F491837
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1220 | 340 | 2440 | 129 |
Family's Representative Sequence
| Representative Sequence | 3300007265|Ga0099794_10048776|Ga0099794_100487763 |
| Length | 144 |
| Sequence | MKPCGQRARDRKSKIKGDVEMKFMMIVKSSEKSGRPPQALMDEIDKLSKEAGNTMIGGGGLGPTALGARVRLSDGKVTVIDGPFTEAKEIIGGYAQFELKSKEEAVESAVRFMELHKKYWPGWEGETEIRQMFGPEDFAAACKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 2 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 91 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 125 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 126 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 128 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 206 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 207 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 210 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 211 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 213 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 214 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 215 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 216 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 217 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 218 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 225 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 228 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 229 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 231 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 239 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 240 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 241 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 244 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 245 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 246 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 247 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 248 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 249 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 251 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 252 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 253 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 254 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 255 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 256 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 257 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 301 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 302 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 303 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 304 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 305 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 306 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 309 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 310 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 311 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 312 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 313 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.79 |
| Metatranscriptomes | 2.21 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.93 |
| Rhizosphere | 95.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0099794_10048776 | 3300007265 | Bacteria | 2033 |
| 2 | Ga0058861_10066547 | 3300004800 | Bacteria | 1117 |
| 3 | Ga0058861_10853320 | 3300004800 | Unclassified | 673 |
| 4 | Ga0058861_12010396 | 3300004800 | Bacteria | 1247 |
| 5 | Ga0058862_10230424 | 3300004803 | Unclassified | 1009 |
