3300009093 Bacteria 2602
119 Ga0105241_10014342 3300009174 Bacteria 5803
120 Ga0105237_10000434 3300009545 Bacteria 59528
121 Ga0105237_10110128 3300009545 Bacteria 2746
122 Ga0105238_10016156 3300009551 Bacteria 7552
123 Ga0123341_1004338 3300009765 Bacteria 12435
124 Ga0105239_10011555 3300010375 Bacteria 9849
125 Ga0105246_10035227 3300011119 Bacteria 3344
126 Ga0157370_10001667 3300013104 Bacteria 27351
127 Ga0157370_10058384 3300013104 Bacteria 3668
128 Ga0157369_10110027 3300013105 Bacteria 2929
129 Ga0157369_10119777 3300013105 Bacteria 2793
130 Ga0157369_10157122 3300013105 Bacteria 2401
131 Ga0171463_1001 3300013249 Bacteria 1406070
132 Ga0163162_10438769 3300013306 Bacteria 1438
133 Ga0182008_10027793 3300014497 Bacteria 2863
134 Ga0182008_10056897 3300014497 Bacteria 1931
135 Ga0157379_10046850 3300014968 Bacteria 3858
136 Ga0157376_10038693 3300014969 Bacteria 3882
137 Ga0182007_10000762 3300015262 Bacteria 18049
138 Ga0183363_1012 3300015690 Bacteria 90054
139 Ga0214544_1000012 3300021320 Bacteria 229808
140 Ga0214542_1000011 3300021321 Bacteria 238260
141 Ga0214542_1017282 3300021321 Bacteria 6588
142 Ga0214543_1000004 3300021327 Bacteria 527190
143 Ga0214543_1000256 3300021327 Bacteria 82084
144 Ga0228711_1000019 3300022739 Bacteria 111795
145 Ga0228710_1000022 3300022740 Bacteria 111795
146 Ga0209435_100011 3300025206 Bacteria 413027
147 Ga0209436_100429 3300025208 Bacteria 18855
148 Ga0209437_100036 3300025233 Bacteria 469153
149 Ga0209437_100086 3300025233 Bacteria 254578
150 Ga0209437_103627 3300025233 Bacteria 2771
151 Ga0207425_1000750 3300025245 Bacteria 16857
152 Ga0207425_1007797 3300025245 Bacteria 2792
153 Ga0207425_1010337 3300025245 Bacteria 2276
154 Ga0209646_1000024 3300025246 Bacteria 413027
155 Ga0209646_1008094 3300025246 Bacteria 1700
156 Ga0209026_1000030 3300025250 Bacteria 329811
157 Ga0209026_1000116 3300025250 Bacteria 133228
158 Ga0209677_101433 3300025253 Bacteria 10304
159 Ga0209148_1000256 3300025254 Bacteria 83479
160 Ga0209148_1004346 3300025254 Bacteria 3519
161 Ga0209148_1013386 3300025254 Bacteria 1476
162 Ga0209759_1000011 3300025256 Bacteria 413027
163 Ga0209759_1000153 3300025256 Bacteria 119494
164 Ga0209129_1000123 3300025258 Bacteria 133661
165 Ga0209129_1000726 3300025258 Bacteria 21238
166 Ga0209129_1002322 3300025258 Bacteria 9429
167 Ga0209129_1005158 3300025258 Bacteria 4760
168 Ga0209233_1000047 3300025261 Bacteria 459614
169 Ga0209233_1000110 3300025261 Bacteria 260825
170 Ga0209233_1000166 3300025261 Bacteria 152270
171 Ga0209233_1000356 3300025261 Bacteria 42791
172 Ga0209233_1003452 3300025261 Bacteria 5566
173 Ga0209455_1000409 3300025272 Bacteria 34679
174 Ga0209455_1012913 3300025272 Bacteria 1969
175 Ga0209673_1000015 3300025273 Bacteria 530618
176 Ga0209673_1000967 3300025273 Bacteria 35634
177 Ga0209673_1001964 3300025273 Bacteria 16078
178 Ga0209130_1000002 3300025284 Bacteria 722648
179 Ga0209130_1000008 3300025284 Bacteria 581232
180 Ga0209130_1009737 3300025284 Bacteria 2710
181 Ga0209676_1027295 3300025292 Bacteria 1799
182 Ga0209025_1000528 3300025294 Bacteria 72802
183 Ga0209025_1000631 3300025294 Bacteria 62429
184 Ga0209025_1000970 3300025294 Bacteria 43006
185 Ga0209025_1003049 3300025294 Bacteria 16508
186 Ga0209025_1003063 3300025294 Bacteria 16420
187 Ga0209025_1007670 3300025294 Bacteria 7971
188 Ga0209025_1040430 3300025294 Bacteria 2017
189 Ga0209564_1000091 3300025295 Bacteria 249103
190 Ga0209564_1000382 3300025295 Bacteria 81070
191 Ga0209564_1000830 3300025295 Bacteria 41868
192 Ga0209564_1001931 3300025295 Bacteria 18509
193 Ga0209758_1001048 3300025297 Bacteria 36241
194 Ga0209758_1001962 3300025297 Bacteria 22243
195 Ga0209758_1002450 3300025297 Bacteria 18942
196 Ga0209758_1002458 3300025297 Bacteria 18888
197 Ga0209758_1002490 3300025297 Bacteria 18719
198 Ga0209758_1036814 3300025297 Bacteria 1902
199 Ga0209758_1038146 3300025297 Bacteria 1847
200 Ga0209758_1049584 3300025297 Bacteria 1481
201 Ga0209050_1018443 3300025298 Bacteria 2711
202 Ga0209256_1000180 3300025299 Bacteria 123687
203 Ga0209256_1000541 3300025299 Bacteria 54431
204 Ga0209256_1000874 3300025299 Bacteria 37312
205 Ga0209256_1001340 3300025299 Bacteria 26171
206 Ga0209256_1004894 3300025299 Bacteria 8054
207 Ga0209256_1005494 3300025299 Bacteria 7255
208 Ga0207426_1000013 3300025302 Bacteria 721897
209 Ga0207426_1000016 3300025302 Bacteria 581232
210 Ga0207426_1000063 3300025302 Bacteria 358920
211 Ga0207426_1000172 3300025302 Bacteria 163690
212 Ga0209051_1002801 3300025303 Bacteria 12034
213 Ga0209257_1007835 3300025304 Bacteria 6315
214 Ga0207656_10008887 3300025321 Bacteria 3719
215 Ga0207688_10052437 3300025901 Bacteria 2286
216 Ga0207647_10020338 3300025904 Bacteria 4452
217 Ga0207707_10210774 3300025912 Bacteria 1692
218 Ga0207695_10000376 3300025913 Bacteria 101548
219 Ga0207695_10067857 3300025913 Bacteria 3656
220 Ga0207671_10000275 3300025914 Bacteria 76888
221 Ga0207671_10065781 3300025914 Bacteria 2697
222 Ga0207657_10116920 3300025919 Bacteria 2197
223 Ga0207652_10032547 3300025921 Bacteria 4385
224 Ga0207694_10008988 3300025924 Bacteria 7543
225 Ga0207694_10059514 3300025924 Bacteria 2971
226 Ga0207640_10084026 3300025981 Bacteria 2185
227 Ga0207640_10098195 3300025981 Bacteria 2047
228 Ga0207703_10121419 3300026035 Bacteria 2243
229 Ga0207639_10043324 3300026041 Bacteria 3378
230 Ga0207639_10056141 3300026041 Bacteria 3017
231 Ga0207678_10000100 3300026067 Bacteria 70537
232 Ga0207678_10037727 3300026067 Bacteria 4202
233 Ga0207702_10445509 3300026078 Bacteria 1256
234 Ga0207648_10061347 3300026089 Bacteria 3279
235 Ga0207674_10036110 3300026116 Bacteria 5154
236 Ga0207674_10107995 3300026116 Bacteria 2759
237 Ga0207675_100232527 3300026118 Bacteria 1779
238 Ga0209281_1000227 3300027111 Bacteria 119329
239 Ga0209281_1000519 3300027111 Bacteria 50062
240 Ga0209371_1001452 3300027312 Bacteria 16053
241 Ga0209282_1000042 3300027666 Bacteria 119329
242 Ga0268266_10003101 3300028379 Bacteria 16931
243 Ga0268266_10187777 3300028379 Bacteria 1886
244 Ga0268266_10336810 3300028379 Bacteria 1415
245 Ga0268264_10041098 3300028381 Bacteria 3823
246 Ga0307515_10000023 3300028794 Bacteria 400846
247 Ga0268256_1006875 3300030500 Bacteria 4156
248 Ga0307408_100069522 3300031548 Bacteria 2597
249 Ga0316576_10159758 3300031727 Bacteria 1700
250 Ga0307412_10001804 3300031911 Bacteria 11852
251 Ga0307412_10046244 3300031911 Bacteria 2851
252 Ga0315914_1000009 3300031967 Bacteria 182444
253 Ga0315913_1000015 3300033430 Bacteria 119325
254 Ga0315915_1000013 3300033464 Bacteria 182438
255 Ga0395899_0000014 3300037312 Bacteria 488813
256 Ga0395900_0000007 3300037418 Bacteria 488860
257 Ga0395900_0017694 3300037418 Bacteria 7276
258 Ga0395900_0275262 3300037418 Bacteria 1677
259 Ga0395898_0000011 3300037466 Bacteria 488860
260 Ga0395905_0000008 3300037471 Bacteria 488860
261 Ga0395905_0011842 3300037471 Bacteria 8419
262 Ga0395905_0015664 3300037471 Bacteria 7203
263 Ga0395905_0049624 3300037471 Bacteria 3933
264 Ga0395901_0000020 3300038443 Bacteria 314918
265 Ga0395901_0081410 3300038443 Bacteria 3382
266 Ga0395901_0253945 3300038443 Bacteria 1831
267 Ga0451843_1400191 3300041509 Bacteria 1561
268 Ga0451855_0701739 3300041511 Bacteria 1759
269 Ga0439458_0006590 3300042157 Bacteria 2589
270 Ga0466972_0018212 3300044658 Bacteria 3513
271 Ga0466960_0003639 3300044901 Bacteria 5950
272 Ga0451576_0062880 3300045051 Bacteria 3869
273 Ga0495638_0000772 3300046460 Bacteria 33999
274 Ga0495638_0079723 3300046460 Bacteria 1990
275 Ga0495638_0098661 3300046460 Bacteria 1750
276 Ga0495605_0001663 3300046474 Bacteria 14289
277 Ga0495662_0013599 3300046476 Bacteria 3961
278 Ga0495585_0008254 3300046492 Bacteria 6322
279 Ga0495607_0015274 3300046501 Bacteria 4979
280 Ga0495606_0001322 3300046507 Bacteria 33851
281 Ga0495606_0013621 3300046507 Bacteria 6412
282 Ga0495616_0010216 3300046513 Bacteria 5446
283 Ga0495620_0007293 3300046515 Bacteria 6021
284 Ga0495631_0000651 3300046518 Bacteria 22509
285 Ga0495632_0019147 3300046519 Bacteria 3735
286 Ga0495632_0034796 3300046519 Bacteria 2575
287 Ga0495643_0032859 3300046522 Bacteria 2876
288 Ga0495648_0090525 3300046524 Bacteria 1714
289 Ga0495609_0031053 3300046538 Bacteria 2430
290 Ga0495622_0007907 3300046557 Bacteria 4933
291 Ga0495668_0003355 3300046616 Bacteria 12065
292 Ga0495668_0096449 3300046616 Bacteria 1618
293 Ga0495611_0033549 3300046648 Bacteria 2265
294 Ga0495625_0001384 3300046660 Bacteria 29779
295 Ga0495625_0012368 3300046660 Bacteria 6918
296 Ga0495625_0030489 3300046660 Bacteria 4023
297 Ga0495657_0018360 3300046675 Bacteria 5066
298 Ga0495670_0014513 3300046691 Bacteria 3871
299 Ga0495600_0033509 3300046809 Bacteria 3334
300 Ga0495660_0113315 3300046810 Bacteria 1381
301 Ga0495681_0096774 3300047470 Bacteria 1296
302 Ga0496101_0025113 3300048904 Bacteria 4130
303 Ga0496102_0007685 3300048905 Bacteria 9209
304 Ga0496102_0035097 3300048905 Bacteria 4513
305 Ga0496103_0004698 3300048906 Bacteria 8266
306 Ga0496103_0010778 3300048906 Bacteria 5409
307 Ga0496104_0051548 3300048907 Bacteria 3884
308 Ga0496106_0010076 3300048909 Bacteria 6979
309 Ga0496106_0010917 3300048909 Bacteria 6713
310 Ga0496107_0075756 3300048910 Bacteria 2449
311 Ga0496112_0025119 3300048915 Bacteria 5717
312 Ga0496116_0001443 3300048919 Bacteria 26678
313 Ga0496116_0125996 3300048919 Bacteria 1471
314 Ga0496117_0005892 3300048920 Bacteria 12664
315 Ga0496117_0006167 3300048920 Bacteria 12251
316 Ga0496117_0023955 3300048920 Bacteria 4846
317 Ga0496118_0003378 3300048921 Bacteria 20168
318 Ga0496118_0007687 3300048921 Bacteria 11337
319 Ga0496118_0027397 3300048921 Bacteria 4824
320 Ga0496118_0029672 3300048921 Bacteria 4582
321 Ga0496118_0140862 3300048921 Bacteria 1529
322 Ga0496119_0051532 3300048922 Bacteria 2529
323 Ga0496119_0064133 3300048922 Bacteria 2182
324 Ga0496119_0080104 3300048922 Bacteria 1884
325 Ga0496120_0006068 3300048923 Bacteria 9385
326 Ga0496120_0012424 3300048923 Bacteria 5798
327 Ga0496120_0015857 3300048923 Bacteria 4949
328 Ga0496120_0100482 3300048923 Bacteria 1529
329 Ga0496121_0007378 3300048924 Bacteria 13288
330 Ga0496121_0020629 3300048924 Bacteria 6507
331 Ga0496121_0050316 3300048924 Bacteria 3521
332 Ga0496121_0052389 3300048924 Bacteria 3428
333 Ga0496122_0001050 3300048925 Bacteria 48341
334 Ga0496122_0008742 3300048925 Bacteria 10841
335 Ga0496122_0024992 3300048925 Bacteria 5209
336 Ga0496123_0000158 3300048926 Bacteria 136078
337 Ga0496123_0016492 3300048926 Bacteria 5996
338 Ga0496123_0021281 3300048926 Bacteria 5045
339 Ga0496123_0035458 3300048926 Bacteria 3554
340 Ga0496123_0049706 3300048926 Bacteria 2808
341 Ga0496124_0067811 3300048927 Bacteria 2967
342 Ga0496124_0068758 3300048927 Bacteria 2942
343 Ga0496125_0000695 3300048928 Bacteria 55563
344 Ga0496125_0013510 3300048928 Bacteria 8022
345 Ga0496125_0086900 3300048928 Bacteria 2363
346 Ga0496126_0000195 3300048929 Bacteria 135582
347 Ga0496126_0155151 3300048929 Bacteria 1960
348 Ga0496126_0183862 3300048929 Bacteria 1774
349 Ga0496126_0274037 3300048929 Bacteria 1399
350 Ga0501031_0000003 3300049568 Bacteria 206821
351 Ga0501032_0000010 3300049569 Bacteria 206795
352 Ga0501032_0000587 3300049569 Bacteria 29296
353 Ga0501032_0012946 3300049569 Bacteria 5944
354 Ga0501033_0000017 3300049570 Bacteria 206819
355 Ga0501033_0001157 3300049570 Bacteria 23861
356 Ga0501033_0010015 3300049570 Bacteria 7280
357 Ga0501033_0062037 3300049570 Bacteria 2753
358 Ga0501034_0000053 3300049571 Bacteria 206821
359 Ga0501034_0008667 3300049571 Bacteria 10724
360 Ga0501034_0009703 3300049571 Bacteria 10066
361 Ga0501036_0000009 3300049572 Bacteria 206821
362 Ga0501036_0041505 3300049572 Bacteria 3892
363 Ga0501036_0229110 3300049572 Bacteria 1560
364 Ga0501037_0000008 3300049573 Bacteria 206812
365 Ga0501037_0000308 3300049573 Bacteria 41514
366 Ga0501037_0002684 3300049573 Bacteria 12837
367 Ga0501038_0000008 3300049574 Bacteria 206821
368 Ga0501038_0045427 3300049574 Bacteria 3813
369 Ga0501039_0000021 3300049575 Bacteria 162552
370 Ga0501039_0020847 3300049575 Bacteria 5024
371 Ga0501040_0003914 3300049576 Bacteria 9662
372 Ga0501042_0011075 3300049578 Bacteria 6074
373 Ga0501043_0000005 3300049579 Bacteria 254466
374 Ga0501043_0000405 3300049579 Bacteria 38778
375 Ga0501043_0012619 3300049579 Bacteria 6609
376 Ga0501043_0085082 3300049579 Bacteria 2485
377 Ga0501043_0123547 3300049579 Bacteria 2030
378 Ga0501046_0001156 3300049580 Bacteria 25669
379 Ga0501046_0004239 3300049580 Bacteria 13051
380 Ga0501046_0008611 3300049580 Bacteria 8874
381 Ga0501046_0060132 3300049580 Bacteria 2974
382 Ga0501047_0000129 3300049581 Bacteria 91572
383 Ga0501047_0000894 3300049581 Bacteria 30442
384 Ga0501047_0011466 3300049581 Bacteria 8388
385 Ga0501047_0020856 3300049581 Bacteria 6294
386 Ga0501047_0078666 3300049581 Bacteria 3171
387 Ga0501047_0085213 3300049581 Bacteria 3036
388 Ga0501047_0253312 3300049581 Bacteria 1609
389 Ga0501048_0012224 3300049582 Bacteria 6391
390 Ga0501067_0000213 3300049583 Bacteria 32191
391 Ga0501068_0006475 3300049584 Bacteria 6458
392 Ga0501069_0000011 3300049585 Bacteria 153214
393 Ga0501070_0000117 3300049586 Bacteria 70793
394 Ga0501070_0000257 3300049586 Bacteria 50142
395 Ga0501070_0007140 3300049586 Bacteria 9489
396 Ga0501070_0078602 3300049586 Bacteria 2730
397 Ga0501071_0005058 3300049587 Bacteria 8437
398 Ga0501071_0017921 3300049587 Bacteria 4896
399 Ga0501073_0011311 3300049589 Bacteria 6530
400 Ga0501073_0014360 3300049589 Bacteria 5754
401 Ga0501073_0187298 3300049589 Bacteria 1432
402 Ga0501074_0002555 3300049590 Bacteria 12701
403 Ga0501074_0068296 3300049590 Bacteria 2555
404 Ga0501080_0000053 3300049742 Bacteria 74409
405 Ga0501080_0008649 3300049742 Bacteria 9241
406 Ga0501080_0014905 3300049742 Bacteria 7157
407 Ga0501080_0018259 3300049742 Bacteria 6491
408 Ga0501080_0089986 3300049742 Bacteria 2851
409 Ga0501083_0000406 3300049744 Bacteria 27431
410 Ga0501083_0037026 3300049744 Bacteria 3325
411 Ga0501083_0072873 3300049744 Bacteria 2282
412 Ga0501083_0075699 3300049744 Bacteria 2235
413 Ga0501035_0000010 3300049822 Bacteria 309349
414 Ga0501035_0000023 3300049822 Bacteria 206821
415 Ga0501035_0000107 3300049822 Bacteria 103130
416 Ga0501035_0001177 3300049822 Bacteria 27251
417 Ga0501035_0003419 3300049822 Bacteria 15188
418 Ga0501035_0003519 3300049822 Bacteria 14970
419 Ga0501035_0007710 3300049822 Bacteria 10052
420 Ga0501035_0007999 3300049822 Bacteria 9853
421 Ga0501035_0016995 3300049822 Bacteria 6704
422 Ga0501035_0018369 3300049822 Bacteria 6444
423 Ga0501035_0087384 3300049822 Bacteria 2748
424 Ga0501044_0000006 3300049823 Bacteria 291413
425 Ga0501044_0000021 3300049823 Bacteria 206821
426 Ga0501044_0000154 3300049823 Bacteria 85407
427 Ga0501044_0011012 3300049823 Bacteria 9815
428 Ga0501044_0022808 3300049823 Bacteria 6667
429 Ga0501044_0094043 3300049823 Bacteria 3022
430 Ga0501044_0107825 3300049823 Bacteria 2796
431 Ga0501044_0298174 3300049823 Bacteria 1541
432 Ga0501045_0007088 3300049824 Bacteria 7770
433 nmdc:mga03n38_3995_c1 3300050490 Bacteria 4818
434 nmdc:mga03n38_66181_c1 3300050490 Bacteria 1659
435 nmdc:mga00v17_4395_c2 3300050491 Bacteria 4203
436 nmdc:mga0yw44_1917_c1 3300050492 Bacteria 8593
437 nmdc:mga0yw44_81672_c1 3300050492 Bacteria 2027
438 nmdc:mga0k408_78805_c1 3300050493 Bacteria 1927
439 nmdc:mga06z11_32904_c1 3300050494 Bacteria 2532
440 nmdc:mga07m45_19408_c1 3300050496 Bacteria 3683
441 nmdc:mga0sz30_11121_c2 3300050516 Bacteria 2859
442 Ga0495619_0009320 3300053085 Bacteria 6197
443 Ga0500644_0017467 3300053088 Bacteria 2084
444 Ga0500618_008275 3300053125 Bacteria 2913
445 Ga0500658_0050408 3300053134 Bacteria 1699
446 Ga0500568_0000205 3300053139 Bacteria 51687
447 Ga0500568_0000924 3300053139 Bacteria 20259
448 Ga0500568_0014156 3300053139 Bacteria 3611
449 Ga0500568_0026797 3300053139 Bacteria 2416
450 Ga0500590_021587 3300053148 Bacteria 3342
451 Ga0500604_0021191 3300053151 Bacteria 1836
452 Ga0500616_0002449 3300053153 Bacteria 15425
453 Ga0500616_0017030 3300053153 Bacteria 4127
454 Ga0500620_002469 3300053155 Bacteria 3737
455 Ga0500622_0001035 3300053156 Bacteria 23258
456 Ga0500627_0059509 3300053158 Bacteria 1678
457 Ga0587073_0016407 3300059492 Bacteria 1352
458 Ga0587106_002538 3300059605 Bacteria 1808
459 Ga0501082_0013933 3300060353 Bacteria 6915
460 Ga0501082_0046054 3300060353 Bacteria 3761

