F491842

General Info

Members Datasets Scaffolds Average Seq Length
1220 275 2440 105

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0223000|Ga0395899_0223000_218_607
Length 129
Sequence MRAWTDHSRAARVEKHGRSADIANMSQPIDVDLPHNLGKDEARRRIANNVHKLEEHIPGGARVQSGWTGDQLNLQIAAMGEAVNATIDVQDTKVHLKVLLPGMLGMFSGMVQAALQKKGSVLLEDHSKG

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
188 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
194 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
206 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
207 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
208 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
209 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
210 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
211 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
212 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
213 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
217 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
226 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
227 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
230 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
231 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
232 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
236 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
237 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
238 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
239 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
240 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
258 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
259 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
260 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
261 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
262 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
263 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
264 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
265 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
266 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
267 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
268 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
269 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
270 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
271 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
272 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
273 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
274 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.92
Metatranscriptomes 0.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 4.59
Rhizosphere 95.08
Stem 0
Stem Tuber 0
Unclassified 6.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0223000 3300037312 Unclassified 1305
2 JGI24736J21556_1004722 3300001904 Bacteria 2317
3 JGI24741J21665_1046452 3300001915 Bacteria 639
4 JGI24746J21847_1017168 3300001977 Bacteria 1029
5 JGI24747J21853_1033856 3300001978 Bacteria 591
6 JGI24740J21852_10010055 3300001979 Bacteria 3664
7 JGI24740J21852_10010350 3300001979 Bacteria 3601
8 JGI24740J21852_10039731 3300001979 Bacteria 1432
9 JGI24740J21852_10061802 3300001979 Bacteria 1030
10 JGI24740J21852_10130720 3300001979 Unclassified 627
11 JGI24740J21852_10156182 3300001979 Unclassified 566
12 JGI24739J22299_10051984 3300001989 Bacteria 1319
13 JGI24739J22299_10106244 3300001989 Bacteria 845
14 JGI24739J22299_10176764 3300001989 Bacteria 629
15 JGI24739J22299_10238995 3300001989 Unclassified 532
16 JGI24737J22298_10000566 3300001990 Bacteria 12990
17 JGI24737J22298_10005431 3300001990 Bacteria 4401
18 JGI24737J22298_10036727 3300001990 Bacteria 1512
19 JGI24737J22298_10153272 3300001990 Bacteria 680
20 JGI24737J22298_10174141 3300001990 Bacteria 635
21 JGI24743J22301_10077922 3300001991 Bacteria 697
22 JGI24743J22301_10104657 3300001991 Bacteria 611
23 JGI24735J21928_10017310 3300002067 Bacteria 2230
24 JGI24735J21928_10042794 3300002067 Bacteria 1318
25 JGI24735J21928_10135016 3300002067 Bacteria 712
26 JGI24735J21928_10166916 3300002067 Bacteria 636
27 JGI24735J21928_10173315 3300002067 Bacteria 624
28 JGI24735J21928_10192402 3300002067 Unclassified 591
29 JGI24750J21931_1046651 3300002070 Bacteria 668
30 JGI24745J21846_1004912 3300002073 Bacteria 1444
31 JGI24738J21930_10007870 3300002075 Bacteria 2441
32 JGI24738J21930_10115434 3300002075 Bacteria 580
33 JGI24744J21845_10001038 3300002077 Bacteria 5344
34 JGI24742J22300_10115361 3300002244 Bacteria 527
35 JGI24751J29686_10044481 3300002459 Bacteria 918
36 Ga0065712_10366519 3300005290 Bacteria 768
37 Ga0065712_10564523 3300005290 Bacteria 610
38 Ga0065715_10113151 3300005293 Bacteria 2501
39 Ga0070658_10012287 3300005327 Bacteria 6875
40 Ga0070658_10043030 3300005327 Bacteria 3649
41 Ga0070658_10085977 3300005327 Bacteria 2586
42 Ga0070658_10111834 3300005327 Bacteria 2263
43 Ga0070658_10190715 3300005327 Bacteria 1727
44 Ga0070658_10235694 3300005327 Bacteria 1550
45 Ga0070658_10246127 3300005327 Bacteria 1516
46 Ga0070658_10625655 3300005327 Bacteria 934
47 Ga0070658_10629675 3300005327 Bacteria 930
48 Ga0070658_10660029 3300005327 Bacteria 907
49 Ga0070658_10780882 3300005327 Unclassified 830
50 Ga0070676_10056606 3300005328 Bacteria 2317
51 Ga0070676_10167691 3300005328 Bacteria 1418
52 Ga0070676_10577231 3300005328 Unclassified 808
53 Ga0070676_10635875 3300005328 Bacteria 773
54 Ga0070676_10830041 3300005328 Bacteria 684
55 Ga0070683_100065398 3300005329 Bacteria 3386
56 Ga0070683_100112894 3300005329 Bacteria 2564
57 Ga0070683_100304436 3300005329 Bacteria 1516
58 Ga0070683_100620877 3300005329 Unclassified 1035
59 Ga0070683_101331524 3300005329 Bacteria 690
60 Ga0070690_100017691 3300005330 Bacteria 4292
61 Ga0070690_100037331 3300005330 Bacteria 3061
62 Ga0070690_100317922 3300005330 Bacteria 1121
63 Ga0070690_100659722 3300005330 Unclassified 800
64 Ga0070690_101170355 3300005330 Bacteria 612
65 Ga0070670_100013782 3300005331 Bacteria 6928
66 Ga0070670_100028376 3300005331 Bacteria 4816
67 Ga0070670_100078428 3300005331 Bacteria 2837
68 Ga0070670_100360553 3300005331 Bacteria 1278
69 Ga0070670_100487701 3300005331 Bacteria 1095
70 Ga0070670_100488410 3300005331 Bacteria 1094
71 Ga0070670_100954247 3300005331 Bacteria 779
72 Ga0070670_101001706 3300005331 Unclassified 760
73 Ga0070670_101621391 3300005331 Bacteria 595
74 Ga0070677_10006803 3300005333 Bacteria 3801
75 Ga0070677_10178205 3300005333 Bacteria 1010
76 Ga0068869_100112064 3300005334 Bacteria 2076
77 Ga0070666_10000175 3300005335 Bacteria 43927
78 Ga0070666_10037876 3300005335 Bacteria 3208
79 Ga0070666_10044867 3300005335 Bacteria 2963
80 Ga0070666_10048254 3300005335 Bacteria 2861
81 Ga0070666_10120918 3300005335 Bacteria 1816
82 Ga0070666_10259447 3300005335 Unclassified 1232
83 Ga0070666_10374747 3300005335 Bacteria 1021
84 Ga0070680_100001497 3300005336 Bacteria 16999
85 Ga0070680_100004504 3300005336 Bacteria 10494
86 Ga0070680_100005002 3300005336 Bacteria 9989
87 Ga0070680_100070158 3300005336 Bacteria 2878
88 Ga0070680_100086601 3300005336 Bacteria 2589
89 Ga0070680_100139055 3300005336 Bacteria 2036
90 Ga0070680_100150638 3300005336 Bacteria 1953
91 Ga0070680_100567149 3300005336 Bacteria 973
92 Ga0070682_100033548 3300005337 Bacteria 3120
93 Ga0070682_100540579 3300005337 Bacteria 910
94 Ga0070682_102009184 3300005337 Bacteria 509
95 Ga0068868_100005026 3300005338 Bacteria 9288
96 Ga0068868_100136639 3300005338 Bacteria 2010
97 Ga0068868_100171652 3300005338 Bacteria 1795
98 Ga0068868_100260322 3300005338 Bacteria 1462
99 Ga0068868_100311361 3300005338 Bacteria 1339
100 Ga0068868_100435091 3300005338 Bacteria 1138
101 Ga0068868_100514905 3300005338 Bacteria 1050
102 Ga0070660_100002929 3300005339 Bacteria 11747
103 Ga0070660_100004849 3300005339 Bacteria 9291
104 Ga0070660_100010107 3300005339 Bacteria 6658
105 Ga0070660_100069281 3300005339 Bacteria 2750
106 Ga0070660_100072533 3300005339 Bacteria 2691
107 Ga0070660_100153990 3300005339 Bacteria 1850
108 Ga0070660_100198345 3300005339 Bacteria 1627
109 Ga0070660_100221499 3300005339 Bacteria 1538
110 Ga0070660_100247369 3300005339 Bacteria 1453
111 Ga0070660_100474933 3300005339 Bacteria 1039
112 Ga0070660_101936629 3300005339 Unclassified 502
113 Ga0070689_100685167 3300005340 Bacteria 894
114 Ga0070691_10007681 3300005341 Bacteria 4943
115 Ga0070687_100078455 3300005343 Bacteria 1795
116 Ga0070687_100172350 3300005343 Bacteria 1289
117 Ga0070687_100740959 3300005343 Unclassified 690
118 Ga0070661_100025857 3300005344 Bacteria 4219
119 Ga0070661_100031729 3300005344 Bacteria 3821
120 Ga0070661_100042821 3300005344 Bacteria 3306
121 Ga0070661_100081680 3300005344 Bacteria 2386
122 Ga0070661_100085386 3300005344 Bacteria 2332
123 Ga0070661_100110185 3300005344 Bacteria 2055
124 Ga0070661_100186719 3300005344 Bacteria 1579
125 Ga0070661_100330324 3300005344 Bacteria 1192
126 Ga0070661_100487128 3300005344 Bacteria 985
127 Ga0070661_100498135 3300005344 Bacteria 975
128 Ga0070661_101213789 3300005344 Unclassified 631
129 Ga0070661_101223586 3300005344 Bacteria 628
130 Ga0070661_101601629 3300005344 Unclassified 551
131 Ga0070692_10084473 3300005345 Bacteria 1716
132 Ga0070692_10406321 3300005345 Bacteria 861
133 Ga0070692_11381476 3300005345 Unclassified 508
134 Ga0070668_100154730 3300005347 Bacteria 1857
135 Ga0070668_101362690 3300005347 Bacteria 646
136 Ga0070669_100344238 3300005353 Bacteria 1209
137 Ga0070669_101521364 3300005353 Bacteria 582
138 Ga0070675_100029277 3300005354 Bacteria 4440
139 Ga0070675_100060523 3300005354 Bacteria 3126
140 Ga0070675_100144809 3300005354 Bacteria 2033
141 Ga0070675_100617440 3300005354 Bacteria 984
142 Ga0070675_100618675 3300005354 Bacteria 983
143 Ga0070671_100033713 3300005355 Bacteria 4237
144 Ga0070671_100036368 3300005355 Bacteria 4083
145 Ga0070671_100041538 3300005355 Bacteria 3822
146 Ga0070671_100061904 3300005355 Bacteria 3116
147 Ga0070671_100079204 3300005355 Bacteria 2746
148 Ga0070671_100082985 3300005355 Bacteria 2680
149 Ga0070671_100165891 3300005355 Bacteria 1867
150 Ga0070671_100188263 3300005355 Bacteria 1749
151 Ga0070671_100585105 3300005355 Bacteria 964
152 Ga0070671_100718102 3300005355 Bacteria 867
153 Ga0070671_100805933 3300005355 Bacteria 818
154 Ga0070671_100863584 3300005355 Bacteria 789
155 Ga0070671_101006124 3300005355 Bacteria 730
156 Ga0070674_100001005 3300005356 Bacteria 14717
157 Ga0070674_100002384 3300005356 Bacteria 10386
158 Ga0070674_100003417 3300005356 Bacteria 8907
159 Ga0070674_100190704 3300005356 Bacteria 1577
160 Ga0070674_100274456 3300005356 Bacteria 1334
161 Ga0070674_100391767 3300005356 Bacteria 1133
162 Ga0070674_101092441 3300005356 Bacteria 704
163 Ga0070673_100018889 3300005364 Bacteria 4940
164 Ga0070673_100024881 3300005364 Bacteria 4396
165 Ga0070673_100064594 3300005364 Bacteria 2917
166 Ga0070673_100136180 3300005364 Bacteria 2067
167 Ga0070673_100297020 3300005364 Bacteria 1421
168 Ga0070673_100334026 3300005364 Bacteria 1341
169 Ga0070673_100552076 3300005364 Bacteria 1046
170 Ga0070673_100854552 3300005364 Bacteria 842
171 Ga0070673_100945142 3300005364 Bacteria 801
172 Ga0070673_101822685 3300005364 Unclassified 576
173 Ga0070659_100000992 3300005366 Bacteria 20821
174 Ga0070659_100060638 3300005366 Bacteria 2988
175 Ga0070659_100065109 3300005366 Bacteria 2886
176 Ga0070659_100096717 3300005366 Bacteria 2372
177 Ga0070659_100132528 3300005366 Bacteria 2025
178 Ga0070659_100271439 3300005366 Bacteria 1409
179 Ga0070659_100285564 3300005366 Bacteria 1373
180 Ga0070659_101513816 3300005366 Bacteria 598