| 6 | Ga0058862_12088404 | 3300004803 | Bacteria | 1616 |
| 7 | Ga0065712_10148705 | 3300005290 | Unclassified | 1387 |
| 8 | Ga0065712_10289847 | 3300005290 | Bacteria | 878 |
| 9 | Ga0065712_10659416 | 3300005290 | Unclassified | 563 |
| 10 | Ga0065712_10718242 | 3300005290 | Bacteria | 540 |
| 11 | Ga0065715_10133368 | 3300005293 | Bacteria | 1971 |
| 12 | Ga0070676_10008159 | 3300005328 | Bacteria | 5633 |
| 13 | Ga0070676_10011314 | 3300005328 | Bacteria | 4850 |
| 14 | Ga0070676_10545856 | 3300005328 | Bacteria | 829 |
| 15 | Ga0070676_10915332 | 3300005328 | Bacteria | 654 |
| 16 | Ga0070683_100022089 | 3300005329 | Bacteria | 5683 |
| 17 | Ga0070683_100100806 | 3300005329 | Bacteria | 2718 |
| 18 | Ga0070683_100158802 | 3300005329 | Bacteria | 2145 |
| 19 | Ga0070683_100331382 | 3300005329 | Bacteria | 1449 |
| 20 | Ga0070690_100004580 | 3300005330 | Bacteria | 7684 |
| 21 | Ga0070690_100038806 | 3300005330 | Bacteria | 3007 |
| 22 | Ga0070690_100155963 | 3300005330 | Bacteria | 1561 |
| 23 | Ga0070670_100000950 | 3300005331 | Bacteria | 22752 |
| 24 | Ga0070670_100051859 | 3300005331 | Bacteria | 3522 |
| 25 | Ga0070670_100118833 | 3300005331 | Bacteria | 2280 |
| 26 | Ga0070670_100183310 | 3300005331 | Bacteria | 1818 |
| 27 | Ga0070670_100420286 | 3300005331 | Bacteria | 1182 |
| 28 | Ga0070670_101154275 | 3300005331 | Bacteria | 707 |
| 29 | Ga0070677_10245279 | 3300005333 | Bacteria | 886 |
| 30 | Ga0070677_10411659 | 3300005333 | Bacteria | 715 |
| 31 | Ga0068869_100003830 | 3300005334 | Bacteria | 9278 |
| 32 | Ga0068869_100012520 | 3300005334 | Bacteria | 5610 |
| 33 | Ga0068869_100015741 | 3300005334 | Bacteria | 5082 |
| 34 | Ga0068869_100035741 | 3300005334 | Bacteria | 3524 |
| 35 | Ga0068869_100225718 | 3300005334 | Bacteria | 1486 |
| 36 | Ga0068869_101438714 | 3300005334 | Bacteria | 611 |
| 37 | Ga0068869_101864576 | 3300005334 | Unclassified | 538 |
| 38 | Ga0070666_10000307 | 3300005335 | Bacteria | 31713 |
| 39 | Ga0070666_10006800 | 3300005335 | Bacteria | 7045 |
| 40 | Ga0070666_10091506 | 3300005335 | Bacteria | 2090 |
| 41 | Ga0070666_10142110 | 3300005335 | Bacteria | 1672 |
| 42 | Ga0070666_10150328 | 3300005335 | Bacteria | 1625 |
| 43 | Ga0070666_10249042 | 3300005335 | Bacteria | 1257 |
| 44 | Ga0070666_10312040 | 3300005335 | Bacteria | 1121 |
| 45 | Ga0070666_10417770 | 3300005335 | Bacteria | 966 |
| 46 | Ga0070666_11021236 | 3300005335 | Bacteria | 614 |
| 47 | Ga0070680_100023341 | 3300005336 | Bacteria | 4933 |
| 48 | Ga0070680_100092194 | 3300005336 | Bacteria | 2508 |
| 49 | Ga0070680_100183914 | 3300005336 | Bacteria | 1760 |
| 50 | Ga0070682_100159384 | 3300005337 | Unclassified | 1557 |
| 51 | Ga0070682_100222333 | 3300005337 | Bacteria | 1345 |
| 52 | Ga0070682_100247461 | 3300005337 | Bacteria | 1283 |
| 53 | Ga0070682_100871184 | 3300005337 | Bacteria | 737 |
| 54 | Ga0068868_100002020 | 3300005338 | Bacteria | 13953 |
| 55 | Ga0068868_100002966 | 3300005338 | Bacteria | 11782 |
| 56 | Ga0068868_100028342 | 3300005338 | Bacteria | 4281 |
| 57 | Ga0068868_100070366 | 3300005338 | Bacteria | 2790 |
| 58 | Ga0068868_100249670 | 3300005338 | Unclassified | 1493 |
| 59 | Ga0068868_100346495 | 3300005338 | Bacteria | 1271 |
| 60 | Ga0068868_100416448 | 3300005338 | Bacteria | 1162 |
| 61 | Ga0068868_102264125 | 3300005338 | Unclassified | 518 |
| 62 | Ga0070660_100198597 | 3300005339 | Bacteria | 1626 |
| 63 | Ga0070660_100322247 | 3300005339 | Bacteria | 1270 |