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031727 Ga0316576_10159758 Ga0316576_101597581 358
2 iso_pu_bacteria 2508501122 2509107039 358
3 iso_pu_bacteria 2509276019 2509375005 358
4 iso_pu_bacteria 2510065057 2510305151 358
5 iso_pu_bacteria 2511231052 2511500533 358
6 iso_pu_bacteria 2512047086 2512531992 358
7 iso_pu_bacteria 2512875026 2512972690 358
8 iso_pu_bacteria 2513237086 2513584159 358
9 iso_pu_bacteria 2513237089 2513602921 358
10 iso_pu_bacteria 2513237091 2513620444 358
11 iso_pu_bacteria 2513237140 2513880608 358
12 iso_pu_bacteria 2513237143 2513903338 358
13 iso_pu_bacteria 2513237156 2513986336 358
14 iso_pu_bacteria 2513237159 2513996765 358
15 iso_pu_bacteria 2513237160 2514005173 358
16 iso_pu_bacteria 2515154107 2515607721 358
17 iso_pu_bacteria 2516143018 2516204340 358
18 iso_pu_bacteria 2516653046 2516891855 358
19 iso_pu_bacteria 2517487022 2517568651 358
20 iso_pu_bacteria 2524023207 2524449892 358
21 iso_pu_bacteria 2551306084 2551679334 358
22 iso_pu_bacteria 2551306085 2551686161 358
23 iso_pu_bacteria 2551306086 2551692121 358
24 iso_pu_bacteria 2551306087 2551699802 358
25 iso_pu_bacteria 2551306089 2551710537 358
26 iso_pu_bacteria 2551306089 2551712291 358
27 iso_pu_bacteria 2551306090 2551723206 358
28 iso_pu_bacteria 2551306091 2551729903 358
29 iso_pu_bacteria 2551306092 2551733411 358
30 iso_pu_bacteria 2551306093 2551743527 358
31 iso_pu_bacteria 2558860100 2558866007 358
32 iso_pu_bacteria 2582581283 2585165000 358
33 iso_pu_bacteria 2582581306 2585269544 358
34 iso_pu_bacteria 2582581865 2585385488 358
35 iso_pu_bacteria 2599185352 2600191454 358
36 iso_pu_bacteria 2643221557 2643806294 358
37 iso_pu_bacteria 2643221607 2644047125 358
38 iso_pu_bacteria 2643221610 2644070104 358
39 iso_pu_bacteria 2643221618 2644103239 358
40 iso_pu_bacteria 2643221626 2644151889 358
41 iso_pu_bacteria 2643221636 2644203436 358
42 iso_pu_bacteria 2643221637 2644206704 358
43 iso_pu_bacteria 2643221655 2644306167 358
44 iso_pu_bacteria 2643221659 2644330417 358
45 iso_pu_bacteria 2643221668 2644381075 358
46 iso_pu_bacteria 2643221675 2644414981 358
47 iso_pu_bacteria 2643221680 2644448638 358
48 iso_pu_bacteria 2643221686 2644479914 358
49 iso_pu_bacteria 2643221688 2644492250 358
50 iso_pu_bacteria 2643221689 2644496753 358
51 iso_pu_bacteria 2643221698 2644542837 358
52 iso_pu_bacteria 2643221712 2644618883 358
53 iso_pu_bacteria 2643221718 2644650351 358
54 iso_pu_bacteria 2643221723 2644674026 358
55 iso_pu_bacteria 2643221726 2644689054 358
56 iso_pu_bacteria 2657244999 2657681895 358
57 iso_pu_bacteria 2690316117 2692317256 358
58 iso_pu_bacteria 2757320392 2757569207 358
59 iso_pu_bacteria 2765235942 2766066478 358
60 iso_pu_bacteria 2791355082 2792582922 358
61 iso_pu_bacteria 2791355091 2792623811 358
62 iso_pu_bacteria 2791355092 2792629809 358
63 iso_pu_bacteria 2791355094 2792638144 358
64 iso_pu_bacteria 2802428858 2802720316 358
65 iso_pu_bacteria 2802428859 2802726135 358
66 iso_pu_bacteria 2802428860 2802731700 358
67 iso_pu_bacteria 2802428861 2802739451 358
68 iso_pu_bacteria 2802428862 2802742593 358
69 iso_pu_bacteria 2802428863 2802749298 358
70 iso_pu_bacteria 2802429268 2804750914 358
71 iso_pu_bacteria 2838074704 2838075372 358
72 iso_pu_bacteria 2842521101 2842521696 358
73 iso_pu_bacteria 2844163670 2844170751 358
74 iso_pu_bacteria 2847417321 2847417677 358
75 iso_pu_bacteria 2848992105 2848992482 358
76 iso_pu_bacteria 2850079185 2850079975 358
77 iso_pu_bacteria 2855825444 2855831772 358
78 iso_pu_bacteria 2855839649 2855840003 358
79 iso_pu_bacteria 2855872281 2855874536 358
80 iso_pu_bacteria 2858800743 2858803967 358
81 iso_pu_bacteria 2896384573 2896391555 358
82 iso_pu_bacteria 2913295892 2913297993 358
83 iso_pu_bacteria 2915980308 2915980782 358
84 iso_pu_bacteria 2915986958 2915992630 358
85 iso_pu_bacteria 2915993759 2915999680 358
86 iso_pu_bacteria 2916000859 2916002002 358
87 iso_pu_bacteria 2916007675 2916011988 358
88 iso_pu_bacteria 2916014648 2916016046 358
89 iso_pu_bacteria 2916021584 2916022534 358
90 iso_pu_bacteria 2916028427 2916033360 358
91 iso_pu_bacteria 2916035215 2916038814 358
92 iso_pu_bacteria 2916041962 2916042791 358
93 iso_pu_bacteria 2916048683 2916050249 358
94 iso_pu_bacteria 2916055098 2916057715 358
95 iso_pu_bacteria 2916061851 2916063651 358
96 iso_pu_bacteria 2916068649 2916073395 358
97 iso_pu_bacteria 2916076590 2916080888 358
98 iso_pu_bacteria 2920760137 2920763394 358
99 iso_pu_bacteria 2920822456 2920823374 358
100 iso_pu_bacteria 2921201388 2921203048 358
101 iso_pu_bacteria 2921208531 2921209389 358
102 iso_pu_bacteria 2921237296 2921239199 358
103 iso_pu_bacteria 2921244191 2921245204 358
104 iso_pu_bacteria 2921250672 2921257160 358
105 iso_pu_bacteria 2921257292 2921260350 358
106 iso_pu_bacteria 2921263974 2921266485 358
107 iso_pu_bacteria 2921282425 2921287565 358
108 iso_pu_bacteria 2921289301 2921291944 358
109 iso_pu_bacteria 2924144063 2924146048 358
110 iso_pu_bacteria 2924150972 2924154443 358
111 iso_pu_bacteria 2924158325 2924163501 358
112 iso_pu_bacteria 2924165586 2924165986 358
113 iso_pu_bacteria 2924172951 2924174661 358
114 iso_pu_bacteria 2924179722 2924180866 358
115 iso_pu_bacteria 2924186466 2924191814 358
116 iso_pu_bacteria 2924193448 2924194295 358
117 iso_pu_bacteria 2924200457 2924202434 358
118 iso_pu_bacteria 2924207177 2924209666 358
119 iso_pu_bacteria 2924214083 2924218021 358
120 iso_pu_bacteria 2924221636 2924224275 358
121 iso_pu_bacteria 2924228884 2924232991 358
122 iso_pu_bacteria 2936996657 2936999117 358
123 iso_pu_bacteria 2937002841 2937005049 358
124 iso_pu_bacteria 2937009748 2937011330 358
125 iso_pu_bacteria 2937016420 2937018763 358
126 iso_pu_bacteria 2937023124 2937023817 358
127 iso_pu_bacteria 2937029754 2937034531 358
128 iso_pu_bacteria 2937036028 2937041308 358
129 iso_pu_bacteria 2937042894 2937049479 358
130 iso_pu_bacteria 2937049772 2937053990 358
131 iso_pu_bacteria 2937056579 2937060445 358
132 iso_pu_bacteria 2937063883 2937070041 358
133 iso_pu_bacteria 2937071275 2937071522 358
134 iso_pu_bacteria 2937078374 2937078742 358
135 iso_pu_bacteria 2937084907 2937086073 358
136 iso_pu_bacteria 2937091812 2937093691 358
137 iso_pu_bacteria 2937098957 2937103442 358
138 iso_pu_bacteria 2937106411 2937110371 358
139 iso_pu_bacteria 2937113482 2937114679 358
140 iso_pu_bacteria 2937119839 2937122589 358
141 iso_pu_bacteria 2937126314 2937128467 358
142 iso_pu_bacteria 2941499720 2941500712 358
143 iso_pu_bacteria 2957375807 2957382059 358
144 iso_pu_bacteria 2957382221 2957383661 358
145 iso_pu_bacteria 2957388812 2957394074 358
146 iso_pu_bacteria 2957395598 2957399561 358
147 iso_pu_bacteria 2957402308 2957403709 358
148 iso_pu_bacteria 2957408893 2957411040 358
149 iso_pu_bacteria 2957415311 2957421561 358
150 iso_pu_bacteria 2957422303 2957426230 358
151 iso_pu_bacteria 2957430029 2957435411 358
152 iso_pu_bacteria 2957437181 2957442636 358
153 iso_pu_bacteria 2957443900 2957447120 358
154 iso_pu_bacteria 2957450854 2957457326 358
155 iso_pu_bacteria 2957457609 2957464404 358
156 iso_pu_bacteria 2957464669 2957466186 358
157 iso_pu_bacteria 2957471148 2957471756 358
158 iso_pu_bacteria 2957478035 2957480323 358
159 iso_pu_bacteria 2957484790 2957489021 358
160 iso_pu_bacteria 2957491536 2957494598 358
161 iso_pu_bacteria 2957498199 2957503818 358
162 iso_pu_bacteria 2957505466 2957508616 358
163 iso_pu_bacteria 2960584000 2960585705 358
164 iso_pu_bacteria 2960591022 2960594764 358
165 iso_pu_bacteria 2960597568 2960599741 358
166 iso_pu_bacteria 2960603979 2960605547 358
167 iso_pu_bacteria 2960610863 2960616931 358
168 iso_pu_bacteria 2960617483 2960621702 358
169 iso_pu_bacteria 2960624210 2960629195 358
170 iso_pu_bacteria 2960631154 2960637459 358
171 iso_pu_bacteria 2960637947 2960644793 358
172 iso_pu_bacteria 2960645483 2960647691 358
173 iso_pu_bacteria 2960652885 2960657204 358
174 iso_pu_bacteria 2960660292 2960660404 358
175 iso_pu_bacteria 2960667422 2960668428 358
176 iso_pu_bacteria 2960674078 2960675589 358
177 iso_pu_bacteria 2960680706 2960686609 358
178 iso_pu_bacteria 2960687367 2960690332 358
179 iso_pu_bacteria 2960693952 2960698826 358
180 iso_pu_bacteria 2964607997 2964609372 358
181 iso_pu_bacteria 2964615318 2964619806 358
182 iso_pu_bacteria 2964621998 2964622437 358
183 iso_pu_bacteria 2964628898 2964634315 358
184 iso_pu_bacteria 2964636051 2964636411 358
185 iso_pu_bacteria 2964643177 2964646964 358
186 iso_pu_bacteria 2964649959 2964650339 358
187 iso_pu_bacteria 2964656573 2964659472 358
188 iso_pu_bacteria 2964663802 2964665799 358
189 iso_pu_bacteria 2964670856 2964674979 358
190 iso_pu_bacteria 2964678106 2964680617 358
191 iso_pu_bacteria 2964685014 2964691098 358
192 iso_pu_bacteria 2964691889 2964693043 358
193 iso_pu_bacteria 2964698721 2964704136 358
194 iso_pu_bacteria 2964705432 2964707182 358
195 iso_pu_bacteria 2964712639 2964718576 358
196 iso_pu_bacteria 2964719344 2964719893 358
197 iso_pu_bacteria 2967664464 2967669779 358
198 iso_pu_bacteria 2967671571 2967678175 358
199 iso_pu_bacteria 2967678726 2967684965 358
200 iso_pu_bacteria 2967686174 2967691523 358
201 iso_pu_bacteria 2967693043 2967695077 358
202 iso_pu_bacteria 2967699805 2967700362 358
203 iso_pu_bacteria 2967706974 2967712773 358
204 iso_pu_bacteria 2967714385 2967714671 358
205 iso_pu_bacteria 2967721400 2967722454 358
206 iso_pu_bacteria 2967728569 2967730556 358
207 iso_pu_bacteria 2967735183 2967736324 358
208 iso_pu_bacteria 2967742019 2967747811 358
209 iso_pu_bacteria 2967748971 2967751849 358
210 iso_pu_bacteria 2967755722 2967761295 358
211 iso_pu_bacteria 2967762386 2967762681 358
212 iso_pu_bacteria 2967769361 2967771306 358
213 iso_pu_bacteria 2967775926 2967776737 358
214 iso_pu_bacteria 2970019648 2970023314 358
215 iso_pu_bacteria 2970026789 2970030577 358
216 iso_pu_bacteria 2970033650 2970034024 358
217 iso_pu_bacteria 2970040964 2970045497 358
218 iso_pu_bacteria 2970047711 2970052620 358
219 iso_pu_bacteria 2970054988 2970057423 358
220 iso_pu_bacteria 2970061556 2970063966 358
221 iso_pu_bacteria 2970068827 2970071366 358
222 iso_pu_bacteria 2970076120 2970080398 358
223 iso_pu_bacteria 2970082768 2970087335 358
224 iso_pu_bacteria 2970088815 2970095379 358
225 iso_pu_bacteria 2970095765 2970101511 358
226 iso_pu_bacteria 2970102677 2970103363 358
227 iso_pu_bacteria 2970109326 2970116051 358
228 iso_pu_bacteria 2970116247 2970121905 358
229 iso_pu_bacteria 2970122695 2970126295 358
230 iso_pu_bacteria 2970129317 2970131575 358
231 iso_pu_bacteria 2970136068 2970143477 358