181 Ga0070659_101627988 3300005366 Unclassified 577
182 Ga0070667_100001408 3300005367 Bacteria 21504
183 Ga0070667_100003855 3300005367 Bacteria 12735
184 Ga0070667_100037678 3300005367 Bacteria 4053
185 Ga0070667_100058269 3300005367 Bacteria 3266
186 Ga0070667_100130200 3300005367 Bacteria 2195
187 Ga0070667_100380743 3300005367 Bacteria 1282
188 Ga0070667_100619459 3300005367 Bacteria 998
189 Ga0070709_10092207 3300005434 Bacteria 2000
190 Ga0070709_10666154 3300005434 Bacteria 807
191 Ga0070714_100021525 3300005435 Bacteria 5276
192 Ga0070714_100152872 3300005435 Bacteria 2081
193 Ga0070714_100212103 3300005435 Bacteria 1775
194 Ga0070714_100653463 3300005435 Bacteria 1012
195 Ga0070713_100091585 3300005436 Bacteria 2616
196 Ga0070713_100311843 3300005436 Bacteria 1451
197 Ga0070713_100332155 3300005436 Bacteria 1406
198 Ga0070713_100431727 3300005436 Unclassified 1234
199 Ga0070710_10489712 3300005437 Bacteria 840
200 Ga0070700_101972452 3300005441 Bacteria 506
201 Ga0070663_100005666 3300005455 Bacteria 7441
202 Ga0070663_100030678 3300005455 Bacteria 3687
203 Ga0070663_100053126 3300005455 Bacteria 2891
204 Ga0070663_100066161 3300005455 Bacteria 2618
205 Ga0070663_100097419 3300005455 Bacteria 2189
206 Ga0070663_100255396 3300005455 Bacteria 1388
207 Ga0070663_100278271 3300005455 Bacteria 1333
208 Ga0070663_100488604 3300005455 Bacteria 1020
209 Ga0070663_100585431 3300005455 Bacteria 937
210 Ga0070663_100669554 3300005455 Bacteria 879
211 Ga0070663_101948127 3300005455 Unclassified 528
212 Ga0070678_100010289 3300005456 Bacteria 5706
213 Ga0070678_100016637 3300005456 Bacteria 4711
214 Ga0070678_100026069 3300005456 Bacteria 3946
215 Ga0070678_100026663 3300005456 Bacteria 3911
216 Ga0070678_100258162 3300005456 Bacteria 1464
217 Ga0070678_101242883 3300005456 Bacteria 692
218 Ga0070662_100011388 3300005457 Bacteria 5870
219 Ga0070662_100015039 3300005457 Bacteria 5176
220 Ga0070662_100060258 3300005457 Bacteria 2767
221 Ga0070662_100087940 3300005457 Bacteria 2327
222 Ga0070662_100163879 3300005457 Bacteria 1740
223 Ga0070662_100300625 3300005457 Bacteria 1304
224 Ga0070662_100301228 3300005457 Bacteria 1302
225 Ga0070662_100375857 3300005457 Bacteria 1169
226 Ga0070662_100450216 3300005457 Bacteria 1068
227 Ga0070662_100550430 3300005457 Bacteria 967
228 Ga0070662_101760569 3300005457 Bacteria 535
229 Ga0070681_10088373 3300005458 Bacteria 3051
230 Ga0070681_10100772 3300005458 Bacteria 2834
231 Ga0070681_10184084 3300005458 Bacteria 2009
232 Ga0070681_10261760 3300005458 Bacteria 1641
233 Ga0070681_10654224 3300005458 Bacteria 966
234 Ga0070681_10691043 3300005458 Bacteria 936
235 Ga0068867_100036903 3300005459 Bacteria 3550
236 Ga0068867_100047648 3300005459 Bacteria 3151
237 Ga0068867_100135803 3300005459 Bacteria 1917
238 Ga0068867_101500982 3300005459 Bacteria 628
239 Ga0070685_10662632 3300005466 Unclassified 757
240 Ga0070679_100002835 3300005530 Bacteria 15761
241 Ga0070679_100188527 3300005530 Bacteria 2032
242 Ga0070679_100254282 3300005530 Bacteria 1712
243 Ga0070679_100477135 3300005530 Bacteria 1191
244 Ga0070679_100575799 3300005530 Unclassified 1069
245 Ga0070679_101933853 3300005530 Bacteria 539
246 Ga0070684_100001026 3300005535 Bacteria 19914
247 Ga0070684_100010648 3300005535 Bacteria 7293
248 Ga0070684_100283093 3300005535 Bacteria 1519
249 Ga0070684_100358506 3300005535 Bacteria 1342
250 Ga0070684_101408071 3300005535 Bacteria 657
251 Ga0068853_100096431 3300005539 Bacteria 2609
252 Ga0068853_100436807 3300005539 Bacteria 1229
253 Ga0068853_100448174 3300005539 Bacteria 1214
254 Ga0068853_100452439 3300005539 Bacteria 1208
255 Ga0068853_101167923 3300005539 Bacteria 743
256 Ga0068853_101296844 3300005539 Bacteria 704
257 Ga0068853_101765925 3300005539 Bacteria 600
258 Ga0070672_100052473 3300005543 Bacteria 3183
259 Ga0070672_100074979 3300005543 Bacteria 2700
260 Ga0070672_100087333 3300005543 Bacteria 2509
261 Ga0070672_100144325 3300005543 Bacteria 1966
262 Ga0070672_100158953 3300005543 Bacteria 1873
263 Ga0070672_100244804 3300005543 Bacteria 1509
264 Ga0070686_100048833 3300005544 Bacteria 2683
265 Ga0070686_101536529 3300005544 Bacteria 562
266 Ga0070693_100246076 3300005547 Unclassified 1183
267 Ga0070693_100405267 3300005547 Bacteria 947
268 Ga0070665_100016180 3300005548 Bacteria 7484
269 Ga0070665_100017108 3300005548 Bacteria 7273
270 Ga0070665_100090739 3300005548 Bacteria 3061
271 Ga0070665_100210216 3300005548 Bacteria 1946
272 Ga0070665_100300202 3300005548 Bacteria 1609
273 Ga0070665_102322193 3300005548 Bacteria 539
274 Ga0068855_100002695 3300005563 Bacteria 21894
275 Ga0068855_100053402 3300005563 Bacteria 4754
276 Ga0068855_100189392 3300005563 Bacteria 2322
277 Ga0068855_100259419 3300005563 Bacteria 1937
278 Ga0068855_100310710 3300005563 Bacteria 1744
279 Ga0068855_100335081 3300005563 Bacteria 1669
280 Ga0068855_100464672 3300005563 Bacteria 1379
281 Ga0070664_100001303 3300005564 Bacteria 19939
282 Ga0070664_100007167 3300005564 Bacteria 8988
283 Ga0070664_100101010 3300005564 Bacteria 2508
284 Ga0070664_100105231 3300005564 Bacteria 2457
285 Ga0070664_100138761 3300005564 Bacteria 2139
286 Ga0070664_100168428 3300005564 Bacteria 1942
287 Ga0070664_100243020 3300005564 Bacteria 1616
288 Ga0070664_100374067 3300005564 Bacteria 1299
289 Ga0070664_100378031 3300005564 Bacteria 1292
290 Ga0070664_101035195 3300005564 Bacteria 772
291 Ga0070664_101285577 3300005564 Unclassified 691
292 Ga0070664_102133742 3300005564 Unclassified 532
293 Ga0068857_100056859 3300005577 Bacteria 3472
294 Ga0068857_100076385 3300005577 Bacteria 2987
295 Ga0068857_100147825 3300005577 Bacteria 2127
296 Ga0068857_100682976 3300005577 Bacteria 975
297 Ga0068857_100775264 3300005577 Bacteria 914
298 Ga0068854_100010218 3300005578 Bacteria 6082
299 Ga0068854_100024573 3300005578 Bacteria 4127
300 Ga0068854_100078770 3300005578 Bacteria 2428
301 Ga0068854_100080593 3300005578 Bacteria 2402
302 Ga0068854_100083096 3300005578 Bacteria 2368
303 Ga0068854_100157849 3300005578 Bacteria 1754
304 Ga0068854_100246603 3300005578 Bacteria 1424
305 Ga0068854_100271197 3300005578 Bacteria 1362
306 Ga0068854_100279126 3300005578 Bacteria 1344
307 Ga0068854_100392183 3300005578 Bacteria 1147
308 Ga0068854_100407474 3300005578 Bacteria 1126
309 Ga0068854_100417752 3300005578 Bacteria 1113
310 Ga0068854_101070694 3300005578 Bacteria 717
311 Ga0068854_101178586 3300005578 Unclassified 685
312 Ga0068856_100008516 3300005614 Bacteria 9973
313 Ga0068856_100015328 3300005614 Bacteria 7407
314 Ga0068856_100021054 3300005614 Bacteria 6338
315 Ga0068856_100105379 3300005614 Bacteria 2814
316 Ga0068856_100207413 3300005614 Bacteria 1974
317 Ga0068856_100325425 3300005614 Bacteria 1555
318 Ga0068856_100435380 3300005614 Bacteria 1331
319 Ga0068856_101164317 3300005614 Unclassified 788
320 Ga0068856_101569471 3300005614 Bacteria 672
321 Ga0068856_101781955 3300005614 Bacteria 627
322 Ga0068856_102155405 3300005614 Bacteria 567
323 Ga0068856_102418707 3300005614 Bacteria 532
324 Ga0070702_100132735 3300005615 Bacteria 1575
325 Ga0068852_100045843 3300005616 Bacteria 3721
326 Ga0068852_100084067 3300005616 Bacteria 2831
327 Ga0068852_100097361 3300005616 Bacteria 2647
328 Ga0068852_100104368 3300005616 Bacteria 2565
329 Ga0068852_100114799 3300005616 Bacteria 2454
330 Ga0068852_100186681 3300005616 Bacteria 1953
331 Ga0068852_100278799 3300005616 Bacteria 1611
332 Ga0068852_100454063 3300005616 Bacteria 1269
333 Ga0068852_100484433 3300005616 Bacteria 1230
334 Ga0068852_100521181 3300005616 Bacteria 1186
335 Ga0068852_100563665 3300005616 Bacteria 1140
336 Ga0068852_100577638 3300005616 Bacteria 1126
337 Ga0068852_100708604 3300005616 Bacteria 1017
338 Ga0068852_101164424 3300005616 Bacteria 792
339 Ga0068852_101621283 3300005616 Bacteria 669
340 Ga0068852_101858664 3300005616 Bacteria 624
341 Ga0068859_100170610 3300005617 Bacteria 2256
342 Ga0068859_100457861 3300005617 Bacteria 1372
343 Ga0068859_100785833 3300005617 Bacteria 1040
344 Ga0068864_100020708 3300005618 Bacteria 5504
345 Ga0068864_100021379 3300005618 Bacteria 5421
346 Ga0068864_100050044 3300005618 Bacteria 3595
347 Ga0068864_100132444 3300005618 Bacteria 2241
348 Ga0068866_10121538 3300005718 Bacteria 1472
349 Ga0068866_10168328 3300005718 Bacteria 1284
350 Ga0068851_10042734 3300005834 Bacteria 2282
351 Ga0068851_10074982 3300005834 Bacteria 1757
352 Ga0068851_10111378 3300005834 Bacteria 1461
353 Ga0068851_10275354 3300005834 Unclassified 961
354 Ga0068851_11005373 3300005834 Bacteria 526
355 Ga0068870_10193938 3300005840 Bacteria 1227
356 Ga0068870_10204447 3300005840 Bacteria 1199
357 Ga0068870_10402729 3300005840 Bacteria 891
358 Ga0068863_100016025 3300005841 Bacteria 7188
359 Ga0068863_100083929 3300005841 Bacteria 3019
360 Ga0068863_101131732 3300005841 Bacteria 788
361 Ga0068858_100001465 3300005842 Bacteria 24278
362 Ga0068858_100013766 3300005842 Bacteria 7636
363 Ga0068858_100542598 3300005842 Bacteria 1125
364 Ga0068858_101842031 3300005842 Bacteria 598
365 Ga0068860_100370246 3300005843 Bacteria 1413
366 Ga0068860_101277321 3300005843 Bacteria 755
367 Ga0068860_101794880 3300005843 Unclassified 635
368 Ga0068860_102703822 3300005843 Unclassified 515
369 Ga0068862_102463249 3300005844 Unclassified 532
370 Ga0081539_10046420 3300005985 Bacteria 2489
371 Ga0070717_10002133 3300006028 Bacteria 13866
372 Ga0070717_11807134 3300006028 Bacteria 552
373 Ga0070716_100293685 3300006173 Bacteria 1127
374 Ga0070712_100381466 3300006175 Bacteria 1160
375 Ga0075366_10362750 3300006195 Bacteria 890
376 Ga0097621_100165162 3300006237 Bacteria 1905
377 Ga0097621_100221346 3300006237 Bacteria 1649
378 Ga0097621_100235097 3300006237 Archaea 1601
379 Ga0097621_101346496 3300006237 Bacteria 675
380 Ga0097621_101537420 3300006237 Bacteria 632
381 Ga0068871_100023026 3300006358 Bacteria 4810
382 Ga0068871_100117526 3300006358 Bacteria 2243
383 Ga0068871_100172437 3300006358 Bacteria 1855
384 Ga0068865_100010238 3300006881 Bacteria 5831
385 Ga0068865_100016591 3300006881 Bacteria 4716
386 Ga0068865_100059132 3300006881 Bacteria 2680
387 Ga0068865_100082000 3300006881 Bacteria 2318
388 Ga0068865_100285244 3300006881 Bacteria 1316
389 Ga0097620_100170609 3300006931 Bacteria 2256
390 Ga0097620_100457863 3300006931 Bacteria 1372
391 Ga0097620_100785934 3300006931 Bacteria 1040
392 Ga0105251_10357094 3300009011 Unclassified 667
393 Ga0105240_10047579 3300009093 Bacteria 5427
394 Ga0105240_10262723 3300009093 Bacteria 1991
395 Ga0105240_10295419 3300009093 Bacteria 1855
396 Ga0105240_10949497 3300009093 Bacteria 922
397 Ga0105245_10051816 3300009098 Bacteria 3679
398 Ga0105245_10073009 3300009098 Bacteria 3118
399 Ga0105245_10228184 3300009098 Bacteria 1800
400 Ga0105247_10302189 3300009101 Bacteria 1111
401 Ga0114129_10894455 3300009147 Bacteria 1126
402 Ga0105243_10111137 3300009148 Bacteria 2293
403 Ga0105243_10341269 3300009148 Bacteria 1372
404 Ga0105241_10547908 3300009174 Unclassified 1038
405 Ga0105241_11582991 3300009174 Bacteria 633
406 Ga0105241_11930957 3300009174 Bacteria 579
407 Ga0105242_10079951 3300009176 Bacteria 2731
408 Ga0105242_10812877 3300009176 Bacteria 926
409 Ga0105248_10000818 3300009177 Bacteria 34897
410 Ga0105248_10008738 3300009177 Bacteria 11126
411 Ga0105248_10015579 3300009177 Bacteria 8381
412 Ga0105248_10170905 3300009177 Bacteria 2450
413 Ga0105248_10179809 3300009177 Bacteria 2383
414 Ga0105248_10185409 3300009177 Bacteria 2345
415 Ga0105248_10238645 3300009177 Bacteria 2046
416 Ga0105248_10239851 3300009177 Bacteria 2041
417 Ga0105248_10507897 3300009177 Bacteria 1359
418 Ga0105248_10705912 3300009177 Bacteria 1138