| 64 | Ga0070660_101262901 | 3300005339 | Bacteria | 626 |
| 65 | Ga0070689_100127148 | 3300005340 | Bacteria | 2040 |
| 66 | Ga0070689_100258752 | 3300005340 | Bacteria | 1438 |
| 67 | Ga0070689_100276873 | 3300005340 | Bacteria | 1391 |
| 68 | Ga0070689_100286294 | 3300005340 | Unclassified | 1368 |
| 69 | Ga0070691_10148086 | 3300005341 | Unclassified | 1201 |
| 70 | Ga0070687_101251987 | 3300005343 | Bacteria | 549 |
| 71 | Ga0070661_100010979 | 3300005344 | Bacteria | 6312 |
| 72 | Ga0070661_100011400 | 3300005344 | Bacteria | 6195 |
| 73 | Ga0070661_100017145 | 3300005344 | Bacteria | 5134 |
| 74 | Ga0070661_100376373 | 3300005344 | Bacteria | 1118 |
| 75 | Ga0070692_10017351 | 3300005345 | Bacteria | 3440 |
| 76 | Ga0070692_10219897 | 3300005345 | Bacteria | 1122 |
| 77 | Ga0070668_100009164 | 3300005347 | Bacteria | 7343 |
| 78 | Ga0070668_100015740 | 3300005347 | Bacteria | 5658 |
| 79 | Ga0070668_100109338 | 3300005347 | Bacteria | 2199 |
| 80 | Ga0070668_100569390 | 3300005347 | Bacteria | 988 |
| 81 | Ga0070668_100691078 | 3300005347 | Unclassified | 899 |
| 82 | Ga0070668_101067396 | 3300005347 | Bacteria | 728 |
| 83 | Ga0070669_100009226 | 3300005353 | Bacteria | 7028 |
| 84 | Ga0070669_100078187 | 3300005353 | Bacteria | 2459 |
| 85 | Ga0070669_100456871 | 3300005353 | Bacteria | 1053 |
| 86 | Ga0070675_100012308 | 3300005354 | Bacteria | 6704 |
| 87 | Ga0070675_100015107 | 3300005354 | Bacteria | 6098 |
| 88 | Ga0070675_100300466 | 3300005354 | Unclassified | 1414 |
| 89 | Ga0070671_100006881 | 3300005355 | Bacteria | 9105 |
| 90 | Ga0070671_100008247 | 3300005355 | Bacteria | 8337 |
| 91 | Ga0070671_100213435 | 3300005355 | Bacteria | 1637 |
| 92 | Ga0070674_100015074 | 3300005356 | Bacteria | 4818 |
| 93 | Ga0070674_100027369 | 3300005356 | Bacteria | 3736 |
| 94 | Ga0070674_101516609 | 3300005356 | Bacteria | 603 |
| 95 | Ga0070674_102038998 | 3300005356 | Bacteria | 523 |
| 96 | Ga0070673_100004008 | 3300005364 | Bacteria | 9269 |
| 97 | Ga0070673_100140583 | 3300005364 | Bacteria | 2036 |
| 98 | Ga0070673_100172456 | 3300005364 | Bacteria | 1847 |
| 99 | Ga0070673_100273212 | 3300005364 | Unclassified | 1480 |
| 100 | Ga0070673_100445271 | 3300005364 | Bacteria | 1164 |
| 101 | Ga0070673_100550291 | 3300005364 | Bacteria | 1048 |
| 102 | Ga0070673_102174569 | 3300005364 | Unclassified | 527 |
| 103 | Ga0070688_100006308 | 3300005365 | Bacteria | 6330 |
| 104 | Ga0070688_100046463 | 3300005365 | Bacteria | 2689 |
| 105 | Ga0070688_100963643 | 3300005365 | Unclassified | 676 |
| 106 | Ga0070659_100016993 | 3300005366 | Bacteria | 5469 |
| 107 | Ga0070659_100755697 | 3300005366 | Bacteria | 843 |
| 108 | Ga0070659_101634578 | 3300005366 | Bacteria | 575 |
| 109 | Ga0070667_100001519 | 3300005367 | Bacteria | 20773 |
| 110 | Ga0070667_100004143 | 3300005367 | Bacteria | 12254 |
| 111 | Ga0070667_100023166 | 3300005367 | Bacteria | 5151 |
| 112 | Ga0070667_100065830 | 3300005367 | Bacteria | 3077 |
| 113 | Ga0070667_100147571 | 3300005367 | Bacteria | 2064 |
| 114 | Ga0070667_100219284 | 3300005367 | Bacteria | 1693 |
| 115 | Ga0070667_100257499 | 3300005367 | Bacteria | 1561 |
| 116 | Ga0070667_100463753 | 3300005367 | Bacteria | 1158 |
| 117 | Ga0070667_100672718 | 3300005367 | Bacteria | 957 |
| 118 | Ga0070709_10003057 | 3300005434 | Bacteria | 8983 |
| 119 | Ga0070709_10033855 | 3300005434 | Unclassified | 3093 |
| 120 | Ga0070709_10034812 | 3300005434 | Bacteria | 3057 |
| 121 | Ga0070709_10103503 | 3300005434 | Bacteria | 1901 |