232 iso_pu_bacteria 2970143518 2970148538 358
233 iso_pu_bacteria 2970149975 2970153261 358
234 iso_pu_bacteria 2970156795 2970159525 358
235 iso_pu_bacteria 2970164137 2970167711 358
236 iso_pu_bacteria 2970170962 2970177015 358
237 iso_pu_bacteria 2970177841 2970181890 358
238 iso_pu_bacteria 2970184632 2970188449 358
239 iso_pu_bacteria 2970191845 2970196432 358
240 iso_pu_bacteria 2977516862 2977517731 358
241 iso_pu_bacteria 2977523885 2977529136 358
242 iso_pu_bacteria 2977530762 2977535859 358
243 iso_pu_bacteria 2977537788 2977539985 358
244 iso_pu_bacteria 2977544691 2977549467 358
245 iso_pu_bacteria 2977551784 2977552923 358
246 iso_pu_bacteria 2977558990 2977559282 358
247 iso_pu_bacteria 2977565890 2977567518 358
248 iso_pu_bacteria 2977572785 2977573172 358
249 iso_pu_bacteria 2977579622 2977580445 358
250 iso_pu_bacteria 643692032 643824536 358
251 iso_pu_bacteria 648276728 648739369 358
252 iso_pu_bacteria 8003992118 8003992446 358
253 iso_pu_bacteria 8003999396 8003999774 358
254 iso_pu_bacteria 8049293176 8049293472 358
255 iso_pu_bacteria 2891373044 2891374939 359
256 iso_pu_bacteria 2989349275 2989351410 359
257 3300045051 Ga0451576_0062880 Ga0451576_0062880_683_1795 360
258 iso_pu_bacteria 2643221551 2643778054 360
259 iso_pu_bacteria 2643221555 2643796502 360
260 iso_pu_bacteria 2894817345 2894819413 360
261 iso_pu_bacteria 2909042592 2909046720 360
262 iso_pu_bacteria 2937843397 2937845200 360
263 iso_pu_bacteria 2989771324 2989772786 360
264 iso_pu_bacteria 3003930520 3003931950 360
265 iso_pu_bacteria 8005289223 8005291089 360
266 iso_pu_bacteria 8054558443 8054559215 360
267 3300006038 Ga0075365_10223540 Ga0075365_102235401 361
268 3300046460 Ga0495638_0098661 Ga0495638_0098661_445_1557 361
269 iso_pu_bacteria 2503198000 2503200584 361
270 iso_pu_bacteria 2508501123 2509116877 361
271 iso_pu_bacteria 2508501127 2509141879 361
272 iso_pu_bacteria 2509276018 2509373986 361
273 iso_pu_bacteria 2509276021 2509388442 361
274 iso_pu_bacteria 2509276022 2509395372 361
275 iso_pu_bacteria 2509276033 2509443990 361
276 iso_pu_bacteria 2510065019 2510131411 361
277 iso_pu_bacteria 2510065059 2510316343 361
278 iso_pu_bacteria 2510461076 2510897765 361
279 iso_pu_bacteria 2510917022 2511136282 361
280 iso_pu_bacteria 2510917030 2511196819 361
281 iso_pu_bacteria 2512875016 2512928791 361
282 iso_pu_bacteria 2512875024 2512963535 361
283 iso_pu_bacteria 2513237084 2513570630 361
284 iso_pu_bacteria 2513237090 2513612363 361
285 iso_pu_bacteria 2513237093 2513634258 361
286 iso_pu_bacteria 2513237103 2513713193 361
287 iso_pu_bacteria 2513237144 2513910353 361
288 iso_pu_bacteria 2513237162 2514020249 361
289 iso_pu_bacteria 2513237164 2514038192 361
290 iso_pu_bacteria 2513237305 2514419648 361
291 iso_pu_bacteria 2513237351 2514590764 361
292 iso_pu_bacteria 2515075009 2515110372 361
293 iso_pu_bacteria 2515154113 2515634572 361
294 iso_pu_bacteria 2515154114 2515643797 361
295 iso_pu_bacteria 2515154116 2515657195 361
296 iso_pu_bacteria 2515154134 2515743304 361
297 iso_pu_bacteria 2516653077 2517039059 361
298 iso_pu_bacteria 2516653085 2517079315 361
299 iso_pu_bacteria 2517093000 2517093256 361
300 iso_pu_bacteria 2517287029 2517409523 361
301 iso_pu_bacteria 2519899620 2520378895 361
302 iso_pu_bacteria 2529292951 2530647824 361
303 iso_pu_bacteria 2582581294 2585203670 361
304 iso_pu_bacteria 2582581298 2585227074 361
305 iso_pu_bacteria 2582581304 2585255917 361
306 iso_pu_bacteria 2582581307 2585275445 361
307 iso_pu_bacteria 2582581308 2585282303 361
308 iso_pu_bacteria 2582581315 2585325981 361
309 iso_pu_bacteria 2582581316 2585330152 361
310 iso_pu_bacteria 2585427526 2585529268 361
311 iso_pu_bacteria 2585427527 2585536499 361
312 iso_pu_bacteria 2585427528 2585539681 361
313 iso_pu_bacteria 2585427529 2585550501 361
314 iso_pu_bacteria 2585427530 2585556977 361
315 iso_pu_bacteria 2585427531 2585560112 361
316 iso_pu_bacteria 2585427593 2585837638 361
317 iso_pu_bacteria 2585427608 2585901617 361
318 iso_pu_bacteria 2585427609 2585905707 361
319 iso_pu_bacteria 2585428125 2587979177 361
320 iso_pu_bacteria 2588253730 2588514335 361
321 iso_pu_bacteria 2597489875 2597811167 361
322 iso_pu_bacteria 2599185156 2599333008 361
323 iso_pu_bacteria 2599185301 2599940580 361
324 iso_pu_bacteria 2615840624 2616297114 361
325 iso_pu_bacteria 2615840626 2616306327 361
326 iso_pu_bacteria 2615840698 2616553403 361
327 iso_pu_bacteria 2617270742 2617383744 361
328 iso_pu_bacteria 2643221550 2643770265 361
329 iso_pu_bacteria 2643221564 2643840338 361
330 iso_pu_bacteria 2643221595 2643989857 361
331 iso_pu_bacteria 2643221599 2644007316 361
332 iso_pu_bacteria 2643221623 2644132495 361
333 iso_pu_bacteria 2643221627 2644153509 361
334 iso_pu_bacteria 2667528174 2671112365 361
335 iso_pu_bacteria 2687453392 2688597751 361
336 iso_pu_bacteria 2693429783 2694629155 361
337 iso_pu_bacteria 2693429784 2694636931 361
338 iso_pu_bacteria 2718217882 2719179567 361
339 iso_pu_bacteria 2718217927 2719384120 361
340 iso_pu_bacteria 2718217997 2719663913 361
341 iso_pu_bacteria 2718218009 2719730237 361
342 iso_pu_bacteria 2718218199 2720490332 361
343 iso_pu_bacteria 2718218232 2720611707 361
344 iso_pu_bacteria 2718218233 2720618556 361
345 iso_pu_bacteria 2718218235 2720629964 361
346 iso_pu_bacteria 2718218269 2720773659 361
347 iso_pu_bacteria 2718218363 2721145660 361
348 iso_pu_bacteria 2718218365 2721157176 361
349 iso_pu_bacteria 2718218366 2721162539 361
350 iso_pu_bacteria 2718218423 2721397890 361
351 iso_pu_bacteria 2721755514 2722838709 361
352 iso_pu_bacteria 2721755556 2723025332 361
353 iso_pu_bacteria 2721755684 2723558915 361
354 iso_pu_bacteria 2721755685 2723565485 361
355 iso_pu_bacteria 2721755686 2723578250 361
356 iso_pu_bacteria 2721755809 2724036700 361
357 iso_pu_bacteria 2721755810 2724042993 361
358 iso_pu_bacteria 2721755819 2724088266 361
359 iso_pu_bacteria 2721755822 2724102750 361
360 iso_pu_bacteria 2721755823 2724108650 361
361 iso_pu_bacteria 2724679232 2725948990 361
362 iso_pu_bacteria 2728369352 2730106268 361
363 iso_pu_bacteria 2728369365 2730162804 361
364 iso_pu_bacteria 2728369397 2730296808 361
365 iso_pu_bacteria 2738541333 2739037071 361
366 iso_pu_bacteria 2738543024 2739309605 361
367 iso_pu_bacteria 2751185800 2753358020 361
368 iso_pu_bacteria 2756170246 2756676352 361
369 iso_pu_bacteria 2758568016 2758638827 361
370 iso_pu_bacteria 2765235942 2766066570 361
371 iso_pu_bacteria 2775507266 2778174165 361
372 iso_pu_bacteria 2791355123 2792750123 361
373 iso_pu_bacteria 2791355256 2793295213 361
374 iso_pu_bacteria 2791355259 2793316333 361
375 iso_pu_bacteria 2791355260 2793323435 361
376 iso_pu_bacteria 2791355261 2793326171 361
377 iso_pu_bacteria 2791355262 2793334231 361
378 iso_pu_bacteria 2791355264 2793348146 361
379 iso_pu_bacteria 2791355265 2793357238 361
380 iso_pu_bacteria 2791355266 2793361515 361
381 iso_pu_bacteria 2791355267 2793364671 361
382 iso_pu_bacteria 2802429605 2805929366 361
383 iso_pu_bacteria 2802429606 2805932375 361
384 iso_pu_bacteria 2802429633 2806047547 361
385 iso_pu_bacteria 2802429634 2806054966 361
386 iso_pu_bacteria 2802429635 2806062132 361
387 iso_pu_bacteria 2802429636 2806067142 361
388 iso_pu_bacteria 2802429637 2806076463 361
389 iso_pu_bacteria 2818991448 2819608413 361
390 iso_pu_bacteria 2818991453 2819643511 361
391 iso_pu_bacteria 2838016132 2838020281 361
392 iso_pu_bacteria 2838022645 2838028183 361
393 iso_pu_bacteria 2838029111 2838029296 361
394 iso_pu_bacteria 2838042994 2838044427 361
395 iso_pu_bacteria 2838048938 2838051503 361
396 iso_pu_bacteria 2838061910 2838063977 361
397 iso_pu_bacteria 2838068647 2838071105 361
398 iso_pu_bacteria 2838668709 2838672400 361
399 iso_pu_bacteria 2838680041 2838680579 361
400 iso_pu_bacteria 2838686498 2838691588 361
401 iso_pu_bacteria 2838694306 2838695388 361
402 iso_pu_bacteria 2838701080 2838703858 361
403 iso_pu_bacteria 2838707686 2838708764 361
404 iso_pu_bacteria 2838729681 2838733928 361
405 iso_pu_bacteria 2838742623 2838747008 361
406 iso_pu_bacteria 2841734538 2841735627 361
407 iso_pu_bacteria 2841851746 2841856149 361
408 iso_pu_bacteria 2841864319 2841866818 361
409 iso_pu_bacteria 2842077413 2842080001 361
410 iso_pu_bacteria 2842118031 2842120620 361
411 iso_pu_bacteria 2842146304 2842148350 361
412 iso_pu_bacteria 2842156927 2842161937 361
413 iso_pu_bacteria 2842163707 2842169687 361
414 iso_pu_bacteria 2842180545 2842185779 361
415 iso_pu_bacteria 2842192696 2842192880 361
416 iso_pu_bacteria 2842198810 2842205176 361
417 iso_pu_bacteria 2842205361 2842206957 361
418 iso_pu_bacteria 2842217011 2842218800 361
419 iso_pu_bacteria 2842229732 2842235307 361
420 iso_pu_bacteria 2842237096 2842238176 361
421 iso_pu_bacteria 2842243621 2842248238 361
422 iso_pu_bacteria 2842250916 2842253416 361
423 iso_pu_bacteria 2842257432 2842262168 361
424 iso_pu_bacteria 2842264693 2842268765 361
425 iso_pu_bacteria 2842271015 2842276561 361
426 iso_pu_bacteria 2842278818 2842280350 361
427 iso_pu_bacteria 2842285085 2842286832 361
428 iso_pu_bacteria 2842291075 2842293661 361
429 iso_pu_bacteria 2842304105 2842306508 361
430 iso_pu_bacteria 2842311132 2842312625 361
431 iso_pu_bacteria 2842317721 2842322508 361
432 iso_pu_bacteria 2842341865 2842343079 361
433 iso_pu_bacteria 2842363717 2842367195 361
434 iso_pu_bacteria 2842370503 2842371042 361
435 iso_pu_bacteria 2842377471 2842380058 361
436 iso_pu_bacteria 2842384541 2842387129 361
437 iso_pu_bacteria 2842395702 2842399242 361
438 iso_pu_bacteria 2842402390 2842403615 361
439 iso_pu_bacteria 2842409023 2842410683 361
440 iso_pu_bacteria 2842415677 2842417329 361
441 iso_pu_bacteria 2842422224 2842424721 361
442 iso_pu_bacteria 2842428310 2842433035 361
443 iso_pu_bacteria 2842434925 2842439340 361
444 iso_pu_bacteria 2842441272 2842445969 361
445 iso_pu_bacteria 2842447887 2842451850 361
446 iso_pu_bacteria 2842462802 2842467155 361
447 iso_pu_bacteria 2842469257 2842473817 361
448 iso_pu_bacteria 2842475841 2842476274 361
449 iso_pu_bacteria 2842482326 2842482345 361
450 iso_pu_bacteria 2842489311 2842492466 361
451 iso_pu_bacteria 2842495871 2842500046 361
452 iso_pu_bacteria 2842502639 2842502824 361
453 iso_pu_bacteria 2842922631 2842923314 361
454 iso_pu_bacteria 2844002411 2844004351 361
455 iso_pu_bacteria 2844009547 2844009856 361
456 iso_pu_bacteria 2844454524 2844455997 361
457 iso_pu_bacteria 2847670302 2847672622 361
458 iso_pu_bacteria 2847686936 2847691810 361
459 iso_pu_bacteria 2854911287 2854916248 361
460 iso_pu_bacteria 2856314179 2856315155 361