419 Ga0105248_11077989 3300009177 Unclassified 908
420 Ga0105248_11085213 3300009177 Bacteria 905
421 Ga0105248_11910235 3300009177 Unclassified 674
422 Ga0105237_10058748 3300009545 Bacteria 3849
423 Ga0105237_10063517 3300009545 Bacteria 3690
424 Ga0105237_10918133 3300009545 Bacteria 882
425 Ga0105237_10982783 3300009545 Unclassified 851
426 Ga0105238_10006724 3300009551 Bacteria 11478
427 Ga0105238_10012329 3300009551 Bacteria 8621
428 Ga0105238_10285741 3300009551 Bacteria 1631
429 Ga0105238_10881053 3300009551 Bacteria 913
430 Ga0105238_11267486 3300009551 Bacteria 763
431 Ga0105249_12431918 3300009553 Unclassified 596
432 Ga0105239_10135243 3300010375 Bacteria 2744
433 Ga0105246_10096885 3300011119 Bacteria 2139
434 Ga0105246_10151728 3300011119 Bacteria 1755
435 Ga0105246_10296711 3300011119 Bacteria 1303
436 Ga0105246_10508711 3300011119 Bacteria 1024
437 Ga0157373_10061289 3300013100 Bacteria 2665
438 Ga0157373_10084448 3300013100 Bacteria 2238
439 Ga0157373_10111875 3300013100 Bacteria 1920
440 Ga0157373_10116964 3300013100 Bacteria 1873
441 Ga0157373_10177730 3300013100 Bacteria 1498
442 Ga0157373_10179520 3300013100 Bacteria 1490
443 Ga0157373_10185641 3300013100 Bacteria 1465
444 Ga0157373_10194433 3300013100 Bacteria 1429
445 Ga0157373_10371180 3300013100 Bacteria 1022
446 Ga0157373_10828710 3300013100 Bacteria 683
447 Ga0157373_11191322 3300013100 Unclassified 574
448 Ga0157371_10067992 3300013102 Bacteria 2521
449 Ga0157371_10072232 3300013102 Bacteria 2443
450 Ga0157371_10118533 3300013102 Bacteria 1882
451 Ga0157371_10154417 3300013102 Bacteria 1638
452 Ga0157371_10236689 3300013102 Bacteria 1313
453 Ga0157371_10332500 3300013102 Bacteria 1104
454 Ga0157371_10433709 3300013102 Bacteria 964
455 Ga0157371_10584681 3300013102 Bacteria 830
456 Ga0157371_11140197 3300013102 Bacteria 599
457 Ga0157371_11470201 3300013102 Unclassified 531
458 Ga0157370_10023539 3300013104 Bacteria 6113
459 Ga0157370_10041873 3300013104 Bacteria 4416
460 Ga0157370_10146994 3300013104 Bacteria 2194
461 Ga0157370_10152711 3300013104 Bacteria 2148
462 Ga0157370_10182286 3300013104 Bacteria 1951
463 Ga0157370_10219779 3300013104 Bacteria 1760
464 Ga0157370_10233182 3300013104 Bacteria 1703
465 Ga0157370_10350767 3300013104 Bacteria 1360
466 Ga0157370_10415147 3300013104 Unclassified 1238
467 Ga0157370_10516581 3300013104 Bacteria 1096
468 Ga0157370_11410258 3300013104 Bacteria 627
469 Ga0157369_10006384 3300013105 Bacteria 13671
470 Ga0157369_10072149 3300013105 Bacteria 3706
471 Ga0157369_10168231 3300013105 Bacteria 2311
472 Ga0157369_10197598 3300013105 Bacteria 2111
473 Ga0157369_10198459 3300013105 Bacteria 2106
474 Ga0157369_10406305 3300013105 Bacteria 1412
475 Ga0157369_10527315 3300013105 Bacteria 1221
476 Ga0157369_10598892 3300013105 Bacteria 1138
477 Ga0157369_10675592 3300013105 Bacteria 1064
478 Ga0157369_11276108 3300013105 Unclassified 749
479 Ga0157369_11508391 3300013105 Bacteria 684
480 Ga0157369_12647193 3300013105 Bacteria 506
481 Ga0157369_12704464 3300013105 Bacteria 500
482 Ga0157374_10076429 3300013296 Bacteria 3167
483 Ga0157374_10123807 3300013296 Bacteria 2498
484 Ga0157374_10124650 3300013296 Bacteria 2489
485 Ga0157374_10573325 3300013296 Bacteria 1137
486 Ga0157374_11134381 3300013296 Bacteria 802
487 Ga0157378_10083158 3300013297 Bacteria 2896
488 Ga0157378_10085141 3300013297 Bacteria 2864
489 Ga0157378_10368703 3300013297 Bacteria 1407
490 Ga0157378_12812028 3300013297 Bacteria 539
491 Ga0163162_10017617 3300013306 Bacteria 6989
492 Ga0163162_10126667 3300013306 Bacteria 2661
493 Ga0163162_10439892 3300013306 Bacteria 1436
494 Ga0163162_10445797 3300013306 Bacteria 1426
495 Ga0157372_10131090 3300013307 Bacteria 2884
496 Ga0157372_10193340 3300013307 Bacteria 2357
497 Ga0157372_10342320 3300013307 Bacteria 1742
498 Ga0157372_10963412 3300013307 Bacteria 989
499 Ga0157372_11002785 3300013307 Unclassified 967
500 Ga0157372_11737749 3300013307 Bacteria 718
501 Ga0157372_12076607 3300013307 Bacteria 653
502 Ga0157375_10040943 3300013308 Bacteria 4470
503 Ga0157375_10045518 3300013308 Bacteria 4271
504 Ga0157375_10077378 3300013308 Bacteria 3356
505 Ga0157375_10173056 3300013308 Bacteria 2308
506 Ga0157375_10216120 3300013308 Bacteria 2075
507 Ga0157375_10232399 3300013308 Bacteria 2003
508 Ga0157375_10465657 3300013308 Bacteria 1429
509 Ga0163163_10017377 3300014325 Bacteria 6707
510 Ga0163163_10221024 3300014325 Bacteria 1943
511 Ga0163163_10319923 3300014325 Bacteria 1605
512 Ga0163163_11002867 3300014325 Bacteria 898
513 Ga0182008_10352286 3300014497 Bacteria 781
514 Ga0157377_10041554 3300014745 Bacteria 2551
515 Ga0157377_11379374 3300014745 Unclassified 555
516 Ga0157379_10084893 3300014968 Bacteria 2837
517 Ga0157379_10197261 3300014968 Bacteria 1819
518 Ga0157379_10693008 3300014968 Bacteria 956
519 Ga0157376_10212607 3300014969 Bacteria 1786
520 Ga0157376_12181487 3300014969 Bacteria 593
521 Ga0163161_10057282 3300017792 Bacteria 2831
522 Ga0163161_10483399 3300017792 Bacteria 1006
523 Ga0163161_10536817 3300017792 Bacteria 957
524 Ga0163161_10566723 3300017792 Bacteria 933
525 Ga0163161_10646849 3300017792 Bacteria 876
526 Ga0163161_11678223 3300017792 Unclassified 562
527 Ga0206353_10762675 3300020082 Bacteria 879
528 Ga0213876_10578853 3300021384 Bacteria 597
529 Ga0207697_10017711 3300025315 Bacteria 2926
530 Ga0207656_10033926 3300025321 Bacteria 2128
531 Ga0207656_10041510 3300025321 Bacteria 1955
532 Ga0207656_10073490 3300025321 Bacteria 1524
533 Ga0207682_10027136 3300025893 Bacteria 2279
534 Ga0207682_10197961 3300025893 Bacteria 923
535 Ga0207710_10199879 3300025900 Bacteria 987
536 Ga0207688_10030565 3300025901 Bacteria 2971
537 Ga0207688_10137514 3300025901 Bacteria 1436
538 Ga0207688_10145661 3300025901 Bacteria 1396
539 Ga0207688_10237757 3300025901 Bacteria 1101
540 Ga0207688_10305284 3300025901 Bacteria 974
541 Ga0207688_10632414 3300025901 Bacteria 675
542 Ga0207680_10003241 3300025903 Bacteria 7661
543 Ga0207680_10016177 3300025903 Bacteria 3909
544 Ga0207680_10017057 3300025903 Bacteria 3828
545 Ga0207680_10062848 3300025903 Bacteria 2270
546 Ga0207680_10067342 3300025903 Bacteria 2206
547 Ga0207680_10123573 3300025903 Bacteria 1696
548 Ga0207680_10295399 3300025903 Bacteria 1128
549 Ga0207680_10459697 3300025903 Bacteria 904
550 Ga0207680_11145129 3300025903 Bacteria 555
551 Ga0207647_10003773 3300025904 Bacteria 11329
552 Ga0207647_10004965 3300025904 Bacteria 9807
553 Ga0207647_10006911 3300025904 Bacteria 8227
554 Ga0207647_10065458 3300025904 Bacteria 2206
555 Ga0207647_10130685 3300025904 Bacteria 1476
556 Ga0207647_10156205 3300025904 Bacteria 1332
557 Ga0207647_10594473 3300025904 Bacteria 611
558 Ga0207645_10013986 3300025907 Bacteria 5383
559 Ga0207645_10088170 3300025907 Bacteria 1994
560 Ga0207643_10066221 3300025908 Bacteria 2071
561 Ga0207705_10000942 3300025909 Bacteria 23772
562 Ga0207705_10001316 3300025909 Bacteria 19907
563 Ga0207705_10023301 3300025909 Bacteria 4417
564 Ga0207705_10023836 3300025909 Bacteria 4366
565 Ga0207705_10066922 3300025909 Bacteria 2599
566 Ga0207705_10139185 3300025909 Bacteria 1811
567 Ga0207705_10422371 3300025909 Bacteria 1032
568 Ga0207705_10465144 3300025909 Bacteria 981
569 Ga0207705_10543341 3300025909 Bacteria 903
570 Ga0207705_10891183 3300025909 Unclassified 689
571 Ga0207654_10140053 3300025911 Unclassified 1541
572 Ga0207654_11453153 3300025911 Bacteria 500
573 Ga0207707_10016093 3300025912 Bacteria 6523
574 Ga0207707_10100753 3300025912 Bacteria 2524
575 Ga0207707_10331949 3300025912 Bacteria 1312
576 Ga0207707_10429775 3300025912 Bacteria 1131
577 Ga0207707_10476038 3300025912 Bacteria 1067
578 Ga0207707_10718551 3300025912 Bacteria 838
579 Ga0207707_10835050 3300025912 Bacteria 765
580 Ga0207707_11153218 3300025912 Bacteria 629
581 Ga0207695_10049729 3300025913 Bacteria 4416
582 Ga0207695_10055479 3300025913 Bacteria 4129
583 Ga0207695_10433524 3300025913 Bacteria 1198
584 Ga0207695_10592627 3300025913 Bacteria 990
585 Ga0207671_10049834 3300025914 Bacteria 3101
586 Ga0207671_11031665 3300025914 Unclassified 647
587 Ga0207671_11344228 3300025914 Bacteria 555
588 Ga0207693_10127809 3300025915 Bacteria 1998
589 Ga0207660_10000400 3300025917 Bacteria 28576
590 Ga0207660_10004486 3300025917 Bacteria 9103
591 Ga0207660_10007465 3300025917 Bacteria 7071
592 Ga0207660_10013348 3300025917 Bacteria 5383
593 Ga0207660_10130269 3300025917 Bacteria 1914
594 Ga0207660_10448419 3300025917 Bacteria 1043
595 Ga0207660_10487606 3300025917 Bacteria 999
596 Ga0207662_10128810 3300025918 Bacteria 1594
597 Ga0207662_10315019 3300025918 Bacteria 1043
598 Ga0207657_10001753 3300025919 Bacteria 23414
599 Ga0207657_10005658 3300025919 Bacteria 13043
600 Ga0207657_10018268 3300025919 Bacteria 6704
601 Ga0207657_10037805 3300025919 Bacteria 4306
602 Ga0207657_10056516 3300025919 Bacteria 3386
603 Ga0207657_10064185 3300025919 Bacteria 3135
604 Ga0207657_10094294 3300025919 Bacteria 2492
605 Ga0207657_10132957 3300025919 Bacteria 2038
606 Ga0207657_10139244 3300025919 Bacteria 1983
607 Ga0207657_10141170 3300025919 Bacteria 1968
608 Ga0207657_10258324 3300025919 Bacteria 1387
609 Ga0207657_10263549 3300025919 Bacteria 1371
610 Ga0207657_10270202 3300025919 Bacteria 1351
611 Ga0207657_10429685 3300025919 Bacteria 1038
612 Ga0207649_10006680 3300025920 Bacteria 6269
613 Ga0207649_10041126 3300025920 Bacteria 2813
614 Ga0207649_10063938 3300025920 Bacteria 2325
615 Ga0207649_10087397 3300025920 Bacteria 2034
616 Ga0207649_10088905 3300025920 Bacteria 2018
617 Ga0207649_10118531 3300025920 Bacteria 1781
618 Ga0207649_10253349 3300025920 Bacteria 1269
619 Ga0207649_10276056 3300025920 Bacteria 1220
620 Ga0207649_10303047 3300025920 Bacteria 1169
621 Ga0207649_10396170 3300025920 Bacteria 1032
622 Ga0207649_10746680 3300025920 Bacteria 761
623 Ga0207649_10820210 3300025920 Bacteria 727
624 Ga0207652_10000875 3300025921 Bacteria 28516
625 Ga0207652_10294646 3300025921 Bacteria 1464
626 Ga0207652_10314499 3300025921 Bacteria 1413
627 Ga0207652_10612988 3300025921 Bacteria 975
628 Ga0207652_11641901 3300025921 Bacteria 547
629 Ga0207652_11653787 3300025921 Bacteria 545
630 Ga0207681_10532962 3300025923 Unclassified 965
631 Ga0207694_10069885 3300025924 Bacteria 2744
632 Ga0207694_10103012 3300025924 Bacteria 2263
633 Ga0207694_10859497 3300025924 Bacteria 767
634 Ga0207694_11056916 3300025924 Bacteria 687
635 Ga0207650_10008672 3300025925 Bacteria 6947
636 Ga0207650_10060026 3300025925 Bacteria 2837
637 Ga0207650_10134640 3300025925 Bacteria 1937
638 Ga0207650_10235690 3300025925 Unclassified 1477
639 Ga0207650_10480500 3300025925 Bacteria 1037
640 Ga0207650_10537317 3300025925 Bacteria 979
641 Ga0207650_10806660 3300025925 Bacteria 796
642 Ga0207659_10113155 3300025926 Bacteria 2066
643 Ga0207659_10289287 3300025926 Bacteria 1342
644 Ga0207659_10517917 3300025926 Bacteria 1011
645 Ga0207659_11039961 3300025926 Unclassified 705
646 Ga0207687_10081964 3300025927 Bacteria 2333
647 Ga0207687_10141118 3300025927 Bacteria 1828
648 Ga0207700_10361832 3300025928 Bacteria 1265
649 Ga0207700_10477295 3300025928 Bacteria 1101
650 Ga0207700_10484277 3300025928 Bacteria 1093
651 Ga0207664_10058195 3300025929 Bacteria 3074
652 Ga0207664_10112886 3300025929 Bacteria 2262
653 Ga0207664_10137366 3300025929 Bacteria 2064
654 Ga0207664_10244522 3300025929 Bacteria 1564
655 Ga0207664_10470604 3300025929 Bacteria 1123
656 Ga0207664_11315318 3300025929 Bacteria 642
657 Ga0207644_10001071 3300025931 Bacteria 17504
658 Ga0207644_10033493 3300025931 Bacteria 3590
659 Ga0207644_10049096 3300025931 Bacteria 3019