| 122 | Ga0070709_10240879 | 3300005434 | Bacteria | 1299 |
| 123 | Ga0070709_10294933 | 3300005434 | Bacteria | 1183 |
| 124 | Ga0070709_10494140 | 3300005434 | Unclassified | 928 |
| 125 | Ga0070709_10593865 | 3300005434 | Bacteria | 852 |
| 126 | Ga0070709_10826113 | 3300005434 | Bacteria | 729 |
| 127 | Ga0070714_100034856 | 3300005435 | Bacteria | 4215 |
| 128 | Ga0070714_100223181 | 3300005435 | Bacteria | 1733 |
| 129 | Ga0070714_100867719 | 3300005435 | Bacteria | 876 |
| 130 | Ga0070714_101007189 | 3300005435 | Bacteria | 811 |
| 131 | Ga0070713_100004902 | 3300005436 | Bacteria | 9082 |
| 132 | Ga0070713_100014740 | 3300005436 | Bacteria | 5814 |
| 133 | Ga0070713_100016919 | 3300005436 | Bacteria | 5496 |
| 134 | Ga0070713_100039281 | 3300005436 | Bacteria | 3840 |
| 135 | Ga0070713_100955995 | 3300005436 | Unclassified | 825 |
| 136 | Ga0070713_101133704 | 3300005436 | Bacteria | 756 |
| 137 | Ga0070713_101271123 | 3300005436 | Bacteria | 713 |
| 138 | Ga0070710_10052393 | 3300005437 | Bacteria | 2295 |
| 139 | Ga0070710_10074352 | 3300005437 | Unclassified | 1967 |
| 140 | Ga0070710_10312082 | 3300005437 | Bacteria | 1030 |
| 141 | Ga0070710_10317481 | 3300005437 | Bacteria | 1022 |
| 142 | Ga0070701_11092581 | 3300005438 | Bacteria | 561 |
| 143 | Ga0070701_11156367 | 3300005438 | Bacteria | 547 |
| 144 | Ga0070711_100013269 | 3300005439 | Bacteria | 5172 |
| 145 | Ga0070711_100017806 | 3300005439 | Bacteria | 4527 |
| 146 | Ga0070711_100034081 | 3300005439 | Bacteria | 3394 |
| 147 | Ga0070711_100060641 | 3300005439 | Bacteria | 2630 |
| 148 | Ga0070711_100228661 | 3300005439 | Bacteria | 1449 |
| 149 | Ga0070711_100403336 | 3300005439 | Bacteria | 1110 |
| 150 | Ga0070711_101486970 | 3300005439 | Bacteria | 591 |
| 151 | Ga0070705_100099614 | 3300005440 | Bacteria | 1832 |
| 152 | Ga0070705_100140125 | 3300005440 | Unclassified | 1590 |
| 153 | Ga0070705_100585444 | 3300005440 | Bacteria | 861 |
| 154 | Ga0070694_100091962 | 3300005444 | Bacteria | 2131 |
| 155 | Ga0070694_100289858 | 3300005444 | Bacteria | 1251 |
| 156 | Ga0070708_100001177 | 3300005445 | Bacteria | 20152 |
| 157 | Ga0070708_100003267 | 3300005445 | Bacteria | 12656 |
| 158 | Ga0070708_100100428 | 3300005445 | Bacteria | 2648 |
| 159 | Ga0070708_100329461 | 3300005445 | Bacteria | 1439 |
| 160 | Ga0070708_100415306 | 3300005445 | Bacteria | 1269 |
| 161 | Ga0070708_100593007 | 3300005445 | Bacteria | 1045 |
| 162 | Ga0070708_101042416 | 3300005445 | Bacteria | 766 |
| 163 | Ga0070663_100010222 | 3300005455 | Bacteria | 5844 |
| 164 | Ga0070663_100120004 | 3300005455 | Bacteria | 1985 |
| 165 | Ga0070678_100009727 | 3300005456 | Bacteria | 5842 |
| 166 | Ga0070678_100064384 | 3300005456 | Bacteria | 2717 |
| 167 | Ga0070678_100157796 | 3300005456 | Bacteria | 1834 |
| 168 | Ga0070662_100004776 | 3300005457 | Bacteria | 8586 |
| 169 | Ga0070662_100008211 | 3300005457 | Bacteria | 6799 |
| 170 | Ga0070681_10002028 | 3300005458 | Bacteria | 18331 |
| 171 | Ga0070681_10014060 | 3300005458 | Bacteria | 7965 |
| 172 | Ga0070681_10060328 | 3300005458 | Bacteria | 3770 |
| 173 | Ga0070681_10552390 | 3300005458 | Bacteria | 1065 |
| 174 | Ga0070681_10734524 | 3300005458 | Unclassified | 903 |
| 175 | Ga0070681_11130016 | 3300005458 | Bacteria | 705 |
| 176 | Ga0068867_100012126 | 3300005459 | Bacteria | 6087 |
| 177 | Ga0068867_100023605 | 3300005459 | Bacteria | 4403 |
| 178 | Ga0068867_100030550 | 3300005459 | Bacteria | 3885 |
| 179 | Ga0068867_100238346 | 3300005459 | Bacteria | 1474 |