461 iso_pu_bacteria 2856320880 2856328169 361
462 iso_pu_bacteria 2856328259 2856329855 361
463 iso_pu_bacteria 2856334872 2856338770 361
464 iso_pu_bacteria 2856342000 2856346628 361
465 iso_pu_bacteria 2856349417 2856351370 361
466 iso_pu_bacteria 2856356410 2856362543 361
467 iso_pu_bacteria 2857349434 2857353655 361
468 iso_pu_bacteria 2857367948 2857371923 361
469 iso_pu_bacteria 2857516855 2857523445 361
470 iso_pu_bacteria 2869162929 2869166967 361
471 iso_pu_bacteria 2869169390 2869172486 361
472 iso_pu_bacteria 2869234852 2869235720 361
473 iso_pu_bacteria 2869242130 2869247504 361
474 iso_pu_bacteria 2869249662 2869256720 361
475 iso_pu_bacteria 2869256925 2869261458 361
476 iso_pu_bacteria 2869264136 2869266045 361
477 iso_pu_bacteria 2869271264 2869276256 361
478 iso_pu_bacteria 2869278585 2869284296 361
479 iso_pu_bacteria 2869285874 2869286815 361
480 iso_pu_bacteria 2871429161 2871434079 361
481 iso_pu_bacteria 2871435913 2871436788 361
482 iso_pu_bacteria 2871444079 2871451036 361
483 iso_pu_bacteria 2871451962 2871454749 361
484 iso_pu_bacteria 2871459585 2871462919 361
485 iso_pu_bacteria 2871466892 2871474270 361
486 iso_pu_bacteria 2871474448 2871475686 361
487 iso_pu_bacteria 2871481445 2871483942 361
488 iso_pu_bacteria 2871488783 2871490081 361
489 iso_pu_bacteria 2871495908 2871501992 361
490 iso_pu_bacteria 2874102143 2874107151 361
491 iso_pu_bacteria 2874109183 2874111816 361
492 iso_pu_bacteria 2874116593 2874118191 361
493 iso_pu_bacteria 2874123672 2874126819 361
494 iso_pu_bacteria 2874131515 2874132337 361
495 iso_pu_bacteria 2874139085 2874139241 361
496 iso_pu_bacteria 2874146452 2874147737 361
497 iso_pu_bacteria 2874155637 2874156655 361
498 iso_pu_bacteria 2874162495 2874163838 361
499 iso_pu_bacteria 2874168670 2874170898 361
500 iso_pu_bacteria 2876363079 2876369166 361
501 iso_pu_bacteria 2876369609 2876373576 361
502 iso_pu_bacteria 2876377896 2876378445 361
503 iso_pu_bacteria 2876386047 2876386218 361
504 iso_pu_bacteria 2876392853 2876393781 361
505 iso_pu_bacteria 2876399893 2876401496 361
506 iso_pu_bacteria 2876406927 2876410456 361
507 iso_pu_bacteria 2876413966 2876414771 361
508 iso_pu_bacteria 2876420981 2876421593 361
509 iso_pu_bacteria 2878035449 2878041990 361
510 iso_pu_bacteria 2878730984 2878736116 361
511 iso_pu_bacteria 2878738818 2878740088 361
512 iso_pu_bacteria 2878738818 2878743609 361
513 iso_pu_bacteria 2878745973 2878746789 361
514 iso_pu_bacteria 2878753008 2878753234 361
515 iso_pu_bacteria 2878760144 2878765771 361
516 iso_pu_bacteria 2878767105 2878772445 361
517 iso_pu_bacteria 2878774303 2878775281 361
518 iso_pu_bacteria 2878781027 2878781189 361
519 iso_pu_bacteria 2878788777 2878794642 361
520 iso_pu_bacteria 2881147464 2881154674 361
521 iso_pu_bacteria 2881155292 2881158436 361
522 iso_pu_bacteria 2881161766 2881164088 361
523 iso_pu_bacteria 2881845957 2881847279 361
524 iso_pu_bacteria 2881861095 2881867011 361
525 iso_pu_bacteria 2882632389 2882634310 361
526 iso_pu_bacteria 2882912400 2882912863 361
527 iso_pu_bacteria 2885305155 2885308817 361
528 iso_pu_bacteria 2885312484 2885318806 361
529 iso_pu_bacteria 2885318864 2885319097 361
530 iso_pu_bacteria 2885326080 2885332325 361
531 iso_pu_bacteria 2885334103 2885335950 361
532 iso_pu_bacteria 2885342637 2885345133 361
533 iso_pu_bacteria 2885350715 2885354792 361
534 iso_pu_bacteria 2888337043 2888342460 361
535 iso_pu_bacteria 2888343758 2888346301 361
536 iso_pu_bacteria 2888350351 2888351805 361
537 iso_pu_bacteria 2889010040 2889013779 361
538 iso_pu_bacteria 2889016732 2889021519 361
539 iso_pu_bacteria 2889790730 2889795366 361
540 iso_pu_bacteria 2889914905 2889916058 361
541 iso_pu_bacteria 2903448605 2903449374 361
542 iso_pu_bacteria 2903492973 2903498001 361
543 iso_pu_bacteria 2903492973 2903500677 361
544 iso_pu_bacteria 2903513507 2903515959 361
545 iso_pu_bacteria 2903521522 2903526366 361
546 iso_pu_bacteria 2903528002 2903529653 361
547 iso_pu_bacteria 2903540706 2903546717 361
548 iso_pu_bacteria 2904659560 2904660506 361
549 iso_pu_bacteria 2906308376 2906309169 361
550 iso_pu_bacteria 2906321335 2906326776 361
551 iso_pu_bacteria 2906328253 2906328729 361
552 iso_pu_bacteria 2906354277 2906357196 361
553 iso_pu_bacteria 2906363423 2906365197 361
554 iso_pu_bacteria 2906370794 2906372142 361
555 iso_pu_bacteria 2906378014 2906379282 361
556 iso_pu_bacteria 2906386501 2906391938 361
557 iso_pu_bacteria 2906393657 2906394512 361
558 iso_pu_bacteria 2906401398 2906406118 361
559 iso_pu_bacteria 2906408224 2906412304 361
560 iso_pu_bacteria 2906414383 2906415152 361
561 iso_pu_bacteria 2906427513 2906435277 361
562 iso_pu_bacteria 2915650412 2915652850 361
563 iso_pu_bacteria 2919100787 2919101353 361
564 iso_pu_bacteria 2919408235 2919408796 361
565 iso_pu_bacteria 2922130491 2922136557 361
566 iso_pu_bacteria 2922151315 2922157489 361
567 iso_pu_bacteria 2922158528 2922160058 361
568 iso_pu_bacteria 2922172374 2922174595 361
569 iso_pu_bacteria 2922178524 2922182633 361
570 iso_pu_bacteria 2922185730 2922189182 361
571 iso_pu_bacteria 2924718760 2924722622 361
572 iso_pu_bacteria 2924726620 2924728218 361
573 iso_pu_bacteria 2924733363 2924738441 361
574 iso_pu_bacteria 2924741084 2924747269 361
575 iso_pu_bacteria 2924748358 2924754206 361
576 iso_pu_bacteria 2924762789 2924765496 361
577 iso_pu_bacteria 2924776078 2924777687 361
578 iso_pu_bacteria 2924776078 2924781421 361
579 iso_pu_bacteria 2924784321 2924791169 361
580 iso_pu_bacteria 2933016740 2933017679 361
581 iso_pu_bacteria 2933570622 2933573577 361
582 iso_pu_bacteria 2933586486 2933593998 361
583 iso_pu_bacteria 2933599457 2933601904 361
584 iso_pu_bacteria 2935894831 2935895911 361
585 iso_pu_bacteria 2935901341 2935907170 361
586 iso_pu_bacteria 2936367885 2936368934 361
587 iso_pu_bacteria 2936375103 2936378451 361
588 iso_pu_bacteria 2936381700 2936383738 361
589 iso_pu_bacteria 2937813078 2937813972 361
590 iso_pu_bacteria 2937822353 2937828725 361
591 iso_pu_bacteria 2937836603 2937837050 361
592 iso_pu_bacteria 2937848649 2937850879 361
593 iso_pu_bacteria 2937861824 2937863175 361
594 iso_pu_bacteria 2937868953 2937874193 361
595 iso_pu_bacteria 2937877337 2937883905 361
596 iso_pu_bacteria 2937891427 2937892385 361
597 iso_pu_bacteria 2937972304 2937976656 361
598 iso_pu_bacteria 2937980651 2937981882 361
599 iso_pu_bacteria 2937994558 2938000576 361
600 iso_pu_bacteria 2958034702 2958038394 361
601 iso_pu_bacteria 2958041894 2958056004 361
602 iso_pu_bacteria 2958064165 2958066461 361
603 iso_pu_bacteria 2958071322 2958075378 361
604 iso_pu_bacteria 2958084443 2958091183 361
605 iso_pu_bacteria 2958092219 2958094664 361
606 iso_pu_bacteria 2958092219 2958096643 361
607 iso_pu_bacteria 2958108152 2958114965 361
608 iso_pu_bacteria 2958115193 2958121446 361
609 iso_pu_bacteria 2958122699 2958125024 361
610 iso_pu_bacteria 2958130278 2958131219 361
611 iso_pu_bacteria 2958137437 2958143857 361
612 iso_pu_bacteria 2958144490 2958151155 361
613 iso_pu_bacteria 2958158011 2958162692 361
614 iso_pu_bacteria 2958165035 2958170947 361
615 iso_pu_bacteria 2958172287 2958174210 361
616 iso_pu_bacteria 2958179912 2958180618 361
617 iso_pu_bacteria 2961077736 2961078452 361
618 iso_pu_bacteria 2961114664 2961120828 361
619 iso_pu_bacteria 2961136820 2961137078 361
620 iso_pu_bacteria 2961163497 2961169391 361
621 iso_pu_bacteria 2961170736 2961177058 361
622 iso_pu_bacteria 2961183825 2961184268 361
623 iso_pu_bacteria 2963644680 2963650442 361
624 iso_pu_bacteria 2965018300 2965023643 361
625 iso_pu_bacteria 2965025482 2965031044 361
626 iso_pu_bacteria 2965032056 2965035570 361
627 iso_pu_bacteria 2965040258 2965040350 361
628 iso_pu_bacteria 2965047637 2965050729 361
629 iso_pu_bacteria 2965062239 2965067222 361
630 iso_pu_bacteria 2965089291 2965093468 361
631 iso_pu_bacteria 2965102966 2965103540 361
632 iso_pu_bacteria 2965110997 2965115135 361
633 iso_pu_bacteria 2965119406 2965121528 361
634 iso_pu_bacteria 2967996073 2968002816 361
635 iso_pu_bacteria 2968003550 2968005213 361
636 iso_pu_bacteria 2968016561 2968021301 361
637 iso_pu_bacteria 2968083720 2968085615 361
638 iso_pu_bacteria 2968091066 2968095265 361
639 iso_pu_bacteria 2968097103 2968101236 361
640 iso_pu_bacteria 2968110612 2968111565 361
641 iso_pu_bacteria 2968117919 2968120213 361
642 iso_pu_bacteria 2968128360 2968128616 361
643 iso_pu_bacteria 2968138860 2968144175 361
644 iso_pu_bacteria 2968171901 2968177781 361
645 iso_pu_bacteria 2970469710 2970476406 361
646 iso_pu_bacteria 2970489779 2970491390 361
647 iso_pu_bacteria 2970503327 2970509731 361
648 iso_pu_bacteria 2970510686 2970516059 361
649 iso_pu_bacteria 2970524798 2970527809 361
650 iso_pu_bacteria 2970532167 2970534822 361
651 iso_pu_bacteria 2970540015 2970541931 361
652 iso_pu_bacteria 2970547951 2970554661 361
653 iso_pu_bacteria 2970554993 2970560627 361
654 iso_pu_bacteria 2970593180 2970598912 361
655 iso_pu_bacteria 2970619444 2970620941 361
656 iso_pu_bacteria 2970627176 2970628604 361
657 iso_pu_bacteria 2977821940 2977822167 361
658 iso_pu_bacteria 2977828996 2977832402 361
659 iso_pu_bacteria 2977843712 2977846964 361
660 iso_pu_bacteria 2977851361 2977854918 361
661 iso_pu_bacteria 2977858184 2977859095 361
662 iso_pu_bacteria 2977864932 2977865322 361
663 iso_pu_bacteria 2977872689 2977879354 361
664 iso_pu_bacteria 2977898635 2977905521 361
665 iso_pu_bacteria 2977907340 2977913819 361
666 iso_pu_bacteria 2977915119 2977917808 361
667 iso_pu_bacteria 2977922695 2977923855 361
668 iso_pu_bacteria 2977935797 2977937063 361
669 iso_pu_bacteria 2977942078 2977945726 361
670 iso_pu_bacteria 2977942078 2977945744 361
671 iso_pu_bacteria 2977950692 2977952271 361
672 iso_pu_bacteria 2977957713 2977957933 361
673 iso_pu_bacteria 2977971508 2977976129 361
674 iso_pu_bacteria 2977986579 2977989987 361
675 iso_pu_bacteria 2979710463 2979710606 361
676 iso_pu_bacteria 2979742915 2979749948 361
677 iso_pu_bacteria 2979764755 2979764891 361
678 iso_pu_bacteria 2979772303 2979774496 361
679 iso_pu_bacteria 2979779861 2979780030 361
680 iso_pu_bacteria 2979793036 2979797617 361
681 iso_pu_bacteria 2979808191 2979814518 361
682 iso_pu_bacteria 2987636660 2987642932 361
683 iso_pu_bacteria 2987645492 2987645853 361
684 iso_pu_bacteria 2987652177 2987654524 361
685 iso_pu_bacteria 2987652177 2987655620 361
686 iso_pu_bacteria 2987659509 2987665631 361
687 iso_pu_bacteria 2987666974 2987671738 361
688 iso_pu_bacteria 2987673487 2987680928 361
689 iso_pu_bacteria 2996310559 2996312904 361
690 iso_pu_bacteria 2996336353 2996337645 361