660 Ga0207644_10065503 3300025931 Bacteria 2642
661 Ga0207644_10073001 3300025931 Bacteria 2515
662 Ga0207644_10103907 3300025931 Bacteria 2138
663 Ga0207644_10323569 3300025931 Bacteria 1247
664 Ga0207644_10326105 3300025931 Bacteria 1242
665 Ga0207644_10422370 3300025931 Bacteria 1092
666 Ga0207644_11409158 3300025931 Bacteria 585
667 Ga0207690_10001341 3300025932 Bacteria 15473
668 Ga0207690_10014947 3300025932 Bacteria 4700
669 Ga0207690_10019577 3300025932 Bacteria 4171
670 Ga0207690_10143711 3300025932 Bacteria 1761
671 Ga0207690_10283668 3300025932 Bacteria 1290
672 Ga0207690_10556528 3300025932 Bacteria 933
673 Ga0207690_10630188 3300025932 Bacteria 877
674 Ga0207690_10767205 3300025932 Bacteria 796
675 Ga0207690_10777327 3300025932 Bacteria 790
676 Ga0207690_11402967 3300025932 Bacteria 584
677 Ga0207706_10013653 3300025933 Bacteria 7376
678 Ga0207706_10051013 3300025933 Bacteria 3655
679 Ga0207706_10070485 3300025933 Bacteria 3075
680 Ga0207706_10092851 3300025933 Bacteria 2654
681 Ga0207706_10095253 3300025933 Bacteria 2618
682 Ga0207706_10143783 3300025933 Bacteria 2098
683 Ga0207706_10157654 3300025933 Bacteria 1996
684 Ga0207706_10422170 3300025933 Bacteria 1155
685 Ga0207706_10549471 3300025933 Bacteria 994
686 Ga0207706_10564408 3300025933 Bacteria 979
687 Ga0207706_10587299 3300025933 Bacteria 957
688 Ga0207706_10688051 3300025933 Bacteria 874
689 Ga0207686_10107153 3300025934 Bacteria 1877
690 Ga0207686_11174836 3300025934 Unclassified 627
691 Ga0207709_10120264 3300025935 Bacteria 1772
692 Ga0207669_10002310 3300025937 Bacteria 8110
693 Ga0207669_10207478 3300025937 Bacteria 1427
694 Ga0207669_10224549 3300025937 Bacteria 1381
695 Ga0207669_10359830 3300025937 Bacteria 1127
696 Ga0207669_10913015 3300025937 Bacteria 734
697 Ga0207669_11370827 3300025937 Bacteria 602
698 Ga0207704_10070817 3300025938 Bacteria 2210
699 Ga0207704_10083513 3300025938 Bacteria 2073
700 Ga0207704_10104809 3300025938 Bacteria 1895
701 Ga0207704_10129087 3300025938 Bacteria 1746
702 Ga0207704_10840753 3300025938 Bacteria 769
703 Ga0207665_10145871 3300025939 Bacteria 1691
704 Ga0207665_10641962 3300025939 Bacteria 832
705 Ga0207691_10003204 3300025940 Bacteria 15961
706 Ga0207691_10011977 3300025940 Bacteria 8319
707 Ga0207691_10026686 3300025940 Bacteria 5420
708 Ga0207691_10029479 3300025940 Bacteria 5134
709 Ga0207691_10112990 3300025940 Bacteria 2414
710 Ga0207691_10119169 3300025940 Bacteria 2341
711 Ga0207691_10142243 3300025940 Bacteria 2114
712 Ga0207711_10000193 3300025941 Bacteria 65165
713 Ga0207711_10009919 3300025941 Bacteria 7917
714 Ga0207711_10014767 3300025941 Bacteria 6490
715 Ga0207711_10043780 3300025941 Bacteria 3820
716 Ga0207711_10078656 3300025941 Bacteria 2877
717 Ga0207711_10088568 3300025941 Bacteria 2718
718 Ga0207711_10160190 3300025941 Bacteria 2036
719 Ga0207711_11001293 3300025941 Unclassified 775
720 Ga0207711_11220580 3300025941 Unclassified 694
721 Ga0207711_11507124 3300025941 Bacteria 615
722 Ga0207661_10001073 3300025944 Bacteria 18214
723 Ga0207661_10052755 3300025944 Bacteria 3250
724 Ga0207661_10262454 3300025944 Bacteria 1539
725 Ga0207661_10885934 3300025944 Unclassified 822
726 Ga0207679_10029510 3300025945 Bacteria 3820
727 Ga0207679_10178545 3300025945 Bacteria 1754
728 Ga0207679_10433618 3300025945 Bacteria 1162
729 Ga0207679_10961859 3300025945 Bacteria 782
730 Ga0207679_11071695 3300025945 Unclassified 739
731 Ga0207679_11716983 3300025945 Bacteria 574
732 Ga0207679_12058919 3300025945 Bacteria 519
733 Ga0207667_10002493 3300025949 Bacteria 22937
734 Ga0207667_10023410 3300025949 Bacteria 6801
735 Ga0207667_10036587 3300025949 Bacteria 5259
736 Ga0207667_10044346 3300025949 Bacteria 4713
737 Ga0207667_10052469 3300025949 Bacteria 4294
738 Ga0207667_10252499 3300025949 Bacteria 1804
739 Ga0207667_10322113 3300025949 Bacteria 1579
740 Ga0207667_10349391 3300025949 Bacteria 1508
741 Ga0207667_11015229 3300025949 Bacteria 816
742 Ga0207667_12054745 3300025949 Bacteria 531
743 Ga0207651_10008899 3300025960 Bacteria 5453
744 Ga0207651_10068542 3300025960 Bacteria 2501
745 Ga0207651_10120398 3300025960 Bacteria 1989
746 Ga0207651_10141684 3300025960 Bacteria 1858
747 Ga0207651_10418963 3300025960 Bacteria 1143
748 Ga0207651_11546468 3300025960 Bacteria 597
749 Ga0207651_12130131 3300025960 Unclassified 503
750 Ga0207668_10383159 3300025972 Bacteria 1184
751 Ga0207668_10761375 3300025972 Bacteria 855
752 Ga0207640_10006207 3300025981 Bacteria 6544
753 Ga0207640_10021654 3300025981 Bacteria 3835
754 Ga0207640_10033341 3300025981 Bacteria 3203
755 Ga0207640_10083882 3300025981 Bacteria 2186
756 Ga0207640_10307188 3300025981 Bacteria 1257
757 Ga0207640_10408935 3300025981 Bacteria 1107
758 Ga0207640_10428761 3300025981 Bacteria 1084
759 Ga0207640_10471185 3300025981 Bacteria 1039
760 Ga0207640_10587512 3300025981 Unclassified 941
761 Ga0207640_11255977 3300025981 Bacteria 660
762 Ga0207640_11533757 3300025981 Bacteria 599
763 Ga0207658_10026602 3300025986 Bacteria 4057
764 Ga0207658_10029783 3300025986 Bacteria 3859
765 Ga0207658_10217982 3300025986 Bacteria 1603
766 Ga0207658_10909119 3300025986 Bacteria 801
767 Ga0207658_10966788 3300025986 Unclassified 776
768 Ga0207677_10002084 3300026023 Bacteria 10526
769 Ga0207677_10081998 3300026023 Bacteria 2317
770 Ga0207677_10625704 3300026023 Bacteria 947
771 Ga0207677_10664182 3300026023 Bacteria 921
772 Ga0207677_11048065 3300026023 Bacteria 741
773 Ga0207677_11063007 3300026023 Bacteria 736
774 Ga0207703_10001723 3300026035 Bacteria 19664
775 Ga0207703_10112718 3300026035 Bacteria 2324
776 Ga0207703_10357272 3300026035 Bacteria 1346
777 Ga0207639_10004341 3300026041 Bacteria 9559
778 Ga0207639_10130840 3300026041 Bacteria 2077
779 Ga0207639_10179186 3300026041 Bacteria 1801
780 Ga0207639_10296545 3300026041 Bacteria 1427
781 Ga0207639_10409457 3300026041 Bacteria 1223
782 Ga0207639_10648136 3300026041 Bacteria 977
783 Ga0207639_10750069 3300026041 Bacteria 908
784 Ga0207639_11581517 3300026041 Bacteria 615
785 Ga0207678_10006058 3300026067 Bacteria 10756
786 Ga0207678_10025025 3300026067 Bacteria 5212
787 Ga0207678_10062017 3300026067 Bacteria 3215
788 Ga0207678_10069511 3300026067 Bacteria 3019
789 Ga0207678_10083319 3300026067 Bacteria 2735
790 Ga0207678_10097084 3300026067 Bacteria 2518
791 Ga0207678_10105232 3300026067 Bacteria 2407
792 Ga0207678_10108048 3300026067 Bacteria 2373
793 Ga0207678_10242566 3300026067 Bacteria 1543
794 Ga0207678_10314672 3300026067 Bacteria 1346
795 Ga0207678_10326925 3300026067 Bacteria 1320
796 Ga0207678_10478892 3300026067 Bacteria 1084
797 Ga0207678_11648639 3300026067 Bacteria 564
798 Ga0207702_10028532 3300026078 Bacteria 4639
799 Ga0207702_10058035 3300026078 Bacteria 3292
800 Ga0207702_10095301 3300026078 Bacteria 2614
801 Ga0207702_10120362 3300026078 Bacteria 2348
802 Ga0207702_10136004 3300026078 Bacteria 2217
803 Ga0207702_10160182 3300026078 Bacteria 2055
804 Ga0207702_10179986 3300026078 Bacteria 1946
805 Ga0207702_10238024 3300026078 Bacteria 1704
806 Ga0207641_10042335 3300026088 Bacteria 3820
807 Ga0207641_10314887 3300026088 Bacteria 1482
808 Ga0207641_10505225 3300026088 Bacteria 1174
809 Ga0207648_10008369 3300026089 Bacteria 10027
810 Ga0207648_10036712 3300026089 Bacteria 4317
811 Ga0207648_10100560 3300026089 Bacteria 2533
812 Ga0207648_10202111 3300026089 Bacteria 1762
813 Ga0207648_10345647 3300026089 Bacteria 1340
814 Ga0207676_10030608 3300026095 Bacteria 4041
815 Ga0207676_10179929 3300026095 Bacteria 1850
816 Ga0207676_10181541 3300026095 Bacteria 1843
817 Ga0207676_11694966 3300026095 Bacteria 630
818 Ga0207674_10008585 3300026116 Bacteria 11776
819 Ga0207674_10066040 3300026116 Bacteria 3645
820 Ga0207674_10067056 3300026116 Bacteria 3614
821 Ga0207674_10199719 3300026116 Bacteria 1949
822 Ga0207683_10004291 3300026121 Bacteria 12313
823 Ga0207683_10015098 3300026121 Bacteria 6573
824 Ga0207683_10022524 3300026121 Bacteria 5407
825 Ga0207683_10534535 3300026121 Bacteria 1083
826 Ga0207683_11157241 3300026121 Archaea 717
827 Ga0207698_10008371 3300026142 Bacteria 6538
828 Ga0207698_10054562 3300026142 Bacteria 3075
829 Ga0207698_10073739 3300026142 Bacteria 2719
830 Ga0207698_10098207 3300026142 Bacteria 2419
831 Ga0207698_10114411 3300026142 Bacteria 2269
832 Ga0207698_10197230 3300026142 Bacteria 1799
833 Ga0207698_10204583 3300026142 Bacteria 1771
834 Ga0207698_10239852 3300026142 Bacteria 1651
835 Ga0207698_10290769 3300026142 Bacteria 1516
836 Ga0207698_10444403 3300026142 Bacteria 1250
837 Ga0207698_10507619 3300026142 Bacteria 1174
838 Ga0207698_10530938 3300026142 Bacteria 1150
839 Ga0207698_10566015 3300026142 Bacteria 1116
840 Ga0207698_10883413 3300026142 Bacteria 900
841 Ga0207698_10958087 3300026142 Bacteria 865
842 Ga0207698_11508407 3300026142 Bacteria 687
843 Ga0268266_10060136 3300028379 Bacteria 3275
844 Ga0268266_10081457 3300028379 Bacteria 2822
845 Ga0268266_10134244 3300028379 Bacteria 2216
846 Ga0268266_10150301 3300028379 Bacteria 2098
847 Ga0268266_10528838 3300028379 Bacteria 1128
848 Ga0268264_10376965 3300028381 Bacteria 1358
849 Ga0268264_10887760 3300028381 Unclassified 894
850 Ga0268264_12172309 3300028381 Bacteria 563
851 Ga0268264_12433277 3300028381 Bacteria 529
852 Ga0307408_100036689 3300031548 Bacteria 3447
853 Ga0307408_100063257 3300031548 Bacteria 2706
854 Ga0307408_100206471 3300031548 Bacteria 1594
855 Ga0307408_100694887 3300031548 Bacteria 914
856 Ga0307405_10002230 3300031731 Bacteria 8473
857 Ga0307405_10037513 3300031731 Bacteria 2913
858 Ga0307405_10750966 3300031731 Unclassified 813
859 Ga0307405_10826880 3300031731 Bacteria 778
860 Ga0307405_11318511 3300031731 Unclassified 628
861 Ga0307413_10008180 3300031824 Bacteria 4918
862 Ga0307413_10826001 3300031824 Bacteria 781
863 Ga0307413_11003764 3300031824 Bacteria 715
864 Ga0307410_10017461 3300031852 Bacteria 4310
865 Ga0307410_10018714 3300031852 Bacteria 4191
866 Ga0307410_10027848 3300031852 Bacteria 3576
867 Ga0307410_10469943 3300031852 Bacteria 1029
868 Ga0307410_10613388 3300031852 Bacteria 909
869 Ga0307410_11184236 3300031852 Bacteria 665
870 Ga0307406_10017344 3300031901 Bacteria 4191
871 Ga0307406_10179989 3300031901 Bacteria 1538
872 Ga0307406_10311580 3300031901 Bacteria 1213
873 Ga0307407_10007084 3300031903 Bacteria 5051
874 Ga0307407_10035013 3300031903 Bacteria 2754
875 Ga0307407_10338992 3300031903 Bacteria 1061
876 Ga0307412_10014478 3300031911 Bacteria 4651
877 Ga0307412_10774261 3300031911 Bacteria 831
878 Ga0307412_10812557 3300031911 Bacteria 812
879 Ga0307412_10867443 3300031911 Unclassified 789
880 Ga0307409_100073105 3300031995 Bacteria 2733
881 Ga0307409_100128274 3300031995 Bacteria 2162
882 Ga0307409_100308062 3300031995 Bacteria 1476
883 Ga0307409_100544812 3300031995 Bacteria 1138
884 Ga0307409_102962283 3300031995 Unclassified 501
885 Ga0307416_100000618 3300032002 Bacteria 18316
886 Ga0307416_100011575 3300032002 Bacteria 5892
887 Ga0307416_100303864 3300032002 Bacteria 1587
888 Ga0307416_100407673 3300032002 Bacteria 1399
889 Ga0307416_100815566 3300032002 Unclassified 1029
890 Ga0307416_101636372 3300032002 Bacteria 749
891 Ga0307416_101772560 3300032002 Bacteria 721
892 Ga0307414_10053285 3300032004 Bacteria 2820
893 Ga0307414_10082274 3300032004 Bacteria 2360
894 Ga0307414_11003096 3300032004 Bacteria 768
895 Ga0307414_11351903 3300032004 Bacteria 661
896 Ga0307414_11694019 3300032004 Bacteria 590
897 Ga0307411_10018387 3300032005 Bacteria 4007
898 Ga0307411_10406985 3300032005 Bacteria 1126
899 Ga0307411_10466276 3300032005 Bacteria 1060
900 Ga0307415_100010082 3300032126 Bacteria 5331