| 180 | Ga0068867_100312573 | 3300005459 | Bacteria | 1299 |
| 181 | Ga0068867_100936642 | 3300005459 | Unclassified | 782 |
| 182 | Ga0070685_10016951 | 3300005466 | Bacteria | 3890 |
| 183 | Ga0070685_10061380 | 3300005466 | Bacteria | 2201 |
| 184 | Ga0070685_10228219 | 3300005466 | Bacteria | 1223 |
| 185 | Ga0070685_11121746 | 3300005466 | Bacteria | 595 |
| 186 | Ga0070706_100000852 | 3300005467 | Bacteria | 33595 |
| 187 | Ga0070706_100070410 | 3300005467 | Bacteria | 3234 |
| 188 | Ga0070706_100433995 | 3300005467 | Unclassified | 1222 |
| 189 | Ga0070706_100632665 | 3300005467 | Bacteria | 993 |
| 190 | Ga0070707_100001948 | 3300005468 | Bacteria | 19815 |
| 191 | Ga0070707_100100064 | 3300005468 | Bacteria | 2809 |
| 192 | Ga0070707_100178281 | 3300005468 | Bacteria | 2071 |
| 193 | Ga0070707_100192858 | 3300005468 | Bacteria | 1987 |
| 194 | Ga0070707_100201406 | 3300005468 | Bacteria | 1940 |
| 195 | Ga0070707_100202181 | 3300005468 | Bacteria | 1937 |
| 196 | Ga0070707_100579781 | 3300005468 | Bacteria | 1084 |
| 197 | Ga0070707_101408472 | 3300005468 | Bacteria | 664 |
| 198 | Ga0070698_100008866 | 3300005471 | Bacteria | 10814 |
| 199 | Ga0070698_100047078 | 3300005471 | Bacteria | 4409 |
| 200 | Ga0070698_100084976 | 3300005471 | Bacteria | 3152 |
| 201 | Ga0070698_100149494 | 3300005471 | Bacteria | 2284 |
| 202 | Ga0070698_100528179 | 3300005471 | Bacteria | 1118 |
| 203 | Ga0070698_100652109 | 3300005471 | Bacteria | 994 |
| 204 | Ga0070698_101773191 | 3300005471 | Unclassified | 570 |
| 205 | Ga0070699_100041048 | 3300005518 | Bacteria | 4004 |
| 206 | Ga0070699_100046528 | 3300005518 | Bacteria | 3754 |
| 207 | Ga0070699_100085912 | 3300005518 | Bacteria | 2745 |
| 208 | Ga0070699_100164649 | 3300005518 | Bacteria | 1964 |
| 209 | Ga0070699_100395736 | 3300005518 | Bacteria | 1249 |
| 210 | Ga0070679_100024800 | 3300005530 | Bacteria | 5878 |
| 211 | Ga0070679_100024972 | 3300005530 | Bacteria | 5858 |
| 212 | Ga0070679_100030000 | 3300005530 | Bacteria | 5366 |
| 213 | Ga0070679_100040198 | 3300005530 | Bacteria | 4652 |
| 214 | Ga0070679_100148036 | 3300005530 | Bacteria | 2325 |
| 215 | Ga0070679_100333836 | 3300005530 | Bacteria | 1464 |
| 216 | Ga0070679_101186630 | 3300005530 | Bacteria | 708 |
| 217 | Ga0070684_100679968 | 3300005535 | Bacteria | 959 |
| 218 | Ga0070697_100001492 | 3300005536 | Bacteria | 17798 |
| 219 | Ga0070697_100002458 | 3300005536 | Bacteria | 14261 |
| 220 | Ga0070697_100053092 | 3300005536 | Bacteria | 3294 |
| 221 | Ga0070697_100089042 | 3300005536 | Bacteria | 2549 |
| 222 | Ga0070697_100111686 | 3300005536 | Bacteria | 2278 |
| 223 | Ga0070697_100369194 | 3300005536 | Bacteria | 1241 |
| 224 | Ga0070697_100458103 | 3300005536 | Bacteria | 1111 |
| 225 | Ga0070697_100982767 | 3300005536 | Bacteria | 750 |
| 226 | Ga0070697_101171192 | 3300005536 | Bacteria | 685 |
| 227 | Ga0070697_101259443 | 3300005536 | Bacteria | 659 |
| 228 | Ga0068853_100002937 | 3300005539 | Bacteria | 12966 |
| 229 | Ga0068853_100017845 | 3300005539 | Bacteria | 5862 |
| 230 | Ga0068853_100034977 | 3300005539 | Bacteria | 4265 |
| 231 | Ga0068853_100129793 | 3300005539 | Bacteria | 2255 |
| 232 | Ga0070672_100001186 | 3300005543 | Bacteria | 15902 |
| 233 | Ga0070672_100050221 | 3300005543 | Bacteria | 3248 |
| 234 | Ga0070672_100286715 | 3300005543 | Bacteria | 1393 |
| 235 | Ga0070672_100356862 | 3300005543 | Bacteria | 1247 |
| 236 | Ga0070672_100531042 | 3300005543 | Bacteria | 1020 |
| 237 | Ga0070672_101302193 | 3300005543 | Bacteria | 649 |