691 iso_pu_bacteria 2996341866 2996346059 361
692 iso_pu_bacteria 2996348954 2996356392 361
693 iso_pu_bacteria 2996386984 2996393965 361
694 iso_pu_bacteria 2996893221 2996893428 361
695 iso_pu_bacteria 3000135777 3000142385 361
696 iso_pu_bacteria 3004167301 3004172303 361
697 iso_pu_bacteria 3004188549 3004194579 361
698 iso_pu_bacteria 3004195979 3004197771 361
699 iso_pu_bacteria 3004203850 3004210725 361
700 iso_pu_bacteria 3004211236 3004213293 361
701 iso_pu_bacteria 3004218560 3004221365 361
702 iso_pu_bacteria 3004232784 3004236239 361
703 iso_pu_bacteria 3004239961 3004243344 361
704 iso_pu_bacteria 3004268573 3004271610 361
705 iso_pu_bacteria 3004275668 3004282696 361
706 iso_pu_bacteria 3004334049 3004338360 361
707 iso_pu_bacteria 3005416602 3005422813 361
708 iso_pu_bacteria 3005445848 3005446179 361
709 iso_pu_bacteria 3005452660 3005452836 361
710 iso_pu_bacteria 637000159 637074144 361
711 iso_pu_bacteria 637000159 637078489 361
712 iso_pu_bacteria 639633055 639646641 361
713 iso_pu_bacteria 649633066 649872294 361
714 iso_pu_bacteria 8002285264 8002288293 361
715 iso_pu_bacteria 8004300914 8004307325 361
716 iso_pu_bacteria 8004312739 8004317046 361
717 iso_pu_bacteria 8004361976 8004362922 361
718 iso_pu_bacteria 8004374579 8004374805 361
719 iso_pu_bacteria 8004387939 8004388099 361
720 iso_pu_bacteria 8004445564 8004447209 361
721 iso_pu_bacteria 8004633249 8004639102 361
722 iso_pu_bacteria 8004640170 8004644529 361
723 iso_pu_bacteria 8004695233 8004697204 361
724 iso_pu_bacteria 8004703790 8004713179 361
725 iso_pu_bacteria 8004714634 8004715426 361
726 iso_pu_bacteria 8004727605 8004729886 361
727 iso_pu_bacteria 8005275841 8005278831 361
728 iso_pu_bacteria 8005282627 8005289015 361
729 iso_pu_bacteria 8005301065 8005301547 361
730 iso_pu_bacteria 8005307578 8005309200 361
731 iso_pu_bacteria 8005314921 8005321651 361
732 iso_pu_bacteria 8005376324 8005377440 361
733 iso_pu_bacteria 8005382845 8005387303 361
734 iso_pu_bacteria 8005395548 8005400120 361
735 iso_pu_bacteria 8005430974 8005432927 361
736 iso_pu_bacteria 8005460587 8005461011 361
737 iso_pu_bacteria 8005484373 8005484944 361
738 iso_pu_bacteria 8005484373 8005487814 361
739 iso_pu_bacteria 8005497431 8005498655 361
740 iso_pu_bacteria 8005556819 8005560626 361
741 iso_pu_bacteria 8005563573 8005563915 361
742 iso_pu_bacteria 8005570704 8005576916 361
743 iso_pu_bacteria 8005619151 8005619849 361
744 iso_pu_bacteria 8005626139 8005628421 361
745 iso_pu_bacteria 8005645114 8005650140 361
746 iso_pu_bacteria 8005668836 8005670066 361
747 iso_pu_bacteria 8005682033 8005685120 361
748 iso_pu_bacteria 8005688590 8005690263 361
749 iso_pu_bacteria 8005695170 8005699260 361
750 iso_pu_bacteria 8018127388 8018133118 361
751 iso_pu_bacteria 8018163183 8018169019 361
752 iso_pu_bacteria 8018176218 8018179463 361
753 iso_pu_bacteria 8023680758 8023684237 361
754 iso_pu_bacteria 8024479707 8024480270 361
755 iso_pu_bacteria 8024486573 8024491420 361
756 iso_pu_bacteria 8024501048 8024501609 361
757 iso_pu_bacteria 8055617313 8055619093 361
758 iso_pu_bacteria 8056375014 8056375628 361
759 iso_pu_bacteria 8056382006 8056385942 361
760 iso_pu_bacteria 8057874678 8057876042 361
761 3300002987 JGI25159J45721_1000016 JGI25159J45721_100001646 362
762 3300003187 JGI25151J46595_10008996 JGI25151J46595_100089964 362
763 3300003354 JGI25160J50197_1000002 JGI25160J50197_1000002489 362
764 3300003374 JGI25161J50226_1000397 JGI25161J50226_100039711 362
765 3300003771 Ga0055526_1001675 Ga0055526_10016758 362
766 3300003775 Ga0055524_1000384 Ga0055524_100038412 362
767 3300003775 Ga0055524_1013288 Ga0055524_10132882 362
768 3300003781 Ga0055536_1008133 Ga0055536_10081334 362
769 3300003792 Ga0055540_1017728 Ga0055540_10177282 362
770 3300003794 Ga0055531_10008927 Ga0055531_100089273 362
771 3300004625 Ga0055543_1000022 Ga0055543_100002258 362
772 3300005262 Ga0065165_1000058 Ga0065165_1000058114 362
773 3300006946 Ga0079104_1000876 Ga0079104_100087617 362
774 3300006946 Ga0079104_1006701 Ga0079104_10067014 362
775 3300006948 Ga0099826_10102133 Ga0099826_101021331 362
776 3300013249 Ga0171463_1001 Ga0171463_1001691 362
777 3300015690 Ga0183363_1012 Ga0183363_101234 362
778 3300021320 Ga0214544_1000012 Ga0214544_1000012144 362
779 3300021321 Ga0214542_1000011 Ga0214542_1000011138 362
780 3300021321 Ga0214542_1017282 Ga0214542_10172822 362
781 3300021327 Ga0214543_1000004 Ga0214543_1000004362 362
782 3300021327 Ga0214543_1000256 Ga0214543_100025645 362
783 3300022739 Ga0228711_1000019 Ga0228711_10000198 362
784 3300022740 Ga0228710_1000022 Ga0228710_10000228 362
785 3300025284 Ga0209130_1000008 Ga0209130_100000857 362
786 3300025294 Ga0209025_1000631 Ga0209025_10006316 362
787 3300025295 Ga0209564_1000091 Ga0209564_1000091178 362
788 3300025297 Ga0209758_1038146 Ga0209758_10381462 362
789 3300025297 Ga0209758_1049584 Ga0209758_10495842 362
790 3300025298 Ga0209050_1018443 Ga0209050_10184432 362
791 3300025299 Ga0209256_1000180 Ga0209256_100018065 362
792 3300025299 Ga0209256_1000541 Ga0209256_100054112 362
793 3300025302 Ga0207426_1000016 Ga0207426_1000016504 362
794 3300025304 Ga0209257_1007835 Ga0209257_10078351 362
795 3300027111 Ga0209281_1000227 Ga0209281_100022714 362
796 3300027111 Ga0209281_1000519 Ga0209281_10005194 362
797 3300027666 Ga0209282_1000042 Ga0209282_100004214 362
798 3300031967 Ga0315914_1000009 Ga0315914_1000009113 362
799 3300033430 Ga0315913_1000015 Ga0315913_100001514 362
800 3300033464 Ga0315915_1000013 Ga0315915_100001375 362
801 3300046660 Ga0495625_0012368 Ga0495625_0012368_3584_4678 362
802 iso_pu_bacteria 2751185821 2753461344 362
803 3300001979 JGI24740J21852_10033550 JGI24740J21852_100335501 363
804 3300003187 JGI25151J46595_10005451 JGI25151J46595_100054515 363
805 3300004800 Ga0058861_10929188 Ga0058861_109291881 363
806 3300005334 Ga0068869_100080741 Ga0068869_1000807412 363
807 3300005337 Ga0070682_100006740 Ga0070682_1000067406 363
808 3300005341 Ga0070691_10020262 Ga0070691_100202623 363
809 3300005344 Ga0070661_100241988 Ga0070661_1002419881 363
810 3300005366 Ga0070659_100015565 Ga0070659_1000155651 363
811 3300005440 Ga0070705_100003435 Ga0070705_1000034356 363
812 3300005455 Ga0070663_100035546 Ga0070663_1000355462 363
813 3300005458 Ga0070681_10006028 Ga0070681_100060288 363
814 3300005530 Ga0070679_100014502 Ga0070679_1000145025 363
815 3300005539 Ga0068853_100015631 Ga0068853_1000156312 363
816 3300005545 Ga0070695_100026551 Ga0070695_1000265513 363
817 3300005546 Ga0070696_100047010 Ga0070696_1000470102 363
818 3300005547 Ga0070693_100043144 Ga0070693_1000431442 363
819 3300005548 Ga0070665_100333213 Ga0070665_1003332132 363
820 3300005549 Ga0070704_100045011 Ga0070704_1000450112 363
821 3300005563 Ga0068855_100173114 Ga0068855_1001731143 363
822 3300005842 Ga0068858_100033410 Ga0068858_1000334102 363
823 3300005843 Ga0068860_100092421 Ga0068860_1000924212 363
824 3300006881 Ga0068865_100244837 Ga0068865_1002448372 363
825 3300009174 Ga0105241_10014342 Ga0105241_100143422 363
826 3300009545 Ga0105237_10110128 Ga0105237_101101281 363
827 3300011119 Ga0105246_10035227 Ga0105246_100352272 363
828 3300013105 Ga0157369_10157122 Ga0157369_101571222 363
829 3300014968 Ga0157379_10046850 Ga0157379_100468502 363
830 3300014969 Ga0157376_10038693 Ga0157376_100386932 363
831 3300025294 Ga0209025_1000528 Ga0209025_100052831 363
832 3300025901 Ga0207688_10052437 Ga0207688_100524371 363
833 3300025904 Ga0207647_10020338 Ga0207647_100203382 363
834 3300025912 Ga0207707_10210774 Ga0207707_102107742 363
835 3300025914 Ga0207671_10065781 Ga0207671_100657812 363
836 3300025921 Ga0207652_10032547 Ga0207652_100325473 363
837 3300025924 Ga0207694_10059514 Ga0207694_100595141 363
838 3300026035 Ga0207703_10121419 Ga0207703_101214192 363
839 3300026041 Ga0207639_10056141 Ga0207639_100561413 363
840 3300026067 Ga0207678_10000100 Ga0207678_100001009 363
841 3300026116 Ga0207674_10036110 Ga0207674_100361104 363
842 3300028381 Ga0268264_10041098 Ga0268264_100410982 363
843 3300048904 Ga0496101_0025113 Ga0496101_0025113_2961_4067 363
844 3300048905 Ga0496102_0007685 Ga0496102_0007685_4606_5712 363
845 3300048906 Ga0496103_0004698 Ga0496103_0004698_871_1977 363
846 3300048907 Ga0496104_0051548 Ga0496104_0051548_1291_2397 363
847 3300048909 Ga0496106_0010076 Ga0496106_0010076_977_2083 363
848 3300048910 Ga0496107_0075756 Ga0496107_0075756_1307_2413 363
849 3300048920 Ga0496117_0005892 Ga0496117_0005892_2091_3185 363
850 3300048925 Ga0496122_0001050 Ga0496122_0001050_16622_17716 363
851 3300048926 Ga0496123_0000158 Ga0496123_0000158_30626_31720 363
852 3300048928 Ga0496125_0000695 Ga0496125_0000695_39092_40186 363
853 3300048929 Ga0496126_0000195 Ga0496126_0000195_103792_104886 363
854 3300049823 Ga0501044_0107825 Ga0501044_0107825_875_1996 363
855 3300050493 nmdc:mga0k408_78805_c1 nmdc:mga0k408_78805_c1_111_1208 363
856 iso_pu_bacteria 2842694124 2842696952 363
857 3300005289 Ga0065704_10120625 Ga0065704_101206252 364
858 3300026067 Ga0207678_10037727 Ga0207678_100377272 364
859 3300037312 Ga0395899_0000014 Ga0395899_0000014_215974_217071 364
860 3300037418 Ga0395900_0000007 Ga0395900_0000007_215993_217090 364
861 3300037466 Ga0395898_0000011 Ga0395898_0000011_271771_272868 364
862 3300037471 Ga0395905_0000008 Ga0395905_0000008_215993_217090 364
863 3300038443 Ga0395901_0000020 Ga0395901_0000020_42051_43148 364
864 3300049569 Ga0501032_0000587 Ga0501032_0000587_20494_21588 364
865 3300049570 Ga0501033_0062037 Ga0501033_0062037_553_1647 364
866 3300049573 Ga0501037_0000308 Ga0501037_0000308_1794_2888 364
867 3300049579 Ga0501043_0000005 Ga0501043_0000005_34874_35968 364
868 3300049581 Ga0501047_0011466 Ga0501047_0011466_279_1373 364
869 3300049581 Ga0501047_0085213 Ga0501047_0085213_278_1372 364
870 3300049585 Ga0501069_0000011 Ga0501069_0000011_30185_31279 364
871 3300049586 Ga0501070_0000117 Ga0501070_0000117_19836_20930 364
872 3300049586 Ga0501070_0000257 Ga0501070_0000257_475_1569 364
873 3300049586 Ga0501070_0007140 Ga0501070_0007140_7928_9022 364
874 3300049586 Ga0501070_0078602 Ga0501070_0078602_1603_2697 364
875 3300049587 Ga0501071_0005058 Ga0501071_0005058_6326_7420 364
876 3300049589 Ga0501073_0014360 Ga0501073_0014360_3021_4115 364
877 3300049590 Ga0501074_0002555 Ga0501074_0002555_7191_8285 364
878 3300049590 Ga0501074_0068296 Ga0501074_0068296_1015_2109 364
879 3300049742 Ga0501080_0008649 Ga0501080_0008649_983_2077 364
880 3300049742 Ga0501080_0014905 Ga0501080_0014905_568_1662 364
881 3300049744 Ga0501083_0000406 Ga0501083_0000406_12382_13476 364
882 3300049822 Ga0501035_0000107 Ga0501035_0000107_31082_32176 364