901 Ga0307415_100013096 3300032126 Bacteria 4826
902 Ga0307415_100068641 3300032126 Bacteria 2482
903 Ga0307415_100846282 3300032126 Bacteria 839
904 Ga0373944_0229101 3300035089 Unclassified 680
905 Ga0373941_0073432 3300035115 Bacteria 1141
906 Ga0373945_0110699 3300035116 Bacteria 1083
907 Ga0373960_0095411 3300035121 Bacteria 957
908 Ga0373943_0001773 3300035170 Bacteria 9770
909 Ga0373955_0974776 3300035172 Bacteria 522
910 Ga0373942_0176351 3300035207 Unclassified 698
911 Ga0373962_0234008 3300035242 Unclassified 633
912 Ga0373931_0113069 3300035691 Bacteria 1543
913 Ga0373931_0120100 3300035691 Bacteria 1501
914 Ga0373935_0010280 3300035692 Bacteria 5611
915 Ga0373935_0355435 3300035692 Bacteria 1045
916 Ga0373927_0875702 3300035695 Bacteria 593
917 Ga0373947_0983036 3300035725 Unclassified 576
918 Ga0373937_0957296 3300036401 Bacteria 805
919 Ga0373925_0135488 3300037068 Bacteria 1924
920 Ga0373925_1651639 3300037068 Bacteria 523
921 Ga0373925_1760114 3300037068 Bacteria 506
922 Ga0395899_0000820 3300037312 Bacteria 30249
923 Ga0395899_0013958 3300037312 Bacteria 6134
924 Ga0395899_0027311 3300037312 Bacteria 4304
925 Ga0395899_0028620 3300037312 Bacteria 4194
926 Ga0395899_0033684 3300037312 Bacteria 3846
927 Ga0395899_0041491 3300037312 Bacteria 3438
928 Ga0395899_0048855 3300037312 Bacteria 3146
929 Ga0395899_0052464 3300037312 Bacteria 3022
930 Ga0395899_0136179 3300037312 Bacteria 1750
931 Ga0395899_0136623 3300037312 Bacteria 1747
932 Ga0395899_0187583 3300037312 Bacteria 1448
933 Ga0395899_0207581 3300037312 Bacteria 1363
934 Ga0395899_0234445 3300037312 Bacteria 1266
935 Ga0395899_0264370 3300037312 Bacteria 1175
936 Ga0395899_0297066 3300037312 Bacteria 1094
937 Ga0395899_0314272 3300037312 Bacteria 1057
938 Ga0395899_0354231 3300037312 Bacteria 981
939 Ga0395899_0385679 3300037312 Bacteria 930
940 Ga0395899_0471921 3300037312 Bacteria 818
941 Ga0395899_0943788 3300037312 Unclassified 523
942 Ga0395900_0000192 3300037418 Bacteria 98186
943 Ga0395900_0000289 3300037418 Bacteria 75525
944 Ga0395900_0002088 3300037418 Bacteria 22392
945 Ga0395900_0009433 3300037418 Bacteria 10004
946 Ga0395900_0051186 3300037418 Bacteria 4255
947 Ga0395900_0073045 3300037418 Bacteria 3526
948 Ga0395900_0074906 3300037418 Bacteria 3479
949 Ga0395900_0091822 3300037418 Bacteria 3119
950 Ga0395900_0110557 3300037418 Bacteria 2823
951 Ga0395900_0124425 3300037418 Bacteria 2644
952 Ga0395900_0132805 3300037418 Bacteria 2550
953 Ga0395900_0146838 3300037418 Bacteria 2411
954 Ga0395900_0147380 3300037418 Bacteria 2406
955 Ga0395900_0160655 3300037418 Bacteria 2292
956 Ga0395900_0170139 3300037418 Bacteria 2219
957 Ga0395900_0172213 3300037418 Bacteria 2203
958 Ga0395900_0214540 3300037418 Bacteria 1942
959 Ga0395900_0224828 3300037418 Bacteria 1890
960 Ga0395900_0224991 3300037418 Bacteria 1889
961 Ga0395900_0236324 3300037418 Bacteria 1835
962 Ga0395900_0259595 3300037418 Bacteria 1736
963 Ga0395900_0269835 3300037418 Bacteria 1696
964 Ga0395900_0478224 3300037418 Bacteria 1198
965 Ga0395900_1023105 3300037418 Bacteria 745
966 Ga0395900_1620937 3300037418 Bacteria 558
967 Ga0395900_1816594 3300037418 Bacteria 520
968 Ga0395898_0000055 3300037466 Bacteria 278557
969 Ga0395898_0017933 3300037466 Bacteria 7223
970 Ga0395898_0018903 3300037466 Bacteria 7020
971 Ga0395898_0025578 3300037466 Bacteria 5946
972 Ga0395898_0037462 3300037466 Bacteria 4810
973 Ga0395898_0054501 3300037466 Bacteria 3902
974 Ga0395898_0065239 3300037466 Bacteria 3530
975 Ga0395898_0079676 3300037466 Bacteria 3159
976 Ga0395898_0134850 3300037466 Bacteria 2364
977 Ga0395898_0162933 3300037466 Bacteria 2133
978 Ga0395898_0234346 3300037466 Bacteria 1750
979 Ga0395898_0263033 3300037466 Bacteria 1645
980 Ga0395898_0354833 3300037466 Bacteria 1398
981 Ga0395898_0626844 3300037466 Bacteria 1018
982 Ga0395898_1279906 3300037466 Bacteria 663
983 Ga0395898_1941918 3300037466 Bacteria 508
984 Ga0395905_0000067 3300037471 Bacteria 181887
985 Ga0395905_0000187 3300037471 Bacteria 98895
986 Ga0395905_0007771 3300037471 Bacteria 10635
987 Ga0395905_0010406 3300037471 Bacteria 9055
988 Ga0395905_0011321 3300037471 Bacteria 8626
989 Ga0395905_0013361 3300037471 Bacteria 7868
990 Ga0395905_0026054 3300037471 Bacteria 5514
991 Ga0395905_0027580 3300037471 Bacteria 5355
992 Ga0395905_0030397 3300037471 Bacteria 5089
993 Ga0395905_0041513 3300037471 Bacteria 4317
994 Ga0395905_0047957 3300037471 Bacteria 4003
995 Ga0395905_0086904 3300037471 Bacteria 2931
996 Ga0395905_0105787 3300037471 Bacteria 2642
997 Ga0395905_0145809 3300037471 Bacteria 2227
998 Ga0395905_0145939 3300037471 Bacteria 2226
999 Ga0395905_0146274 3300037471 Bacteria 2223
1000 Ga0395905_0193698 3300037471 Bacteria 1906
1001 Ga0395905_0243895 3300037471 Bacteria 1678
1002 Ga0395905_0301746 3300037471 Bacteria 1489
1003 Ga0395905_0307360 3300037471 Bacteria 1474
1004 Ga0395905_0367087 3300037471 Unclassified 1332
1005 Ga0395905_0419951 3300037471 Bacteria 1233
1006 Ga0395905_0436735 3300037471 Bacteria 1206
1007 Ga0395905_0458461 3300037471 Bacteria 1173
1008 Ga0395905_0585249 3300037471 Bacteria 1018
1009 Ga0395905_0741547 3300037471 Bacteria 884
1010 Ga0395905_0774071 3300037471 Bacteria 862
1011 Ga0395905_0788346 3300037471 Bacteria 853
1012 Ga0395905_0818074 3300037471 Bacteria 834
1013 Ga0395905_0908737 3300037471 Viruses 783
1014 Ga0395905_1736283 3300037471 Bacteria 529
1015 Ga0395901_0000876 3300038443 Bacteria 33203
1016 Ga0395901_0001001 3300038443 Bacteria 30549
1017 Ga0395901_0008643 3300038443 Bacteria 10289
1018 Ga0395901_0042744 3300038443 Bacteria 4699
1019 Ga0395901_0069858 3300038443 Bacteria 3658
1020 Ga0395901_0071430 3300038443 Bacteria 3617
1021 Ga0395901_0075945 3300038443 Bacteria 3505
1022 Ga0395901_0098155 3300038443 Bacteria 3071
1023 Ga0395901_0120861 3300038443 Bacteria 2752
1024 Ga0395901_0136429 3300038443 Bacteria 2578
1025 Ga0395901_0144186 3300038443 Bacteria 2503
1026 Ga0395901_0171114 3300038443 Bacteria 2279
1027 Ga0395901_0178380 3300038443 Bacteria 2228
1028 Ga0395901_0255981 3300038443 Bacteria 1823
1029 Ga0395901_0270821 3300038443 Bacteria 1766
1030 Ga0395901_0286360 3300038443 Bacteria 1711
1031 Ga0395901_0307473 3300038443 Bacteria 1642
1032 Ga0395901_0451381 3300038443 Bacteria 1315
1033 Ga0395901_0587507 3300038443 Unclassified 1124
1034 Ga0395901_0767085 3300038443 Bacteria 956
1035 Ga0395901_0831007 3300038443 Bacteria 910
1036 Ga0395901_2097313 3300038443 Bacteria 510
1037 Ga0436363_1203780 3300039450 Bacteria 980
1038 Ga0439432_056515 3300042006 Bacteria 1216
1039 Ga0439449_0428504 3300042007 Bacteria 502
1040 Ga0439455_0014122 3300042012 Bacteria 1819
1041 Ga0439458_0000200 3300042157 Bacteria 13792
1042 Ga0439458_0001085 3300042157 Bacteria 6932
1043 Ga0466969_0217010 3300044656 Unclassified 870
1044 Ga0466969_0329713 3300044656 Bacteria 691
1045 Ga0466972_0378908 3300044658 Unclassified 662
1046 Ga0466972_0380235 3300044658 Bacteria 661
1047 Ga0466972_0481285 3300044658 Bacteria 584
1048 Ga0466965_0307438 3300044683 Bacteria 861
1049 Ga0466965_0539905 3300044683 Bacteria 657
1050 Ga0466966_0036316 3300044684 Bacteria 3182
1051 Ga0466966_0101252 3300044684 Bacteria 1782
1052 Ga0466966_0128130 3300044684 Bacteria 1555
1053 Ga0466966_0511045 3300044684 Bacteria 723
1054 Ga0466966_0647439 3300044684 Bacteria 636
1055 Ga0466966_0707074 3300044684 Unclassified 607
1056 Ga0466961_0032089 3300044693 Bacteria 3375
1057 Ga0466961_0065392 3300044693 Bacteria 2310
1058 Ga0466961_0100860 3300044693 Bacteria 1818
1059 Ga0466961_0118767 3300044693 Unclassified 1661
1060 Ga0466961_0227811 3300044693 Bacteria 1147
1061 Ga0466961_0335521 3300044693 Unclassified 921
1062 Ga0466961_0424693 3300044693 Unclassified 805
1063 Ga0466961_0585191 3300044693 Bacteria 671
1064 Ga0466963_0032081 3300044694 Bacteria 3399
1065 Ga0466963_0076635 3300044694 Bacteria 2258
1066 Ga0466963_0082662 3300044694 Bacteria 2177
1067 Ga0466963_0109356 3300044694 Bacteria 1896
1068 Ga0466963_0132128 3300044694 Bacteria 1725
1069 Ga0466963_0267908 3300044694 Bacteria 1200
1070 Ga0466963_0499754 3300044694 Bacteria 858
1071 Ga0466964_0194482 3300044706 Bacteria 970
1072 Ga0466964_0623726 3300044706 Bacteria 594
1073 Ga0466964_0640421 3300044706 Bacteria 587
1074 Ga0466971_0014594 3300044719 Bacteria 3458
1075 Ga0466971_0016023 3300044719 Bacteria 3304
1076 Ga0466971_0157623 3300044719 Bacteria 1061
1077 Ga0466971_0505875 3300044719 Bacteria 596
1078 Ga0466971_0633737 3300044719 Bacteria 534
1079 Ga0466968_0002826 3300044735 Bacteria 6418
1080 Ga0466968_0126804 3300044735 Bacteria 1159
1081 Ga0466970_0030964 3300044765 Bacteria 2824
1082 Ga0466970_0050154 3300044765 Bacteria 2226
1083 Ga0466970_0156747 3300044765 Bacteria 1258
1084 Ga0466970_0209665 3300044765 Bacteria 1085
1085 Ga0466970_0277096 3300044765 Bacteria 943
1086 Ga0466970_0352922 3300044765 Bacteria 835
1087 Ga0466957_0002842 3300044842 Bacteria 9366
1088 Ga0466957_0069559 3300044842 Bacteria 2174
1089 Ga0466957_0075879 3300044842 Bacteria 2086
1090 Ga0466957_0314474 3300044842 Bacteria 1055
1091 Ga0466957_0410112 3300044842 Bacteria 928
1092 Ga0466957_0816740 3300044842 Unclassified 663
1093 Ga0466960_0283295 3300044901 Bacteria 929
1094 Ga0466959_0104806 3300045049 Bacteria 2022
1095 Ga0466959_0126056 3300045049 Bacteria 1817
1096 Ga0466959_0294326 3300045049 Bacteria 1112
1097 Ga0466959_0603607 3300045049 Bacteria 738
1098 Ga0466959_0658861 3300045049 Bacteria 702
1099 Ga0466959_0930497 3300045049 Bacteria 580
1100 Ga0466958_0004199 3300045836 Bacteria 7574
1101 Ga0466958_0034292 3300045836 Bacteria 3027
1102 Ga0466958_0051561 3300045836 Bacteria 2491
1103 Ga0466958_0297992 3300045836 Bacteria 1035
1104 Ga0466958_0304624 3300045836 Bacteria 1023
1105 Ga0466958_0454463 3300045836 Bacteria 829
1106 Ga0466967_0052898 3300045976 Bacteria 3567
1107 Ga0466967_0069711 3300045976 Bacteria 3143
1108 Ga0466967_0126989 3300045976 Bacteria 2363
1109 Ga0466967_0515530 3300045976 Bacteria 1174
1110 Ga0466967_0540541 3300045976 Bacteria 1146
1111 Ga0466967_0564074 3300045976 Bacteria 1121
1112 Ga0466967_0677985 3300045976 Bacteria 1020
1113 Ga0466967_0679417 3300045976 Bacteria 1019
1114 Ga0466967_1415001 3300045976 Bacteria 693
1115 Ga0495606_0591392 3300046507 Unclassified 546
1116 Ga0495610_0332119 3300046512 Bacteria 577
1117 Ga0495616_0048159 3300046513 Bacteria 2143
1118 Ga0495663_0087926 3300046525 Bacteria 1009
1119 Ga0495663_0118494 3300046525 Unclassified 885
1120 Ga0495663_0196218 3300046525 Bacteria 703
1121 Ga0495642_0084158 3300046528 Bacteria 1342
1122 Ga0495654_0109236 3300046530 Bacteria 1264
1123 Ga0495598_0001042 3300046537 Bacteria 5327
1124 Ga0495621_0000147 3300046539 Bacteria 15233
1125 Ga0495668_0028799 3300046616 Bacteria 3139
1126 Ga0495625_0406072 3300046660 Bacteria 850
1127 Ga0495669_0000090 3300046684 Bacteria 60222
1128 Ga0495669_0017854 3300046684 Bacteria 3046
1129 Ga0495669_0024887 3300046684 Bacteria 2608
1130 Ga0495669_0034674 3300046684 Bacteria 2225
1131 Ga0495669_0039499 3300046684 Bacteria 2090
1132 Ga0495669_0093531 3300046684 Bacteria 1390
1133 Ga0495669_0553963 3300046684 Bacteria 559
1134 Ga0495670_0000192 3300046691 Bacteria 27204
1135 Ga0495683_0151061 3300047323 Bacteria 1081
1136 Ga0495677_0002796 3300047445 Bacteria 6809
1137 Ga0495685_079039 3300047447 Bacteria 1096
1138 Ga0495681_0307301 3300047470 Bacteria 612
1139 Ga0496100_0011228 3300048903 Bacteria 5094
1140 Ga0496100_0014810 3300048903 Bacteria 4537
1141 Ga0496100_0482107 3300048903 Bacteria 954
1142 Ga0496101_0009177 3300048904 Bacteria 6491
1143 Ga0496101_0012548 3300048904 Bacteria 5657