| 238 | Ga0070686_100011604 | 3300005544 | Bacteria | 5003 |
| 239 | Ga0070686_100704205 | 3300005544 | Bacteria | 806 |
| 240 | Ga0070695_100016051 | 3300005545 | Bacteria | 4528 |
| 241 | Ga0070695_100052111 | 3300005545 | Bacteria | 2628 |
| 242 | Ga0070696_100032942 | 3300005546 | Bacteria | 3557 |
| 243 | Ga0070696_100133369 | 3300005546 | Bacteria | 1809 |
| 244 | Ga0070696_100142096 | 3300005546 | Bacteria | 1755 |
| 245 | Ga0070696_100165538 | 3300005546 | Bacteria | 1631 |
| 246 | Ga0070696_100812987 | 3300005546 | Bacteria | 770 |
| 247 | Ga0070696_100957306 | 3300005546 | Unclassified | 713 |
| 248 | Ga0070693_100003714 | 3300005547 | Bacteria | 7140 |
| 249 | Ga0070693_100143242 | 3300005547 | Bacteria | 1507 |
| 250 | Ga0070693_100181277 | 3300005547 | Bacteria | 1356 |
| 251 | Ga0070693_100791316 | 3300005547 | Bacteria | 702 |
| 252 | Ga0070665_100011794 | 3300005548 | Bacteria | 8826 |
| 253 | Ga0070665_100354320 | 3300005548 | Bacteria | 1473 |
| 254 | Ga0070665_100700936 | 3300005548 | Bacteria | 1025 |
| 255 | Ga0070704_100003098 | 3300005549 | Bacteria | 9472 |
| 256 | Ga0070704_100541231 | 3300005549 | Bacteria | 1016 |
| 257 | Ga0068855_100010540 | 3300005563 | Bacteria | 11147 |
| 258 | Ga0068855_100281501 | 3300005563 | Bacteria | 1846 |
| 259 | Ga0068855_100551844 | 3300005563 | Bacteria | 1247 |
| 260 | Ga0068855_100640922 | 3300005563 | Bacteria | 1142 |
| 261 | Ga0070664_100000458 | 3300005564 | Bacteria | 30952 |
| 262 | Ga0070664_100070558 | 3300005564 | Bacteria | 2992 |
| 263 | Ga0068857_100022459 | 3300005577 | Bacteria | 5551 |
| 264 | Ga0068857_100228430 | 3300005577 | Bacteria | 1701 |
| 265 | Ga0068857_100499298 | 3300005577 | Bacteria | 1142 |
| 266 | Ga0068857_101047179 | 3300005577 | Bacteria | 786 |
| 267 | Ga0068854_100005528 | 3300005578 | Bacteria | 7985 |
| 268 | Ga0068854_100048778 | 3300005578 | Bacteria | 3022 |
| 269 | Ga0068854_100074454 | 3300005578 | Bacteria | 2491 |
| 270 | Ga0068854_100242223 | 3300005578 | Bacteria | 1437 |
| 271 | Ga0068856_100004947 | 3300005614 | Bacteria | 13193 |
| 272 | Ga0068856_100064436 | 3300005614 | Bacteria | 3621 |
| 273 | Ga0068856_100205315 | 3300005614 | Bacteria | 1985 |
| 274 | Ga0068856_100333132 | 3300005614 | Bacteria | 1535 |
| 275 | Ga0070702_100006695 | 3300005615 | Bacteria | 5474 |
| 276 | Ga0070702_100088175 | 3300005615 | Bacteria | 1875 |
| 277 | Ga0070702_100150165 | 3300005615 | Bacteria | 1495 |
| 278 | Ga0070702_100769510 | 3300005615 | Bacteria | 741 |
| 279 | Ga0070702_100840189 | 3300005615 | Bacteria | 714 |
| 280 | Ga0068852_100095348 | 3300005616 | Bacteria | 2671 |
| 281 | Ga0068852_100215233 | 3300005616 | Bacteria | 1825 |
| 282 | Ga0068852_100259006 | 3300005616 | Bacteria | 1669 |
| 283 | Ga0068852_100280198 | 3300005616 | Bacteria | 1607 |
| 284 | Ga0068859_100001589 | 3300005617 | Bacteria | 23178 |
| 285 | Ga0068859_100007804 | 3300005617 | Bacteria | 10862 |
| 286 | Ga0068859_100038603 | 3300005617 | Bacteria | 4790 |
| 287 | Ga0068859_100501292 | 3300005617 | Bacteria | 1309 |
| 288 | Ga0068859_100618303 | 3300005617 | Bacteria | 1176 |
| 289 | Ga0068859_100623137 | 3300005617 | Bacteria | 1171 |
| 290 | Ga0068859_100988113 | 3300005617 | Bacteria | 924 |
| 291 | Ga0068859_102507480 | 3300005617 | Bacteria | 568 |
| 292 | Ga0068864_100001439 | 3300005618 | Bacteria | 19638 |
| 293 | Ga0068864_100010797 | 3300005618 | Bacteria | 7548 |
| 294 | Ga0068864_100014458 | 3300005618 | Bacteria | 6555 |
| 295 | Ga0068864_100073651 | 3300005618 | Unclassified | 2978 |