883 3300049822 Ga0501035_0001177 Ga0501035_0001177_17447_18541 364
884 3300049822 Ga0501035_0007710 Ga0501035_0007710_7604_8698 364
885 3300049822 Ga0501035_0007999 Ga0501035_0007999_1440_2534 364
886 3300049822 Ga0501035_0016995 Ga0501035_0016995_5106_6200 364
887 3300049822 Ga0501035_0018369 Ga0501035_0018369_4725_5819 364
888 3300049823 Ga0501044_0000154 Ga0501044_0000154_73780_74874 364
889 3300049823 Ga0501044_0011012 Ga0501044_0011012_8309_9403 364
890 3300049823 Ga0501044_0022808 Ga0501044_0022808_3648_4742 364
891 3300049823 Ga0501044_0298174 Ga0501044_0298174_296_1390 364
892 3300001979 JGI24740J21852_10000180 JGI24740J21852_100001808 365
893 3300002704 JGI25155J39150_1000023 JGI25155J39150_100002345 365
894 3300002705 JGI25156J39149_1000029 JGI25156J39149_100002980 365
895 3300002737 JGI25162J39368_1000557 JGI25162J39368_100055716 365
896 3300002737 JGI25162J39368_1000680 JGI25162J39368_100068014 365
897 3300002738 JGI25154J39366_1000067 JGI25154J39366_100006745 365
898 3300002741 JGI25157J39369_1000043 JGI25157J39369_100004382 365
899 3300002741 JGI25157J39369_1002049 JGI25157J39369_10020492 365
900 3300002773 JGI25152J39213_1001989 JGI25152J39213_10019895 365
901 3300002773 JGI25152J39213_1003556 JGI25152J39213_10035564 365
902 3300002773 JGI25152J39213_1007450 JGI25152J39213_10074503 365
903 3300002774 JGI25150J39212_1000635 JGI25150J39212_10006355 365
904 3300002987 JGI25159J45721_1002498 JGI25159J45721_10024983 365
905 3300003187 JGI25151J46595_10006576 JGI25151J46595_100065761 365
906 3300003203 JGI25406J46586_10003471 JGI25406J46586_100034713 365
907 3300003203 JGI25406J46586_10004531 JGI25406J46586_100045317 365
908 3300003214 JGI25165J46597_1000020 JGI25165J46597_100002040 365
909 3300003214 JGI25165J46597_1000341 JGI25165J46597_100034143 365
910 3300003214 JGI25165J46597_1000685 JGI25165J46597_10006858 365
911 3300003214 JGI25165J46597_1002415 JGI25165J46597_10024153 365
912 3300003215 JGI25153J46596_10008486 JGI25153J46596_100084864 365
913 3300003215 JGI25153J46596_10017393 JGI25153J46596_100173933 365
914 3300003215 JGI25153J46596_10017407 JGI25153J46596_100174073 365
915 3300003320 rootH2_10167695 rootH2_101676952 365
916 3300003323 rootH1_10142434 rootH1_101424342 365
917 3300003354 JGI25160J50197_1002474 JGI25160J50197_10024743 365
918 3300003354 JGI25160J50197_1008833 JGI25160J50197_10088334 365
919 3300003374 JGI25161J50226_1000074 JGI25161J50226_100007422 365
920 3300003374 JGI25161J50226_1003864 JGI25161J50226_10038642 365
921 3300003578 Ga0006562J51391_1007706 Ga0006562J51391_10077062 365
922 3300003762 Ga0055542_1000391 Ga0055542_100039134 365
923 3300003763 Ga0055529_1003631 Ga0055529_10036312 365
924 3300003771 Ga0055526_1002163 Ga0055526_10021631 365
925 3300003771 Ga0055526_1003529 Ga0055526_10035295 365
926 3300003771 Ga0055526_1015631 Ga0055526_10156312 365
927 3300003771 Ga0055526_1019861 Ga0055526_10198612 365
928 3300003775 Ga0055524_1005117 Ga0055524_10051175 365
929 3300003775 Ga0055524_1016207 Ga0055524_10162072 365
930 3300003775 Ga0055524_1016318 Ga0055524_10163182 365
931 3300003790 Ga0055528_1000642 Ga0055528_100064211 365
932 3300003790 Ga0055528_1000866 Ga0055528_10008665 365
933 3300003790 Ga0055528_1001522 Ga0055528_10015226 365
934 3300003792 Ga0055540_1002010 Ga0055540_10020102 365
935 3300003856 Ga0058692_1015609 Ga0058692_10156093 365
936 3300004625 Ga0055543_1000141 Ga0055543_10001417 365
937 3300004625 Ga0055543_1001242 Ga0055543_10012427 365
938 3300005262 Ga0065165_1006709 Ga0065165_10067093 365
939 3300005262 Ga0065165_1009515 Ga0065165_10095154 365
940 3300005327 Ga0070658_10057249 Ga0070658_100572493 365
941 3300005339 Ga0070660_100051633 Ga0070660_1000516332 365
942 3300005347 Ga0070668_100203763 Ga0070668_1002037632 365
943 3300005459 Ga0068867_100093470 Ga0068867_1000934702 365
944 3300005539 Ga0068853_100073032 Ga0068853_1000730321 365
945 3300005548 Ga0070665_100003769 Ga0070665_1000037693 365
946 3300005548 Ga0070665_100059986 Ga0070665_1000599863 365
947 3300005548 Ga0070665_100212633 Ga0070665_1002126332 365
948 3300005563 Ga0068855_100336449 Ga0068855_1003364492 365
949 3300005614 Ga0068856_100010830 Ga0068856_1000108306 365
950 3300005834 Ga0068851_10013108 Ga0068851_100131084 365
951 3300005983 Ga0081540_1008678 Ga0081540_10086785 365
952 3300005985 Ga0081539_10000881 Ga0081539_1000088144 365
953 3300006038 Ga0075365_10003480 Ga0075365_100034801 365
954 3300006038 Ga0075365_10009006 Ga0075365_100090064 365
955 3300006038 Ga0075365_10031740 Ga0075365_100317402 365
956 3300006038 Ga0075365_10065914 Ga0075365_100659142 365
957 3300006038 Ga0075365_10066519 Ga0075365_100665192 365
958 3300006048 Ga0075363_100010408 Ga0075363_1000104083 365
959 3300006048 Ga0075363_100033536 Ga0075363_1000335362 365
960 3300006051 Ga0075364_10148354 Ga0075364_101483542 365
961 3300006177 Ga0075362_10041002 Ga0075362_100410022 365
962 3300006177 Ga0075362_10055641 Ga0075362_100556412 365
963 3300006178 Ga0075367_10045438 Ga0075367_100454383 365
964 3300006186 Ga0075369_10008616 Ga0075369_100086163 365
965 3300006353 Ga0075370_10013935 Ga0075370_100139353 365
966 3300006353 Ga0075370_10014582 Ga0075370_100145822 365
967 3300006353 Ga0075370_10038960 Ga0075370_100389602 365
968 3300006353 Ga0075370_10103900 Ga0075370_101039001 365
969 3300009093 Ga0105240_10000278 Ga0105240_1000027823 365
970 3300009093 Ga0105240_10167846 Ga0105240_101678462 365
971 3300009545 Ga0105237_10000434 Ga0105237_1000043410 365
972 3300009551 Ga0105238_10016156 Ga0105238_100161565 365
973 3300009765 Ga0123341_1004338 Ga0123341_10043383 365
974 3300010375 Ga0105239_10011555 Ga0105239_100115551 365
975 3300013104 Ga0157370_10001667 Ga0157370_100016672 365
976 3300013104 Ga0157370_10058384 Ga0157370_100583842 365
977 3300013105 Ga0157369_10110027 Ga0157369_101100272 365
978 3300013105 Ga0157369_10119777 Ga0157369_101197772 365
979 3300013306 Ga0163162_10438769 Ga0163162_104387691 365
980 3300014497 Ga0182008_10027793 Ga0182008_100277932 365
981 3300014497 Ga0182008_10056897 Ga0182008_100568972 365
982 3300015262 Ga0182007_10000762 Ga0182007_100007629 365
983 3300025206 Ga0209435_100011 Ga0209435_100011330 365
984 3300025208 Ga0209436_100429 Ga0209436_1004296 365
985 3300025233 Ga0209437_100036 Ga0209437_10003624 365
986 3300025233 Ga0209437_100086 Ga0209437_100086227 365
987 3300025233 Ga0209437_103627 Ga0209437_1036272 365
988 3300025245 Ga0207425_1000750 Ga0207425_100075014 365
989 3300025245 Ga0207425_1007797 Ga0207425_10077972 365
990 3300025245 Ga0207425_1010337 Ga0207425_10103372 365
991 3300025246 Ga0209646_1000024 Ga0209646_100002480 365
992 3300025246 Ga0209646_1008094 Ga0209646_10080942 365
993 3300025250 Ga0209026_1000030 Ga0209026_100003080 365
994 3300025250 Ga0209026_1000116 Ga0209026_100011658 365
995 3300025253 Ga0209677_101433 Ga0209677_1014336 365
996 3300025254 Ga0209148_1000256 Ga0209148_100025614 365
997 3300025254 Ga0209148_1004346 Ga0209148_10043464 365
998 3300025254 Ga0209148_1013386 Ga0209148_10133862 365
999 3300025256 Ga0209759_1000011 Ga0209759_1000011330 365
1000 3300025256 Ga0209759_1000153 Ga0209759_100015366 365
1001 3300025258 Ga0209129_1000123 Ga0209129_100012349 365
1002 3300025258 Ga0209129_1000726 Ga0209129_10007267 365
1003 3300025258 Ga0209129_1002322 Ga0209129_10023225 365
1004 3300025258 Ga0209129_1005158 Ga0209129_10051583 365
1005 3300025261 Ga0209233_1000047 Ga0209233_1000047294 365
1006 3300025261 Ga0209233_1000110 Ga0209233_100011023 365
1007 3300025261 Ga0209233_1000166 Ga0209233_100016624 365
1008 3300025261 Ga0209233_1000356 Ga0209233_100035616 365
1009 3300025261 Ga0209233_1003452 Ga0209233_10034522 365
1010 3300025272 Ga0209455_1000409 Ga0209455_100040916 365
1011 3300025272 Ga0209455_1012913 Ga0209455_10129132 365
1012 3300025273 Ga0209673_1000015 Ga0209673_1000015365 365
1013 3300025273 Ga0209673_1000967 Ga0209673_100096711 365
1014 3300025273 Ga0209673_1001964 Ga0209673_10019648 365
1015 3300025284 Ga0209130_1000002 Ga0209130_100000260 365
1016 3300025284 Ga0209130_1009737 Ga0209130_10097373 365
1017 3300025292 Ga0209676_1027295 Ga0209676_10272951 365
1018 3300025294 Ga0209025_1000970 Ga0209025_10009706 365
1019 3300025294 Ga0209025_1003049 Ga0209025_10030497 365
1020 3300025294 Ga0209025_1003063 Ga0209025_10030631 365
1021 3300025294 Ga0209025_1007670 Ga0209025_10076702 365
1022 3300025294 Ga0209025_1040430 Ga0209025_10404302 365
1023 3300025295 Ga0209564_1000382 Ga0209564_100038268 365
1024 3300025295 Ga0209564_1000830 Ga0209564_100083028 365
1025 3300025295 Ga0209564_1001931 Ga0209564_10019317 365
1026 3300025297 Ga0209758_1001048 Ga0209758_100104817 365
1027 3300025297 Ga0209758_1001962 Ga0209758_100196214 365
1028 3300025297 Ga0209758_1002450 Ga0209758_10024504 365
1029 3300025297 Ga0209758_1002458 Ga0209758_100245815 365
1030 3300025297 Ga0209758_1002490 Ga0209758_10024903 365
1031 3300025297 Ga0209758_1036814 Ga0209758_10368141 365
1032 3300025299 Ga0209256_1000874 Ga0209256_100087422 365
1033 3300025299 Ga0209256_1001340 Ga0209256_100134021 365
1034 3300025299 Ga0209256_1004894 Ga0209256_10048943 365
1035 3300025299 Ga0209256_1005494 Ga0209256_10054945 365
1036 3300025302 Ga0207426_1000013 Ga0207426_100001360 365
1037 3300025302 Ga0207426_1000063 Ga0207426_1000063227 365
1038 3300025302 Ga0207426_1000172 Ga0207426_1000172108 365
1039 3300025303 Ga0209051_1002801 Ga0209051_10028017 365
1040 3300025321 Ga0207656_10008887 Ga0207656_100088874 365
1041 3300025913 Ga0207695_10000376 Ga0207695_1000037623 365
1042 3300025913 Ga0207695_10067857 Ga0207695_100678572 365
1043 3300025914 Ga0207671_10000275 Ga0207671_1000027540 365
1044 3300025919 Ga0207657_10116920 Ga0207657_101169201 365
1045 3300025924 Ga0207694_10008988 Ga0207694_100089885 365
1046 3300025981 Ga0207640_10084026 Ga0207640_100840261 365
1047 3300025981 Ga0207640_10098195 Ga0207640_100981952 365
1048 3300026041 Ga0207639_10043324 Ga0207639_100433242 365
1049 3300026078 Ga0207702_10445509 Ga0207702_104455091 365
1050 3300026089 Ga0207648_10061347 Ga0207648_100613472 365
1051 3300026116 Ga0207674_10107995 Ga0207674_101079952 365
1052 3300026118 Ga0207675_100232527 Ga0207675_1002325272 365
1053 3300027312 Ga0209371_1001452 Ga0209371_100145212 365
1054 3300028379 Ga0268266_10003101 Ga0268266_1000310112 365
1055 3300028379 Ga0268266_10187777 Ga0268266_101877772 365
1056 3300028379 Ga0268266_10336810 Ga0268266_103368101 365
1057 3300028794 Ga0307515_10000023 Ga0307515_10000023130 365
1058 3300030500 Ga0268256_1006875 Ga0268256_10068752 365
1059 3300031548 Ga0307408_100069522 Ga0307408_1000695221 365
1060 3300031911 Ga0307412_10001804 Ga0307412_100018042 365