1144 Ga0496102_0070756 3300048905 Bacteria 3203
1145 Ga0496102_1552210 3300048905 Archaea 581
1146 Ga0496102_1587418 3300048905 Bacteria 573
1147 Ga0496103_0066432 3300048906 Bacteria 2251
1148 Ga0496103_0116738 3300048906 Bacteria 1698
1149 Ga0496104_0098857 3300048907 Bacteria 2793
1150 Ga0496104_0530611 3300048907 Bacteria 1088
1151 Ga0496105_0075364 3300048908 Bacteria 2786
1152 Ga0496106_0100069 3300048909 Bacteria 2248
1153 Ga0496106_0160847 3300048909 Bacteria 1776
1154 Ga0496106_0199554 3300048909 Bacteria 1592
1155 Ga0496106_0228992 3300048909 Bacteria 1484
1156 Ga0496107_0057001 3300048910 Bacteria 2824
1157 Ga0496107_0144210 3300048910 Bacteria 1760
1158 Ga0496107_0679308 3300048910 Bacteria 758
1159 Ga0496107_1181890 3300048910 Archaea 550
1160 Ga0496108_0006295 3300048911 Bacteria 9622
1161 Ga0496108_0032108 3300048911 Bacteria 4359
1162 Ga0496108_0034504 3300048911 Bacteria 4204
1163 Ga0496109_0081202 3300048912 Bacteria 2987
1164 Ga0496109_0104842 3300048912 Bacteria 2625
1165 Ga0496109_0170712 3300048912 Bacteria 2040
1166 Ga0496109_0333644 3300048912 Bacteria 1432
1167 Ga0496109_0578099 3300048912 Bacteria 1059
1168 Ga0496109_1140489 3300048912 Bacteria 716
1169 Ga0496110_0034694 3300048913 Bacteria 4372
1170 Ga0496110_0166823 3300048913 Bacteria 1997
1171 Ga0496110_0271981 3300048913 Bacteria 1542
1172 Ga0496110_0377317 3300048913 Bacteria 1292
1173 Ga0496110_0443455 3300048913 Bacteria 1183
1174 Ga0496111_0054622 3300048914 Bacteria 2887
1175 Ga0496111_0391135 3300048914 Bacteria 1028
1176 Ga0496111_0622225 3300048914 Bacteria 789
1177 Ga0496111_0818921 3300048914 Bacteria 673
1178 Ga0496112_0028192 3300048915 Bacteria 5417
1179 Ga0496112_0051599 3300048915 Bacteria 4034
1180 Ga0496112_0055936 3300048915 Bacteria 3882
1181 Ga0496112_0099954 3300048915 Bacteria 2871
1182 Ga0496112_0306060 3300048915 Bacteria 1534
1183 Ga0496112_0884937 3300048915 Bacteria 815
1184 Ga0496112_1514121 3300048915 Unclassified 585
1185 Ga0496112_1818150 3300048915 Bacteria 521
1186 Ga0496113_0033465 3300048916 Bacteria 3742
1187 Ga0496113_0077662 3300048916 Bacteria 2539
1188 Ga0496113_0160137 3300048916 Bacteria 1779
1189 Ga0496113_0228164 3300048916 Bacteria 1485
1190 Ga0496113_0591756 3300048916 Bacteria 888
1191 Ga0496114_0000029 3300048917 Bacteria 175132
1192 Ga0496114_0049302 3300048917 Bacteria 3503
1193 Ga0496114_0550773 3300048917 Bacteria 1019
1194 Ga0496115_0014491 3300048918 Bacteria 5969
1195 Ga0501067_0039345 3300049583 Bacteria 2626
1196 Ga0501069_0143306 3300049585 Bacteria 1371
1197 Ga0501209_008712 3300049656 Bacteria 2014
1198 Ga0501217_008990 3300049661 Bacteria 2167
1199 Ga0501224_028008 3300049664 Bacteria 843
1200 Ga0501227_163493 3300049665 Bacteria 620
1201 Ga0501235_009844 3300049669 Bacteria 2091
1202 Ga0501246_049130 3300049676 Bacteria 524
1203 Ga0501259_072848 3300049688 Bacteria 740
1204 Ga0501221_022686 3300049704 Unclassified 1246
1205 Ga0501225_0118686 3300049705 Bacteria 784
1206 Ga0501225_0148409 3300049705 Bacteria 713
1207 Ga0501268_006619 3300049765 Bacteria 1708
1208 Ga0501272_010667 3300049769 Bacteria 1028
1209 Ga0501273_031171 3300049770 Bacteria 759
1210 nmdc:mga0k408_134172_c1 3300050493 Bacteria 1470
1211 nmdc:mga05p37_703528_c1 3300050507 Bacteria 1122
1212 Ga0495655_0029703 3300053083 Bacteria 1316
1213 Ga0466962_0010032 3300061719 Bacteria 4546
1214 Ga0466962_0034165 3300061719 Bacteria 2433
1215 Ga0466962_0042195 3300061719 Bacteria 2183
1216 Ga0466962_0106804 3300061719 Bacteria 1347
1217 Ga0466962_0115307 3300061719 Bacteria 1294
1218 Ga0466962_0145143 3300061719 Bacteria 1150
1219 Ga0466962_0282984 3300061719 Bacteria 819
1220 Ga0530510_0364812 3300061734 Bacteria 1086
1221 Ga0395899_0223000
1222 JGI24736J21556_1004722
1223 JGI24741J21665_1046452
1224 JGI24746J21847_1017168
1225 JGI24747J21853_1033856
1226 JGI24740J21852_10010055
1227 JGI24740J21852_10010350
1228 JGI24740J21852_10039731
1229 JGI24740J21852_10061802
1230 JGI24740J21852_10130720
1231 JGI24740J21852_10156182
1232 JGI24739J22299_10051984
1233 JGI24739J22299_10106244
1234 JGI24739J22299_10176764
1235 JGI24739J22299_10238995
1236 JGI24737J22298_10000566
1237 JGI24737J22298_10005431
1238 JGI24737J22298_10036727
1239 JGI24737J22298_10153272
1240 JGI24737J22298_10174141
1241 JGI24743J22301_10077922
1242 JGI24743J22301_10104657
1243 JGI24735J21928_10017310
1244 JGI24735J21928_10042794
1245 JGI24735J21928_10135016
1246 JGI24735J21928_10166916
1247 JGI24735J21928_10173315
1248 JGI24735J21928_10192402
1249 JGI24750J21931_1046651
1250 JGI24745J21846_1004912
1251 JGI24738J21930_10007870
1252 JGI24738J21930_10115434
1253 JGI24744J21845_10001038
1254 JGI24742J22300_10115361
1255 JGI24751J29686_10044481
1256 Ga0065712_10366519
1257 Ga0065712_10564523
1258 Ga0065715_10113151
1259 Ga0070658_10012287
1260 Ga0070658_10043030
1261 Ga0070658_10085977
1262 Ga0070658_10111834
1263 Ga0070658_10190715
1264 Ga0070658_10235694
1265 Ga0070658_10246127
1266 Ga0070658_10625655
1267 Ga0070658_10629675
1268 Ga0070658_10660029
1269 Ga0070658_10780882
1270 Ga0070676_10056606
1271 Ga0070676_10167691
1272 Ga0070676_10577231
1273 Ga0070676_10635875
1274 Ga0070676_10830041
1275 Ga0070683_100065398
1276 Ga0070683_100112894
1277 Ga0070683_100304436
1278 Ga0070683_100620877
1279 Ga0070683_101331524
1280 Ga0070690_100017691
1281 Ga0070690_100037331
1282 Ga0070690_100317922
1283 Ga0070690_100659722
1284 Ga0070690_101170355
1285 Ga0070670_100013782
1286 Ga0070670_100028376
1287 Ga0070670_100078428
1288 Ga0070670_100360553
1289 Ga0070670_100487701
1290 Ga0070670_100488410
1291 Ga0070670_100954247
1292 Ga0070670_101001706
1293 Ga0070670_101621391
1294 Ga0070677_10006803
1295 Ga0070677_10178205
1296 Ga0068869_100112064
1297 Ga0070666_10000175
1298 Ga0070666_10037876
1299 Ga0070666_10044867
1300 Ga0070666_10048254
1301 Ga0070666_10120918
1302 Ga0070666_10259447
1303 Ga0070666_10374747
1304 Ga0070680_100001497
1305 Ga0070680_100004504
1306 Ga0070680_100005002
1307 Ga0070680_100070158
1308 Ga0070680_100086601
1309 Ga0070680_100139055
1310 Ga0070680_100150638
1311 Ga0070680_100567149
1312 Ga0070682_100033548
1313 Ga0070682_100540579
1314 Ga0070682_102009184
1315 Ga0068868_100005026
1316 Ga0068868_100136639
1317 Ga0068868_100171652
1318 Ga0068868_100260322
1319 Ga0068868_100311361
1320 Ga0068868_100435091
1321 Ga0068868_100514905
1322 Ga0070660_100002929
1323 Ga0070660_100004849
1324 Ga0070660_100010107
1325 Ga0070660_100069281
1326 Ga0070660_100072533
1327 Ga0070660_100153990
1328 Ga0070660_100198345
1329 Ga0070660_100221499
1330 Ga0070660_100247369
1331 Ga0070660_100474933
1332 Ga0070660_101936629
1333 Ga0070689_100685167
1334 Ga0070691_10007681
1335 Ga0070687_100078455
1336 Ga0070687_100172350
1337 Ga0070687_100740959
1338 Ga0070661_100025857
1339 Ga0070661_100031729
1340 Ga0070661_100042821
1341 Ga0070661_100081680
1342 Ga0070661_100085386
1343 Ga0070661_100110185
1344 Ga0070661_100186719
1345 Ga0070661_100330324
1346 Ga0070661_100487128
1347 Ga0070661_100498135
1348 Ga0070661_101213789
1349 Ga0070661_101223586
1350 Ga0070661_101601629
1351 Ga0070692_10084473
1352 Ga0070692_10406321
1353 Ga0070692_11381476
1354 Ga0070668_100154730
1355 Ga0070668_101362690
1356 Ga0070669_100344238
1357 Ga0070669_101521364
1358 Ga0070675_100029277
1359 Ga0070675_100060523
1360 Ga0070675_100144809
1361 Ga0070675_100617440
1362 Ga0070675_100618675
1363 Ga0070671_100033713
1364 Ga0070671_100036368
1365 Ga0070671_100041538
1366 Ga0070671_100061904
1367 Ga0070671_100079204
1368 Ga0070671_100082985
1369 Ga0070671_100165891
1370 Ga0070671_100188263
1371 Ga0070671_100585105
1372 Ga0070671_100718102
1373 Ga0070671_100805933
1374 Ga0070671_100863584
1375 Ga0070671_101006124
1376 Ga0070674_100001005
1377 Ga0070674_100002384
1378 Ga0070674_100003417
1379 Ga0070674_100190704
1380 Ga0070674_100274456
1381 Ga0070674_100391767
1382 Ga0070674_101092441
1383 Ga0070673_100018889
1384 Ga0070673_100024881
1385 Ga0070673_100064594
1386 Ga0070673_100136180
1387 Ga0070673_100297020
1388 Ga0070673_100334026
1389 Ga0070673_100552076
1390 Ga0070673_100854552
1391 Ga0070673_100945142
1392 Ga0070673_101822685
1393 Ga0070659_100000992
1394 Ga0070659_100060638
1395 Ga0070659_100065109
1396 Ga0070659_100096717
1397 Ga0070659_100132528
1398 Ga0070659_100271439
1399 Ga0070659_100285564
1400 Ga0070659_101513816
1401 Ga0070659_101627988
1402 Ga0070667_100001408
1403 Ga0070667_100003855
1404 Ga0070667_100037678
1405 Ga0070667_100058269
1406 Ga0070667_100130200
1407 Ga0070667_100380743
1408 Ga0070667_100619459
1409 Ga0070709_10092207
1410 Ga0070709_10666154
1411 Ga0070714_100021525
1412 Ga0070714_100152872
1413 Ga0070714_100212103
1414 Ga0070714_100653463
1415 Ga0070713_100091585
1416 Ga0070713_100311843
1417 Ga0070713_100332155
1418 Ga0070713_100431727
1419 Ga0070710_10489712
1420 Ga0070700_101972452
1421 Ga0070663_100005666
1422 Ga0070663_100030678
1423 Ga0070663_100053126
1424 Ga0070663_100066161
1425 Ga0070663_100097419
1426 Ga0070663_100255396
1427 Ga0070663_100278271
1428 Ga0070663_100488604
1429 Ga0070663_100585431
1430 Ga0070663_100669554
1431 Ga0070663_101948127
1432 Ga0070678_100010289
1433 Ga0070678_100016637
1434 Ga0070678_100026069
1435 Ga0070678_100026663
1436 Ga0070678_100258162
1437 Ga0070678_101242883
1438 Ga0070662_100011388
1439 Ga0070662_100015039
1440 Ga0070662_100060258
1441 Ga0070662_100087940
1442 Ga0070662_100163879
1443 Ga0070662_100300625
1444 Ga0070662_100301228
1445 Ga0070662_100375857
1446 Ga0070662_100450216
1447 Ga0070662_100550430
1448 Ga0070662_101760569
1449 Ga0070681_10088373
1450 Ga0070681_10100772
1451 Ga0070681_10184084
1452 Ga0070681_10261760
1453 Ga0070681_10654224
1454 Ga0070681_10691043
1455 Ga0068867_100036903
1456 Ga0068867_100047648
1457 Ga0068867_100135803
1458 Ga0068867_101500982
1459 Ga0070685_10662632
1460 Ga0070679_100002835
1461 Ga0070679_100188527
1462 Ga0070679_100254282
1463 Ga0070679_100477135
1464 Ga0070679_100575799
1465 Ga0070679_101933853
1466 Ga0070684_100001026
1467 Ga0070684_100010648
1468 Ga0070684_100283093
1469 Ga0070684_100358506
1470 Ga0070684_101408071
1471 Ga0068853_100096431
1472 Ga0068853_100436807
1473 Ga0068853_100448174
1474 Ga0068853_100452439
1475 Ga0068853_101167923
1476 Ga0068853_101296844
1477 Ga0068853_101765925
1478 Ga0070672_100052473
1479 Ga0070672_100074979
1480 Ga0070672_100087333
1481 Ga0070672_100144325
1482 Ga0070672_100158953
1483 Ga0070672_100244804
1484 Ga0070686_100048833
1485 Ga0070686_101536529
1486 Ga0070693_100246076
1487 Ga0070693_100405267
1488 Ga0070665_100016180
1489 Ga0070665_100017108
1490 Ga0070665_100090739
1491 Ga0070665_100210216
1492 Ga0070665_100300202
1493 Ga0070665_102322193
1494 Ga0068855_100002695
1495 Ga0068855_100053402
1496 Ga0068855_100189392
1497 Ga0068855_100259419
1498 Ga0068855_100310710
1499 Ga0068855_100335081
1500 Ga0068855_100464672
1501 Ga0070664_100001303
1502 Ga0070664_100007167
1503 Ga0070664_100101010
1504 Ga0070664_100105231
1505 Ga0070664_100138761
1506 Ga0070664_100168428
1507 Ga0070664_100243020
1508 Ga0070664_100374067
1509 Ga0070664_100378031
1510 Ga0070664_101035195
1511 Ga0070664_101285577
1512 Ga0070664_102133742
1513 Ga0068857_100056859
1514 Ga0068857_100076385
1515 Ga0068857_100147825
1516 Ga0068857_100682976
1517 Ga0068857_100775264
1518 Ga0068854_100010218
1519 Ga0068854_100024573
1520 Ga0068854_100078770
1521 Ga0068854_100080593
1522 Ga0068854_100083096
1523 Ga0068854_100157849
1524 Ga0068854_100246603
1525 Ga0068854_100271197
1526 Ga0068854_100279126
1527 Ga0068854_100392183
1528 Ga0068854_100407474
1529 Ga0068854_100417752
1530 Ga0068854_101070694
1531 Ga0068854_101178586
1532 Ga0068856_100008516
1533 Ga0068856_100015328
1534 Ga0068856_100021054