| 296 | Ga0068864_100116325 | 3300005618 | Bacteria | 2386 |
| 297 | Ga0068864_100143020 | 3300005618 | Unclassified | 2160 |
| 298 | Ga0068864_102344108 | 3300005618 | Unclassified | 540 |
| 299 | Ga0068866_10044089 | 3300005718 | Bacteria | 2230 |
| 300 | Ga0068866_10089447 | 3300005718 | Bacteria | 1673 |
| 301 | Ga0068866_10133346 | 3300005718 | Bacteria | 1416 |
| 302 | Ga0068861_100026229 | 3300005719 | Bacteria | 4236 |
| 303 | Ga0068861_100027309 | 3300005719 | Bacteria | 4156 |
| 304 | Ga0068861_100070652 | 3300005719 | Bacteria | 2704 |
| 305 | Ga0068861_100245438 | 3300005719 | Bacteria | 1525 |
| 306 | Ga0068861_101270071 | 3300005719 | Bacteria | 715 |
| 307 | Ga0068851_10003793 | 3300005834 | Bacteria | 6762 |
| 308 | Ga0068851_10144790 | 3300005834 | Bacteria | 1295 |
| 309 | Ga0068851_10228430 | 3300005834 | Unclassified | 1048 |
| 310 | Ga0068870_10007895 | 3300005840 | Bacteria | 4761 |
| 311 | Ga0068870_10238450 | 3300005840 | Bacteria | 1121 |
| 312 | Ga0068863_100008488 | 3300005841 | Bacteria | 10032 |
| 313 | Ga0068863_100014056 | 3300005841 | Bacteria | 7713 |
| 314 | Ga0068863_100047519 | 3300005841 | Bacteria | 4070 |
| 315 | Ga0068863_100167472 | 3300005841 | Bacteria | 2107 |
| 316 | Ga0068863_100508714 | 3300005841 | Bacteria | 1186 |
| 317 | Ga0068863_101838137 | 3300005841 | Bacteria | 616 |
| 318 | Ga0068858_100007581 | 3300005842 | Bacteria | 10485 |
| 319 | Ga0068858_100013060 | 3300005842 | Bacteria | 7833 |
| 320 | Ga0068858_100026578 | 3300005842 | Bacteria | 5377 |
| 321 | Ga0068858_100129041 | 3300005842 | Bacteria | 2369 |
| 322 | Ga0068858_100709384 | 3300005842 | Bacteria | 979 |
| 323 | Ga0068858_100989881 | 3300005842 | Unclassified | 824 |
| 324 | Ga0068858_101128329 | 3300005842 | Bacteria | 770 |
| 325 | Ga0068860_100015899 | 3300005843 | Bacteria | 7344 |
| 326 | Ga0068860_100022961 | 3300005843 | Bacteria | 6032 |
| 327 | Ga0068860_100023141 | 3300005843 | Bacteria | 6007 |
| 328 | Ga0068860_100024545 | 3300005843 | Bacteria | 5824 |
| 329 | Ga0068860_100095512 | 3300005843 | Bacteria | 2833 |
| 330 | Ga0068860_100327059 | 3300005843 | Bacteria | 1505 |
| 331 | Ga0068860_100664342 | 3300005843 | Unclassified | 1050 |
| 332 | Ga0068860_101000283 | 3300005843 | Bacteria | 854 |
| 333 | Ga0068860_101626115 | 3300005843 | Bacteria | 668 |
| 334 | Ga0068862_100008280 | 3300005844 | Bacteria | 8602 |
| 335 | Ga0068862_100020689 | 3300005844 | Bacteria | 5497 |
| 336 | Ga0068862_100026490 | 3300005844 | Bacteria | 4873 |
| 337 | Ga0081455_10035713 | 3300005937 | Bacteria | 4437 |
| 338 | Ga0070717_10002892 | 3300006028 | Bacteria | 12192 |
| 339 | Ga0070717_10092736 | 3300006028 | Bacteria | 2552 |
| 340 | Ga0070717_10098886 | 3300006028 | Bacteria | 2474 |
| 341 | Ga0070717_10283116 | 3300006028 | Bacteria | 1471 |
| 342 | Ga0070717_10293220 | 3300006028 | Unclassified | 1445 |
| 343 | Ga0070717_10312903 | 3300006028 | Bacteria | 1398 |
| 344 | Ga0070717_10445135 | 3300006028 | Bacteria | 1167 |
| 345 | Ga0070717_10556301 | 3300006028 | Bacteria | 1039 |
| 346 | Ga0070717_11087821 | 3300006028 | Archaea | 728 |
| 347 | Ga0070717_11543988 | 3300006028 | Unclassified | 602 |
| 348 | Ga0070715_10010911 | 3300006163 | Bacteria | 3252 |
| 349 | Ga0070715_10113239 | 3300006163 | Bacteria | 1283 |
| 350 | Ga0070715_10175492 | 3300006163 | Bacteria | 1071 |
| 351 | Ga0070715_10240646 | 3300006163 | Unclassified | 941 |
| 352 | Ga0070715_10476186 | 3300006163 | Bacteria | 710 |