1061 3300031911 Ga0307412_10046244 Ga0307412_100462443 365
1062 3300037418 Ga0395900_0017694 Ga0395900_0017694_3533_4630 365
1063 3300037418 Ga0395900_0275262 Ga0395900_0275262_564_1661 365
1064 3300037471 Ga0395905_0011842 Ga0395905_0011842_5281_6378 365
1065 3300037471 Ga0395905_0015664 Ga0395905_0015664_3466_4563 365
1066 3300037471 Ga0395905_0049624 Ga0395905_0049624_53_1150 365
1067 3300038443 Ga0395901_0081410 Ga0395901_0081410_2014_3111 365
1068 3300038443 Ga0395901_0253945 Ga0395901_0253945_329_1426 365
1069 3300041509 Ga0451843_1400191 Ga0451843_1400191_121_1218 365
1070 3300041511 Ga0451855_0701739 Ga0451855_0701739_533_1630 365
1071 3300042157 Ga0439458_0006590 Ga0439458_0006590_266_1363 365
1072 3300044658 Ga0466972_0018212 Ga0466972_0018212_2353_3450 365
1073 3300044901 Ga0466960_0003639 Ga0466960_0003639_294_1391 365
1074 3300046460 Ga0495638_0000772 Ga0495638_0000772_18101_19198 365
1075 3300046460 Ga0495638_0079723 Ga0495638_0079723_630_1727 365
1076 3300046474 Ga0495605_0001663 Ga0495605_0001663_10924_12021 365
1077 3300046476 Ga0495662_0013599 Ga0495662_0013599_902_1999 365
1078 3300046492 Ga0495585_0008254 Ga0495585_0008254_1256_2353 365
1079 3300046501 Ga0495607_0015274 Ga0495607_0015274_2203_3300 365
1080 3300046507 Ga0495606_0001322 Ga0495606_0001322_7940_9040 365
1081 3300046507 Ga0495606_0013621 Ga0495606_0013621_5107_6204 365
1082 3300046513 Ga0495616_0010216 Ga0495616_0010216_1326_2423 365
1083 3300046515 Ga0495620_0007293 Ga0495620_0007293_3422_4519 365
1084 3300046518 Ga0495631_0000651 Ga0495631_0000651_4521_5618 365
1085 3300046519 Ga0495632_0019147 Ga0495632_0019147_2203_3300 365
1086 3300046519 Ga0495632_0034796 Ga0495632_0034796_1233_2330 365
1087 3300046522 Ga0495643_0032859 Ga0495643_0032859_1510_2607 365
1088 3300046524 Ga0495648_0090525 Ga0495648_0090525_180_1277 365
1089 3300046538 Ga0495609_0031053 Ga0495609_0031053_603_1700 365
1090 3300046557 Ga0495622_0007907 Ga0495622_0007907_1940_3037 365
1091 3300046616 Ga0495668_0003355 Ga0495668_0003355_42_1139 365
1092 3300046616 Ga0495668_0096449 Ga0495668_0096449_177_1274 365
1093 3300046648 Ga0495611_0033549 Ga0495611_0033549_738_1835 365
1094 3300046660 Ga0495625_0001384 Ga0495625_0001384_12856_13953 365
1095 3300046660 Ga0495625_0030489 Ga0495625_0030489_1948_3207 365
1096 3300046675 Ga0495657_0018360 Ga0495657_0018360_393_1490 365
1097 3300046691 Ga0495670_0014513 Ga0495670_0014513_580_1677 365
1098 3300046809 Ga0495600_0033509 Ga0495600_0033509_1931_3028 365
1099 3300046810 Ga0495660_0113315 Ga0495660_0113315_130_1227 365
1100 3300047470 Ga0495681_0096774 Ga0495681_0096774_100_1197 365
1101 3300048905 Ga0496102_0035097 Ga0496102_0035097_1652_2749 365
1102 3300048906 Ga0496103_0010778 Ga0496103_0010778_1438_2535 365
1103 3300048909 Ga0496106_0010917 Ga0496106_0010917_3786_4883 365
1104 3300048915 Ga0496112_0025119 Ga0496112_0025119_619_1716 365
1105 3300048919 Ga0496116_0001443 Ga0496116_0001443_13643_14740 365
1106 3300048919 Ga0496116_0125996 Ga0496116_0125996_55_1152 365
1107 3300048920 Ga0496117_0006167 Ga0496117_0006167_3005_4102 365
1108 3300048920 Ga0496117_0023955 Ga0496117_0023955_1937_3034 365
1109 3300048921 Ga0496118_0003378 Ga0496118_0003378_8571_9668 365
1110 3300048921 Ga0496118_0007687 Ga0496118_0007687_2054_3151 365
1111 3300048921 Ga0496118_0027397 Ga0496118_0027397_31_1128 365
1112 3300048921 Ga0496118_0029672 Ga0496118_0029672_1258_2355 365
1113 3300048921 Ga0496118_0140862 Ga0496118_0140862_412_1512 365
1114 3300048922 Ga0496119_0051532 Ga0496119_0051532_218_1315 365
1115 3300048922 Ga0496119_0064133 Ga0496119_0064133_157_1254 365
1116 3300048922 Ga0496119_0080104 Ga0496119_0080104_721_1818 365
1117 3300048923 Ga0496120_0006068 Ga0496120_0006068_157_1254 365
1118 3300048923 Ga0496120_0012424 Ga0496120_0012424_1572_2672 365
1119 3300048923 Ga0496120_0015857 Ga0496120_0015857_99_1196 365
1120 3300048923 Ga0496120_0100482 Ga0496120_0100482_85_1182 365
1121 3300048924 Ga0496121_0007378 Ga0496121_0007378_1908_3005 365
1122 3300048924 Ga0496121_0020629 Ga0496121_0020629_4803_5900 365
1123 3300048924 Ga0496121_0050316 Ga0496121_0050316_319_1416 365
1124 3300048924 Ga0496121_0052389 Ga0496121_0052389_107_1204 365
1125 3300048925 Ga0496122_0008742 Ga0496122_0008742_227_1324 365
1126 3300048925 Ga0496122_0024992 Ga0496122_0024992_2566_3663 365
1127 3300048926 Ga0496123_0016492 Ga0496123_0016492_4026_5141 365
1128 3300048926 Ga0496123_0021281 Ga0496123_0021281_2321_3418 365
1129 3300048926 Ga0496123_0035458 Ga0496123_0035458_706_1803 365
1130 3300048926 Ga0496123_0049706 Ga0496123_0049706_554_1651 365
1131 3300048927 Ga0496124_0067811 Ga0496124_0067811_1742_2839 365
1132 3300048927 Ga0496124_0068758 Ga0496124_0068758_1778_2875 365
1133 3300048928 Ga0496125_0013510 Ga0496125_0013510_581_1678 365
1134 3300048928 Ga0496125_0086900 Ga0496125_0086900_573_1670 365
1135 3300048929 Ga0496126_0155151 Ga0496126_0155151_78_1175 365
1136 3300048929 Ga0496126_0183862 Ga0496126_0183862_410_1507 365
1137 3300048929 Ga0496126_0274037 Ga0496126_0274037_164_1261 365
1138 3300049568 Ga0501031_0000003 Ga0501031_0000003_108058_109155 365
1139 3300049569 Ga0501032_0000010 Ga0501032_0000010_108058_109155 365
1140 3300049569 Ga0501032_0012946 Ga0501032_0012946_4112_5209 365
1141 3300049570 Ga0501033_0000017 Ga0501033_0000017_108058_109155 365
1142 3300049570 Ga0501033_0001157 Ga0501033_0001157_2804_3901 365
1143 3300049570 Ga0501033_0010015 Ga0501033_0010015_5362_6459 365
1144 3300049571 Ga0501034_0000053 Ga0501034_0000053_97667_98764 365
1145 3300049571 Ga0501034_0008667 Ga0501034_0008667_5505_6605 365
1146 3300049571 Ga0501034_0009703 Ga0501034_0009703_5340_6437 365
1147 3300049572 Ga0501036_0000009 Ga0501036_0000009_108058_109155 365
1148 3300049572 Ga0501036_0041505 Ga0501036_0041505_1887_2984 365
1149 3300049572 Ga0501036_0229110 Ga0501036_0229110_378_1502 365
1150 3300049573 Ga0501037_0000008 Ga0501037_0000008_97658_98755 365
1151 3300049573 Ga0501037_0002684 Ga0501037_0002684_8368_9465 365
1152 3300049574 Ga0501038_0000008 Ga0501038_0000008_97667_98764 365
1153 3300049574 Ga0501038_0045427 Ga0501038_0045427_1122_2219 365
1154 3300049575 Ga0501039_0000021 Ga0501039_0000021_63789_64886 365
1155 3300049575 Ga0501039_0020847 Ga0501039_0020847_2981_4078 365
1156 3300049576 Ga0501040_0003914 Ga0501040_0003914_5643_6740 365
1157 3300049578 Ga0501042_0011075 Ga0501042_0011075_151_1248 365
1158 3300049579 Ga0501043_0000405 Ga0501043_0000405_25122_26219 365
1159 3300049579 Ga0501043_0012619 Ga0501043_0012619_2810_3907 365
1160 3300049579 Ga0501043_0085082 Ga0501043_0085082_630_1754 365
1161 3300049579 Ga0501043_0123547 Ga0501043_0123547_276_1376 365
1162 3300049580 Ga0501046_0001156 Ga0501046_0001156_2125_3249 365
1163 3300049580 Ga0501046_0004239 Ga0501046_0004239_1876_2988 365
1164 3300049580 Ga0501046_0008611 Ga0501046_0008611_5340_6437 365
1165 3300049580 Ga0501046_0060132 Ga0501046_0060132_1803_2900 365
1166 3300049581 Ga0501047_0000129 Ga0501047_0000129_81769_82893 365
1167 3300049581 Ga0501047_0000894 Ga0501047_0000894_4400_5497 365
1168 3300049581 Ga0501047_0020856 Ga0501047_0020856_4279_5376 365
1169 3300049581 Ga0501047_0078666 Ga0501047_0078666_1732_2829 365
1170 3300049581 Ga0501047_0253312 Ga0501047_0253312_31_1128 365
1171 3300049582 Ga0501048_0012224 Ga0501048_0012224_3267_4364 365
1172 3300049583 Ga0501067_0000213 Ga0501067_0000213_27339_28463 365
1173 3300049584 Ga0501068_0006475 Ga0501068_0006475_3292_4389 365
1174 3300049587 Ga0501071_0017921 Ga0501071_0017921_3684_4781 365
1175 3300049589 Ga0501073_0011311 Ga0501073_0011311_2170_3294 365
1176 3300049589 Ga0501073_0187298 Ga0501073_0187298_280_1377 365
1177 3300049742 Ga0501080_0000053 Ga0501080_0000053_2603_3727 365
1178 3300049742 Ga0501080_0018259 Ga0501080_0018259_4573_5670 365
1179 3300049742 Ga0501080_0089986 Ga0501080_0089986_1527_2624 365
1180 3300049744 Ga0501083_0037026 Ga0501083_0037026_1827_2924 365
1181 3300049744 Ga0501083_0072873 Ga0501083_0072873_528_1625 365
1182 3300049744 Ga0501083_0075699 Ga0501083_0075699_1098_2195 365
1183 3300049822 Ga0501035_0000010 Ga0501035_0000010_175881_177005 365
1184 3300049822 Ga0501035_0000023 Ga0501035_0000023_108058_109155 365
1185 3300049822 Ga0501035_0003419 Ga0501035_0003419_10428_11525 365
1186 3300049822 Ga0501035_0003519 Ga0501035_0003519_11767_12864 365
1187 3300049822 Ga0501035_0087384 Ga0501035_0087384_386_1483 365
1188 3300049823 Ga0501044_0000006 Ga0501044_0000006_36229_37353 365
1189 3300049823 Ga0501044_0000021 Ga0501044_0000021_97667_98764 365
1190 3300049823 Ga0501044_0094043 Ga0501044_0094043_343_1440 365
1191 3300049824 Ga0501045_0007088 Ga0501045_0007088_2328_3425 365
1192 3300050490 nmdc:mga03n38_3995_c1 nmdc:mga03n38_3995_c1_3091_4188 365
1193 3300050490 nmdc:mga03n38_66181_c1 nmdc:mga03n38_66181_c1_388_1485 365
1194 3300050491 nmdc:mga00v17_4395_c2 nmdc:mga00v17_4395_c2_125_1222 365
1195 3300050492 nmdc:mga0yw44_1917_c1 nmdc:mga0yw44_1917_c1_1160_2257 365
1196 3300050492 nmdc:mga0yw44_81672_c1 nmdc:mga0yw44_81672_c1_633_1730 365
1197 3300050494 nmdc:mga06z11_32904_c1 nmdc:mga06z11_32904_c1_1380_2477 365
1198 3300050496 nmdc:mga07m45_19408_c1 nmdc:mga07m45_19408_c1_1034_2131 365
1199 3300050516 nmdc:mga0sz30_11121_c2 nmdc:mga0sz30_11121_c2_989_2086 365
1200 3300053085 Ga0495619_0009320 Ga0495619_0009320_4788_5885 365
1201 3300053088 Ga0500644_0017467 Ga0500644_0017467_907_2004 365
1202 3300053125 Ga0500618_008275 Ga0500618_008275_143_1240 365
1203 3300053134 Ga0500658_0050408 Ga0500658_0050408_145_1242 365
1204 3300053139 Ga0500568_0000205 Ga0500568_0000205_23522_24622 365
1205 3300053139 Ga0500568_0000924 Ga0500568_0000924_1990_3087 365
1206 3300053139 Ga0500568_0014156 Ga0500568_0014156_744_1841 365
1207 3300053139 Ga0500568_0026797 Ga0500568_0026797_380_1477 365
1208 3300053148 Ga0500590_021587 Ga0500590_021587_2223_3320 365
1209 3300053151 Ga0500604_0021191 Ga0500604_0021191_196_1344 365
1210 3300053153 Ga0500616_0002449 Ga0500616_0002449_8592_9689 365
1211 3300053153 Ga0500616_0017030 Ga0500616_0017030_2979_4076 365
1212 3300053155 Ga0500620_002469 Ga0500620_002469_1767_3119 365
1213 3300053156 Ga0500622_0001035 Ga0500622_0001035_15454_16551 365
1214 3300053158 Ga0500627_0059509 Ga0500627_0059509_134_1327 365
1215 3300059492 Ga0587073_0016407 Ga0587073_0016407_245_1342 365
1216 3300059605 Ga0587106_002538 Ga0587106_002538_181_1278 365
1217 3300060353 Ga0501082_0013933 Ga0501082_0013933_2169_3293 365
1218 3300060353 Ga0501082_0046054 Ga0501082_0046054_2013_3110 365
1219 iso_pu_bacteria 2977942078 2977947363 365
1220 iso_pu_bacteria 8054563764 8054568923 365