1535 Ga0068856_100105379
1536 Ga0068856_100207413
1537 Ga0068856_100325425
1538 Ga0068856_100435380
1539 Ga0068856_101164317
1540 Ga0068856_101569471
1541 Ga0068856_101781955
1542 Ga0068856_102155405
1543 Ga0068856_102418707
1544 Ga0070702_100132735
1545 Ga0068852_100045843
1546 Ga0068852_100084067
1547 Ga0068852_100097361
1548 Ga0068852_100104368
1549 Ga0068852_100114799
1550 Ga0068852_100186681
1551 Ga0068852_100278799
1552 Ga0068852_100454063
1553 Ga0068852_100484433
1554 Ga0068852_100521181
1555 Ga0068852_100563665
1556 Ga0068852_100577638
1557 Ga0068852_100708604
1558 Ga0068852_101164424
1559 Ga0068852_101621283
1560 Ga0068852_101858664
1561 Ga0068859_100170610
1562 Ga0068859_100457861
1563 Ga0068859_100785833
1564 Ga0068864_100020708
1565 Ga0068864_100021379
1566 Ga0068864_100050044
1567 Ga0068864_100132444
1568 Ga0068866_10121538
1569 Ga0068866_10168328
1570 Ga0068851_10042734
1571 Ga0068851_10074982
1572 Ga0068851_10111378
1573 Ga0068851_10275354
1574 Ga0068851_11005373
1575 Ga0068870_10193938
1576 Ga0068870_10204447
1577 Ga0068870_10402729
1578 Ga0068863_100016025
1579 Ga0068863_100083929
1580 Ga0068863_101131732
1581 Ga0068858_100001465
1582 Ga0068858_100013766
1583 Ga0068858_100542598
1584 Ga0068858_101842031
1585 Ga0068860_100370246
1586 Ga0068860_101277321
1587 Ga0068860_101794880
1588 Ga0068860_102703822
1589 Ga0068862_102463249
1590 Ga0081539_10046420
1591 Ga0070717_10002133
1592 Ga0070717_11807134
1593 Ga0070716_100293685
1594 Ga0070712_100381466
1595 Ga0075366_10362750
1596 Ga0097621_100165162
1597 Ga0097621_100221346
1598 Ga0097621_100235097
1599 Ga0097621_101346496
1600 Ga0097621_101537420
1601 Ga0068871_100023026
1602 Ga0068871_100117526
1603 Ga0068871_100172437
1604 Ga0068865_100010238
1605 Ga0068865_100016591
1606 Ga0068865_100059132
1607 Ga0068865_100082000
1608 Ga0068865_100285244
1609 Ga0097620_100170609
1610 Ga0097620_100457863
1611 Ga0097620_100785934
1612 Ga0105251_10357094
1613 Ga0105240_10047579
1614 Ga0105240_10262723
1615 Ga0105240_10295419
1616 Ga0105240_10949497
1617 Ga0105245_10051816
1618 Ga0105245_10073009
1619 Ga0105245_10228184
1620 Ga0105247_10302189
1621 Ga0114129_10894455
1622 Ga0105243_10111137
1623 Ga0105243_10341269
1624 Ga0105241_10547908
1625 Ga0105241_11582991
1626 Ga0105241_11930957
1627 Ga0105242_10079951
1628 Ga0105242_10812877
1629 Ga0105248_10000818
1630 Ga0105248_10008738
1631 Ga0105248_10015579
1632 Ga0105248_10170905
1633 Ga0105248_10179809
1634 Ga0105248_10185409
1635 Ga0105248_10238645
1636 Ga0105248_10239851
1637 Ga0105248_10507897
1638 Ga0105248_10705912
1639 Ga0105248_11077989
1640 Ga0105248_11085213
1641 Ga0105248_11910235
1642 Ga0105237_10058748
1643 Ga0105237_10063517
1644 Ga0105237_10918133
1645 Ga0105237_10982783
1646 Ga0105238_10006724
1647 Ga0105238_10012329
1648 Ga0105238_10285741
1649 Ga0105238_10881053
1650 Ga0105238_11267486
1651 Ga0105249_12431918
1652 Ga0105239_10135243
1653 Ga0105246_10096885
1654 Ga0105246_10151728
1655 Ga0105246_10296711
1656 Ga0105246_10508711
1657 Ga0157373_10061289
1658 Ga0157373_10084448
1659 Ga0157373_10111875
1660 Ga0157373_10116964
1661 Ga0157373_10177730
1662 Ga0157373_10179520
1663 Ga0157373_10185641
1664 Ga0157373_10194433
1665 Ga0157373_10371180
1666 Ga0157373_10828710
1667 Ga0157373_11191322
1668 Ga0157371_10067992
1669 Ga0157371_10072232
1670 Ga0157371_10118533
1671 Ga0157371_10154417
1672 Ga0157371_10236689
1673 Ga0157371_10332500
1674 Ga0157371_10433709
1675 Ga0157371_10584681
1676 Ga0157371_11140197
1677 Ga0157371_11470201
1678 Ga0157370_10023539
1679 Ga0157370_10041873
1680 Ga0157370_10146994
1681 Ga0157370_10152711
1682 Ga0157370_10182286
1683 Ga0157370_10219779
1684 Ga0157370_10233182
1685 Ga0157370_10350767
1686 Ga0157370_10415147
1687 Ga0157370_10516581
1688 Ga0157370_11410258
1689 Ga0157369_10006384
1690 Ga0157369_10072149
1691 Ga0157369_10168231
1692 Ga0157369_10197598
1693 Ga0157369_10198459
1694 Ga0157369_10406305
1695 Ga0157369_10527315
1696 Ga0157369_10598892
1697 Ga0157369_10675592
1698 Ga0157369_11276108
1699 Ga0157369_11508391
1700 Ga0157369_12647193
1701 Ga0157369_12704464
1702 Ga0157374_10076429
1703 Ga0157374_10123807
1704 Ga0157374_10124650
1705 Ga0157374_10573325
1706 Ga0157374_11134381
1707 Ga0157378_10083158
1708 Ga0157378_10085141
1709 Ga0157378_10368703
1710 Ga0157378_12812028
1711 Ga0163162_10017617
1712 Ga0163162_10126667
1713 Ga0163162_10439892
1714 Ga0163162_10445797
1715 Ga0157372_10131090
1716 Ga0157372_10193340
1717 Ga0157372_10342320
1718 Ga0157372_10963412
1719 Ga0157372_11002785
1720 Ga0157372_11737749
1721 Ga0157372_12076607
1722 Ga0157375_10040943
1723 Ga0157375_10045518
1724 Ga0157375_10077378
1725 Ga0157375_10173056
1726 Ga0157375_10216120
1727 Ga0157375_10232399
1728 Ga0157375_10465657
1729 Ga0163163_10017377
1730 Ga0163163_10221024
1731 Ga0163163_10319923
1732 Ga0163163_11002867
1733 Ga0182008_10352286
1734 Ga0157377_10041554
1735 Ga0157377_11379374
1736 Ga0157379_10084893
1737 Ga0157379_10197261
1738 Ga0157379_10693008
1739 Ga0157376_10212607
1740 Ga0157376_12181487
1741 Ga0163161_10057282
1742 Ga0163161_10483399
1743 Ga0163161_10536817
1744 Ga0163161_10566723
1745 Ga0163161_10646849
1746 Ga0163161_11678223
1747 Ga0206353_10762675
1748 Ga0213876_10578853
1749 Ga0207697_10017711
1750 Ga0207656_10033926
1751 Ga0207656_10041510
1752 Ga0207656_10073490
1753 Ga0207682_10027136
1754 Ga0207682_10197961
1755 Ga0207710_10199879
1756 Ga0207688_10030565
1757 Ga0207688_10137514
1758 Ga0207688_10145661
1759 Ga0207688_10237757
1760 Ga0207688_10305284
1761 Ga0207688_10632414
1762 Ga0207680_10003241
1763 Ga0207680_10016177
1764 Ga0207680_10017057
1765 Ga0207680_10062848
1766 Ga0207680_10067342
1767 Ga0207680_10123573
1768 Ga0207680_10295399
1769 Ga0207680_10459697
1770 Ga0207680_11145129
1771 Ga0207647_10003773
1772 Ga0207647_10004965
1773 Ga0207647_10006911
1774 Ga0207647_10065458
1775 Ga0207647_10130685
1776 Ga0207647_10156205
1777 Ga0207647_10594473
1778 Ga0207645_10013986
1779 Ga0207645_10088170
1780 Ga0207643_10066221
1781 Ga0207705_10000942
1782 Ga0207705_10001316
1783 Ga0207705_10023301
1784 Ga0207705_10023836
1785 Ga0207705_10066922
1786 Ga0207705_10139185
1787 Ga0207705_10422371
1788 Ga0207705_10465144
1789 Ga0207705_10543341
1790 Ga0207705_10891183
1791 Ga0207654_10140053
1792 Ga0207654_11453153
1793 Ga0207707_10016093
1794 Ga0207707_10100753
1795 Ga0207707_10331949
1796 Ga0207707_10429775
1797 Ga0207707_10476038
1798 Ga0207707_10718551
1799 Ga0207707_10835050
1800 Ga0207707_11153218
1801 Ga0207695_10049729
1802 Ga0207695_10055479
1803 Ga0207695_10433524
1804 Ga0207695_10592627
1805 Ga0207671_10049834
1806 Ga0207671_11031665
1807 Ga0207671_11344228
1808 Ga0207693_10127809
1809 Ga0207660_10000400
1810 Ga0207660_10004486
1811 Ga0207660_10007465
1812 Ga0207660_10013348
1813 Ga0207660_10130269
1814 Ga0207660_10448419
1815 Ga0207660_10487606
1816 Ga0207662_10128810
1817 Ga0207662_10315019
1818 Ga0207657_10001753
1819 Ga0207657_10005658
1820 Ga0207657_10018268
1821 Ga0207657_10037805
1822 Ga0207657_10056516
1823 Ga0207657_10064185
1824 Ga0207657_10094294
1825 Ga0207657_10132957
1826 Ga0207657_10139244
1827 Ga0207657_10141170
1828 Ga0207657_10258324
1829 Ga0207657_10263549
1830 Ga0207657_10270202
1831 Ga0207657_10429685
1832 Ga0207649_10006680
1833 Ga0207649_10041126
1834 Ga0207649_10063938
1835 Ga0207649_10087397
1836 Ga0207649_10088905
1837 Ga0207649_10118531
1838 Ga0207649_10253349
1839 Ga0207649_10276056
1840 Ga0207649_10303047
1841 Ga0207649_10396170
1842 Ga0207649_10746680
1843 Ga0207649_10820210
1844 Ga0207652_10000875
1845 Ga0207652_10294646
1846 Ga0207652_10314499
1847 Ga0207652_10612988
1848 Ga0207652_11641901
1849 Ga0207652_11653787
1850 Ga0207681_10532962
1851 Ga0207694_10069885
1852 Ga0207694_10103012
1853 Ga0207694_10859497
1854 Ga0207694_11056916
1855 Ga0207650_10008672
1856 Ga0207650_10060026
1857 Ga0207650_10134640
1858 Ga0207650_10235690
1859 Ga0207650_10480500
1860 Ga0207650_10537317
1861 Ga0207650_10806660
1862 Ga0207659_10113155
1863 Ga0207659_10289287
1864 Ga0207659_10517917
1865 Ga0207659_11039961
1866 Ga0207687_10081964
1867 Ga0207687_10141118
1868 Ga0207700_10361832
1869 Ga0207700_10477295
1870 Ga0207700_10484277
1871 Ga0207664_10058195
1872 Ga0207664_10112886
1873 Ga0207664_10137366
1874 Ga0207664_10244522
1875 Ga0207664_10470604
1876 Ga0207664_11315318
1877 Ga0207644_10001071
1878 Ga0207644_10033493
1879 Ga0207644_10049096
1880 Ga0207644_10065503
1881 Ga0207644_10073001
1882 Ga0207644_10103907
1883 Ga0207644_10323569
1884 Ga0207644_10326105
1885 Ga0207644_10422370
1886 Ga0207644_11409158
1887 Ga0207690_10001341
1888 Ga0207690_10014947
1889 Ga0207690_10019577
1890 Ga0207690_10143711
1891 Ga0207690_10283668
1892 Ga0207690_10556528
1893 Ga0207690_10630188
1894 Ga0207690_10767205
1895 Ga0207690_10777327
1896 Ga0207690_11402967
1897 Ga0207706_10013653
1898 Ga0207706_10051013
1899 Ga0207706_10070485
1900 Ga0207706_10092851
1901 Ga0207706_10095253
1902 Ga0207706_10143783
1903 Ga0207706_10157654
1904 Ga0207706_10422170
1905 Ga0207706_10549471
1906 Ga0207706_10564408
1907 Ga0207706_10587299
1908 Ga0207706_10688051
1909 Ga0207686_10107153
1910 Ga0207686_11174836
1911 Ga0207709_10120264
1912 Ga0207669_10002310
1913 Ga0207669_10207478
1914 Ga0207669_10224549
1915 Ga0207669_10359830
1916 Ga0207669_10913015
1917 Ga0207669_11370827
1918 Ga0207704_10070817
1919 Ga0207704_10083513
1920 Ga0207704_10104809
1921 Ga0207704_10129087
1922 Ga0207704_10840753
1923 Ga0207665_10145871
1924 Ga0207665_10641962
1925 Ga0207691_10003204
1926 Ga0207691_10011977
1927 Ga0207691_10026686
1928 Ga0207691_10029479
1929 Ga0207691_10112990
1930 Ga0207691_10119169
1931 Ga0207691_10142243
1932 Ga0207711_10000193
1933 Ga0207711_10009919
1934 Ga0207711_10014767
1935 Ga0207711_10043780
1936 Ga0207711_10078656
1937 Ga0207711_10088568
1938 Ga0207711_10160190
1939 Ga0207711_11001293
1940 Ga0207711_11220580
1941 Ga0207711_11507124
1942 Ga0207661_10001073
1943 Ga0207661_10052755
1944 Ga0207661_10262454
1945 Ga0207661_10885934
1946 Ga0207679_10029510
1947 Ga0207679_10178545
1948 Ga0207679_10433618
1949 Ga0207679_10961859
1950 Ga0207679_11071695
1951 Ga0207679_11716983
1952 Ga0207679_12058919
1953 Ga0207667_10002493
1954 Ga0207667_10023410
1955 Ga0207667_10036587
1956 Ga0207667_10044346
1957 Ga0207667_10052469
1958 Ga0207667_10252499
1959 Ga0207667_10322113
1960 Ga0207667_10349391
1961 Ga0207667_11015229
1962 Ga0207667_12054745
1963 Ga0207651_10008899
1964 Ga0207651_10068542
1965 Ga0207651_10120398
1966 Ga0207651_10141684
1967 Ga0207651_10418963
1968 Ga0207651_11546468
1969 Ga0207651_12130131
1970 Ga0207668_10383159
1971 Ga0207668_10761375
1972 Ga0207640_10006207
1973 Ga0207640_10021654
1974 Ga0207640_10033341
1975 Ga0207640_10083882
1976 Ga0207640_10307188
1977 Ga0207640_10408935
1978 Ga0207640_10428761
1979 Ga0207640_10471185
1980 Ga0207640_10587512
1981 Ga0207640_11255977
1982 Ga0207640_11533757
1983 Ga0207658_10026602
1984 Ga0207658_10029783
1985 Ga0207658_10217982
1986 Ga0207658_10909119
1987 Ga0207658_10966788
1988 Ga0207677_10002084
1989 Ga0207677_10081998
1990 Ga0207677_10625704
1991 Ga0207677_10664182
1992 Ga0207677_11048065
1993 Ga0207677_11063007
1994 Ga0207703_10001723
1995 Ga0207703_10112718
1996 Ga0207703_10357272
1997 Ga0207639_10004341
1998 Ga0207639_10130840
1999 Ga0207639_10179186
2000 Ga0207639_10296545
2001 Ga0207639_10409457
2002 Ga0207639_10648136
2003 Ga0207639_10750069
2004 Ga0207639_11581517
2005 Ga0207678_10006058
2006 Ga0207678_10025025
2007 Ga0207678_10062017
2008 Ga0207678_10069511
2009 Ga0207678_10083319
2010 Ga0207678_10097084
2011 Ga0207678_10105232
2012 Ga0207678_10108048
2013 Ga0207678_10242566
2014 Ga0207678_10314672