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

48

337

0.85

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

83

343

0.81

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

39

306

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oyt-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88l in complex with spermidine 0.9731 27 364
7oys-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s in complex with spermidine 0.973 25 364
7oyu-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s f88y in complex with spermidine 0.9719 27 364
7oyy-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutation s247d in complex with spermidine 0.9718 25 364
7oyz-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d in complex with spermidine 0.9694 27 364
ID Description Score Start End Superfamily
af_P31133_32_136_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9766 29 133 3.40.190.10
af_P31133_32_136_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9675 29 133 3.40.190.10
4gl0A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9541 27 331 3.40.190.10
3ttnB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9521 133 360 3.40.190.10
af_Q2G2A8_37_140_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9514 29 134 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A5R2MU04-F1-model_v4 Spermidine/putrescine ABC transporter substrate-binding protein PotF 0.9877 158 255 GO:0015846
GO:0019808
GO:0042597
AF-A0A530N1C4-F1-model_v4 deleted 0.9874 24 346
AF-A0A2N3AV69-F1-model_v4 Spermidine/putrescine ABC transporter substrate-binding protein PotF 0.9844 43 365 GO:0015846
GO:0019808
GO:0042597
AF-A0A2M7Y8B4-F1-model_v4 Spermidine/putrescine ABC transporter substrate-binding protein PotF 0.9835 98 365 GO:0015846
GO:0019808
GO:0042597
AF-A0A530N1C4-F1-model_v4 deleted 0.9814 24 346

Feature Viewer

pLDDT pTM Quality
90.72 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map