2015 Ga0207678_10326925
2016 Ga0207678_10478892
2017 Ga0207678_11648639
2018 Ga0207702_10028532
2019 Ga0207702_10058035
2020 Ga0207702_10095301
2021 Ga0207702_10120362
2022 Ga0207702_10136004
2023 Ga0207702_10160182
2024 Ga0207702_10179986
2025 Ga0207702_10238024
2026 Ga0207641_10042335
2027 Ga0207641_10314887
2028 Ga0207641_10505225
2029 Ga0207648_10008369
2030 Ga0207648_10036712
2031 Ga0207648_10100560
2032 Ga0207648_10202111
2033 Ga0207648_10345647
2034 Ga0207676_10030608
2035 Ga0207676_10179929
2036 Ga0207676_10181541
2037 Ga0207676_11694966
2038 Ga0207674_10008585
2039 Ga0207674_10066040
2040 Ga0207674_10067056
2041 Ga0207674_10199719
2042 Ga0207683_10004291
2043 Ga0207683_10015098
2044 Ga0207683_10022524
2045 Ga0207683_10534535
2046 Ga0207683_11157241
2047 Ga0207698_10008371
2048 Ga0207698_10054562
2049 Ga0207698_10073739
2050 Ga0207698_10098207
2051 Ga0207698_10114411
2052 Ga0207698_10197230
2053 Ga0207698_10204583
2054 Ga0207698_10239852
2055 Ga0207698_10290769
2056 Ga0207698_10444403
2057 Ga0207698_10507619
2058 Ga0207698_10530938
2059 Ga0207698_10566015
2060 Ga0207698_10883413
2061 Ga0207698_10958087
2062 Ga0207698_11508407
2063 Ga0268266_10060136
2064 Ga0268266_10081457
2065 Ga0268266_10134244
2066 Ga0268266_10150301
2067 Ga0268266_10528838
2068 Ga0268264_10376965
2069 Ga0268264_10887760
2070 Ga0268264_12172309
2071 Ga0268264_12433277
2072 Ga0307408_100036689
2073 Ga0307408_100063257
2074 Ga0307408_100206471
2075 Ga0307408_100694887
2076 Ga0307405_10002230
2077 Ga0307405_10037513
2078 Ga0307405_10750966
2079 Ga0307405_10826880
2080 Ga0307405_11318511
2081 Ga0307413_10008180
2082 Ga0307413_10826001
2083 Ga0307413_11003764
2084 Ga0307410_10017461
2085 Ga0307410_10018714
2086 Ga0307410_10027848
2087 Ga0307410_10469943
2088 Ga0307410_10613388
2089 Ga0307410_11184236
2090 Ga0307406_10017344
2091 Ga0307406_10179989
2092 Ga0307406_10311580
2093 Ga0307407_10007084
2094 Ga0307407_10035013
2095 Ga0307407_10338992
2096 Ga0307412_10014478
2097 Ga0307412_10774261
2098 Ga0307412_10812557
2099 Ga0307412_10867443
2100 Ga0307409_100073105
2101 Ga0307409_100128274
2102 Ga0307409_100308062
2103 Ga0307409_100544812
2104 Ga0307409_102962283
2105 Ga0307416_100000618
2106 Ga0307416_100011575
2107 Ga0307416_100303864
2108 Ga0307416_100407673
2109 Ga0307416_100815566
2110 Ga0307416_101636372
2111 Ga0307416_101772560
2112 Ga0307414_10053285
2113 Ga0307414_10082274
2114 Ga0307414_11003096
2115 Ga0307414_11351903
2116 Ga0307414_11694019
2117 Ga0307411_10018387
2118 Ga0307411_10406985
2119 Ga0307411_10466276
2120 Ga0307415_100010082
2121 Ga0307415_100013096
2122 Ga0307415_100068641
2123 Ga0307415_100846282
2124 Ga0373944_0229101
2125 Ga0373941_0073432
2126 Ga0373945_0110699
2127 Ga0373960_0095411
2128 Ga0373943_0001773
2129 Ga0373955_0974776
2130 Ga0373942_0176351
2131 Ga0373962_0234008
2132 Ga0373931_0113069
2133 Ga0373931_0120100
2134 Ga0373935_0010280
2135 Ga0373935_0355435
2136 Ga0373927_0875702
2137 Ga0373947_0983036
2138 Ga0373937_0957296
2139 Ga0373925_0135488
2140 Ga0373925_1651639
2141 Ga0373925_1760114
2142 Ga0395899_0000820
2143 Ga0395899_0013958
2144 Ga0395899_0027311
2145 Ga0395899_0028620
2146 Ga0395899_0033684
2147 Ga0395899_0041491
2148 Ga0395899_0048855
2149 Ga0395899_0052464
2150 Ga0395899_0136179
2151 Ga0395899_0136623
2152 Ga0395899_0187583
2153 Ga0395899_0207581
2154 Ga0395899_0234445
2155 Ga0395899_0264370
2156 Ga0395899_0297066
2157 Ga0395899_0314272
2158 Ga0395899_0354231
2159 Ga0395899_0385679
2160 Ga0395899_0471921
2161 Ga0395899_0943788
2162 Ga0395900_0000192
2163 Ga0395900_0000289
2164 Ga0395900_0002088
2165 Ga0395900_0009433
2166 Ga0395900_0051186
2167 Ga0395900_0073045
2168 Ga0395900_0074906
2169 Ga0395900_0091822
2170 Ga0395900_0110557
2171 Ga0395900_0124425
2172 Ga0395900_0132805
2173 Ga0395900_0146838
2174 Ga0395900_0147380
2175 Ga0395900_0160655
2176 Ga0395900_0170139
2177 Ga0395900_0172213
2178 Ga0395900_0214540
2179 Ga0395900_0224828
2180 Ga0395900_0224991
2181 Ga0395900_0236324
2182 Ga0395900_0259595
2183 Ga0395900_0269835
2184 Ga0395900_0478224
2185 Ga0395900_1023105
2186 Ga0395900_1620937
2187 Ga0395900_1816594
2188 Ga0395898_0000055
2189 Ga0395898_0017933
2190 Ga0395898_0018903
2191 Ga0395898_0025578
2192 Ga0395898_0037462
2193 Ga0395898_0054501
2194 Ga0395898_0065239
2195 Ga0395898_0079676
2196 Ga0395898_0134850
2197 Ga0395898_0162933
2198 Ga0395898_0234346
2199 Ga0395898_0263033
2200 Ga0395898_0354833
2201 Ga0395898_0626844
2202 Ga0395898_1279906
2203 Ga0395898_1941918
2204 Ga0395905_0000067
2205 Ga0395905_0000187
2206 Ga0395905_0007771
2207 Ga0395905_0010406
2208 Ga0395905_0011321
2209 Ga0395905_0013361
2210 Ga0395905_0026054
2211 Ga0395905_0027580
2212 Ga0395905_0030397
2213 Ga0395905_0041513
2214 Ga0395905_0047957
2215 Ga0395905_0086904
2216 Ga0395905_0105787
2217 Ga0395905_0145809
2218 Ga0395905_0145939
2219 Ga0395905_0146274
2220 Ga0395905_0193698
2221 Ga0395905_0243895
2222 Ga0395905_0301746
2223 Ga0395905_0307360
2224 Ga0395905_0367087
2225 Ga0395905_0419951
2226 Ga0395905_0436735
2227 Ga0395905_0458461
2228 Ga0395905_0585249
2229 Ga0395905_0741547
2230 Ga0395905_0774071
2231 Ga0395905_0788346
2232 Ga0395905_0818074
2233 Ga0395905_0908737
2234 Ga0395905_1736283
2235 Ga0395901_0000876
2236 Ga0395901_0001001
2237 Ga0395901_0008643
2238 Ga0395901_0042744
2239 Ga0395901_0069858
2240 Ga0395901_0071430
2241 Ga0395901_0075945
2242 Ga0395901_0098155
2243 Ga0395901_0120861
2244 Ga0395901_0136429
2245 Ga0395901_0144186
2246 Ga0395901_0171114
2247 Ga0395901_0178380
2248 Ga0395901_0255981
2249 Ga0395901_0270821
2250 Ga0395901_0286360
2251 Ga0395901_0307473
2252 Ga0395901_0451381
2253 Ga0395901_0587507
2254 Ga0395901_0767085
2255 Ga0395901_0831007
2256 Ga0395901_2097313
2257 Ga0436363_1203780
2258 Ga0439432_056515
2259 Ga0439449_0428504
2260 Ga0439455_0014122
2261 Ga0439458_0000200
2262 Ga0439458_0001085
2263 Ga0466969_0217010
2264 Ga0466969_0329713
2265 Ga0466972_0378908
2266 Ga0466972_0380235
2267 Ga0466972_0481285
2268 Ga0466965_0307438
2269 Ga0466965_0539905
2270 Ga0466966_0036316
2271 Ga0466966_0101252
2272 Ga0466966_0128130
2273 Ga0466966_0511045
2274 Ga0466966_0647439
2275 Ga0466966_0707074
2276 Ga0466961_0032089
2277 Ga0466961_0065392
2278 Ga0466961_0100860
2279 Ga0466961_0118767
2280 Ga0466961_0227811
2281 Ga0466961_0335521
2282 Ga0466961_0424693
2283 Ga0466961_0585191
2284 Ga0466963_0032081
2285 Ga0466963_0076635
2286 Ga0466963_0082662
2287 Ga0466963_0109356
2288 Ga0466963_0132128
2289 Ga0466963_0267908
2290 Ga0466963_0499754
2291 Ga0466964_0194482
2292 Ga0466964_0623726
2293 Ga0466964_0640421
2294 Ga0466971_0014594
2295 Ga0466971_0016023
2296 Ga0466971_0157623
2297 Ga0466971_0505875
2298 Ga0466971_0633737
2299 Ga0466968_0002826
2300 Ga0466968_0126804
2301 Ga0466970_0030964
2302 Ga0466970_0050154
2303 Ga0466970_0156747
2304 Ga0466970_0209665
2305 Ga0466970_0277096
2306 Ga0466970_0352922
2307 Ga0466957_0002842
2308 Ga0466957_0069559
2309 Ga0466957_0075879
2310 Ga0466957_0314474
2311 Ga0466957_0410112
2312 Ga0466957_0816740
2313 Ga0466960_0283295
2314 Ga0466959_0104806
2315 Ga0466959_0126056
2316 Ga0466959_0294326
2317 Ga0466959_0603607
2318 Ga0466959_0658861
2319 Ga0466959_0930497
2320 Ga0466958_0004199
2321 Ga0466958_0034292
2322 Ga0466958_0051561
2323 Ga0466958_0297992
2324 Ga0466958_0304624
2325 Ga0466958_0454463
2326 Ga0466967_0052898
2327 Ga0466967_0069711
2328 Ga0466967_0126989
2329 Ga0466967_0515530
2330 Ga0466967_0540541
2331 Ga0466967_0564074
2332 Ga0466967_0677985
2333 Ga0466967_0679417
2334 Ga0466967_1415001
2335 Ga0495606_0591392
2336 Ga0495610_0332119
2337 Ga0495616_0048159
2338 Ga0495663_0087926
2339 Ga0495663_0118494
2340 Ga0495663_0196218
2341 Ga0495642_0084158
2342 Ga0495654_0109236
2343 Ga0495598_0001042
2344 Ga0495621_0000147
2345 Ga0495668_0028799
2346 Ga0495625_0406072
2347 Ga0495669_0000090
2348 Ga0495669_0017854
2349 Ga0495669_0024887
2350 Ga0495669_0034674
2351 Ga0495669_0039499
2352 Ga0495669_0093531
2353 Ga0495669_0553963
2354 Ga0495670_0000192
2355 Ga0495683_0151061
2356 Ga0495677_0002796
2357 Ga0495685_079039
2358 Ga0495681_0307301
2359 Ga0496100_0011228
2360 Ga0496100_0014810
2361 Ga0496100_0482107
2362 Ga0496101_0009177
2363 Ga0496101_0012548
2364 Ga0496102_0070756
2365 Ga0496102_1552210
2366 Ga0496102_1587418
2367 Ga0496103_0066432
2368 Ga0496103_0116738
2369 Ga0496104_0098857
2370 Ga0496104_0530611
2371 Ga0496105_0075364
2372 Ga0496106_0100069
2373 Ga0496106_0160847
2374 Ga0496106_0199554
2375 Ga0496106_0228992
2376 Ga0496107_0057001
2377 Ga0496107_0144210
2378 Ga0496107_0679308
2379 Ga0496107_1181890
2380 Ga0496108_0006295
2381 Ga0496108_0032108
2382 Ga0496108_0034504
2383 Ga0496109_0081202
2384 Ga0496109_0104842
2385 Ga0496109_0170712
2386 Ga0496109_0333644
2387 Ga0496109_0578099
2388 Ga0496109_1140489
2389 Ga0496110_0034694
2390 Ga0496110_0166823
2391 Ga0496110_0271981
2392 Ga0496110_0377317
2393 Ga0496110_0443455
2394 Ga0496111_0054622
2395 Ga0496111_0391135
2396 Ga0496111_0622225
2397 Ga0496111_0818921
2398 Ga0496112_0028192
2399 Ga0496112_0051599
2400 Ga0496112_0055936
2401 Ga0496112_0099954
2402 Ga0496112_0306060
2403 Ga0496112_0884937
2404 Ga0496112_1514121
2405 Ga0496112_1818150
2406 Ga0496113_0033465
2407 Ga0496113_0077662
2408 Ga0496113_0160137
2409 Ga0496113_0228164
2410 Ga0496113_0591756
2411 Ga0496114_0000029
2412 Ga0496114_0049302
2413 Ga0496114_0550773
2414 Ga0496115_0014491
2415 Ga0501067_0039345
2416 Ga0501069_0143306
2417 Ga0501209_008712
2418 Ga0501217_008990
2419 Ga0501224_028008
2420 Ga0501227_163493
2421 Ga0501235_009844
2422 Ga0501246_049130
2423 Ga0501259_072848
2424 Ga0501221_022686
2425 Ga0501225_0118686
2426 Ga0501225_0148409
2427 Ga0501268_006619
2428 Ga0501272_010667
2429 Ga0501273_031171
2430 nmdc:mga0k408_134172_c1
2431 nmdc:mga05p37_703528_c1
2432 Ga0495655_0029703
2433 Ga0466962_0010032
2434 Ga0466962_0034165
2435 Ga0466962_0042195
2436 Ga0466962_0106804
2437 Ga0466962_0115307
2438 Ga0466962_0145143
2439 Ga0466962_0282984
2440 Ga0530510_0364812

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09650

PHA_gran_rgn

Putative polyhydroxyalkanoic acid system protein (PHA_gran_rgn)

29

123

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vis-assembly1.cif.gz_A the crystal structure of domain-swapped trimer q108k:k40d:t53a:r58l:q38f:q4f:v62e variant of hcrbpii 0.8711 47 74
6wp2-assembly1.cif.gz_A the crystal structure of apo zinc-bound domain swapped-trimer q108k:k40d:t53a:r58l:q38f:q4f:f57h variant of hcrbpii 0.8429 47 74
8bor-assembly2.cif.gz_D photosensory module from drbphp without phy tongue 0.761 55 82
8bor-assembly1.cif.gz_B photosensory module from drbphp without phy tongue 0.7588 55 82
8bor-assembly1.cif.gz_A photosensory module from drbphp without phy tongue 0.7269 55 82
ID Description Score Start End Superfamily
af_A0A1D8PGE2_123_352_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.874 45 72 2.120.10.80
af_Q4DB22_67_348_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8331 46 72 2.130.10.10
af_A0A0R0G3L9_89_323_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7671 46 72 2.120.10.80
af_Q08956_119_457_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7647 42 72 2.130.10.10
af_O07750_26_140_2.60.40.1850 Mainly Beta;Sandwich;Immunoglobulin-like; 0.764 47 85 2.60.40.1850
ID Description Score Start End GO Terms
AF-A0A6G7ZIL6-F1-model_v4 Polyhydroxyalkanoic acid synthase 0.9447 8 113
AF-A0A7X5Y6Y7-F1-model_v4 Putative polyhydroxyalkanoate system protein 0.9444 8 114
AF-A0A6G7ZIL6-F1-model_v4 Polyhydroxyalkanoic acid synthase 0.9361 8 113
AF-A0A0Q4HUB2-F1-model_v4 deleted 0.9307 8 107
AF-A0A7X5Y6Y7-F1-model_v4 Putative polyhydroxyalkanoate system protein 0.9273 8 114

Map