| 353 | Ga0070716_100011744 | 3300006173 | Unclassified | 4416 |
| 354 | Ga0070716_100030497 | 3300006173 | Unclassified | 2926 |
| 355 | Ga0070716_100038872 | 3300006173 | Bacteria | 2637 |
| 356 | Ga0070716_100141287 | 3300006173 | Bacteria | 1536 |
| 357 | Ga0070712_100000418 | 3300006175 | Bacteria | 24299 |
| 358 | Ga0070712_100019574 | 3300006175 | Unclassified | 4417 |
| 359 | Ga0070712_100048651 | 3300006175 | Bacteria | 2940 |
| 360 | Ga0070712_100266664 | 3300006175 | Bacteria | 1374 |
| 361 | Ga0070712_100312721 | 3300006175 | Unclassified | 1275 |
| 362 | Ga0070712_100427164 | 3300006175 | Bacteria | 1099 |
| 363 | Ga0070712_100775610 | 3300006175 | Bacteria | 821 |
| 364 | Ga0097621_100000014 | 3300006237 | Bacteria | 100839 |
| 365 | Ga0097621_100009268 | 3300006237 | Bacteria | 7143 |
| 366 | Ga0097621_100022241 | 3300006237 | Bacteria | 4920 |
| 367 | Ga0097621_100091058 | 3300006237 | Bacteria | 2553 |
| 368 | Ga0097621_100115333 | 3300006237 | Bacteria | 2273 |
| 369 | Ga0097621_100127642 | 3300006237 | Bacteria | 2161 |
| 370 | Ga0097621_100179492 | 3300006237 | Bacteria | 1829 |
| 371 | Ga0097621_100272470 | 3300006237 | Bacteria | 1487 |
| 372 | Ga0097621_100280098 | 3300006237 | Bacteria | 1468 |
| 373 | Ga0068871_100001999 | 3300006358 | Bacteria | 13803 |
| 374 | Ga0068871_100004180 | 3300006358 | Bacteria | 9996 |
| 375 | Ga0068871_100081616 | 3300006358 | Bacteria | 2679 |
| 376 | Ga0068871_100116097 | 3300006358 | Bacteria | 2256 |
| 377 | Ga0068871_100165111 | 3300006358 | Bacteria | 1895 |
| 378 | Ga0068871_100344588 | 3300006358 | Bacteria | 1316 |
| 379 | Ga0068871_100570102 | 3300006358 | Bacteria | 1027 |
| 380 | Ga0068871_100723135 | 3300006358 | Bacteria | 913 |
| 381 | Ga0068871_100859184 | 3300006358 | Unclassified | 839 |
| 382 | Ga0075428_102077132 | 3300006844 | Unclassified | 588 |
| 383 | Ga0075434_100014175 | 3300006871 | Bacteria | 7616 |
| 384 | Ga0075434_100172949 | 3300006871 | Bacteria | 2180 |
| 385 | Ga0075434_100314527 | 3300006871 | Bacteria | 1586 |
| 386 | Ga0075434_100598976 | 3300006871 | Bacteria | 1121 |
| 387 | Ga0075434_100735382 | 3300006871 | Bacteria | 1004 |
| 388 | Ga0068865_100009058 | 3300006881 | Bacteria | 6157 |
| 389 | Ga0068865_100193421 | 3300006881 | Bacteria | 1575 |
| 390 | Ga0068865_100321070 | 3300006881 | Bacteria | 1246 |
| 391 | Ga0068865_100491206 | 3300006881 | Bacteria | 1022 |
| 392 | Ga0068865_100668187 | 3300006881 | Bacteria | 885 |
| 393 | Ga0068865_101656819 | 3300006881 | Bacteria | 576 |
| 394 | Ga0097620_100001589 | 3300006931 | Bacteria | 23178 |
| 395 | Ga0097620_100007804 | 3300006931 | Bacteria | 10862 |
| 396 | Ga0097620_100038602 | 3300006931 | Bacteria | 4790 |
| 397 | Ga0097620_100501294 | 3300006931 | Bacteria | 1309 |
| 398 | Ga0097620_100618296 | 3300006931 | Bacteria | 1176 |
| 399 | Ga0097620_100623154 | 3300006931 | Bacteria | 1171 |
| 400 | Ga0097620_100988080 | 3300006931 | Bacteria | 924 |
| 401 | Ga0075435_100138164 | 3300007076 | Bacteria | 2043 |
| 402 | Ga0099794_10005281 | 3300007265 | Bacteria | 5168 |
| 403 | Ga0099794_10129722 | 3300007265 | Bacteria | 1272 |
| 404 | Ga0099794_10282159 | 3300007265 | Bacteria | 859 |
| 405 | Ga0099794_10284175 | 3300007265 | Bacteria | 856 |
| 406 | Ga0099795_10042049 | 3300007788 | Bacteria | 1630 |
| 407 | Ga0099795_10187612 | 3300007788 | Bacteria | 866 |
| 408 | Ga0105251_10280838 | 3300009011 | Bacteria | 753 |
| 409 | Ga0105240_10022263 | 3300009093 | Bacteria | 8406 |
| 410 | Ga0105240_10178654 | 3300009093 | Bacteria | 2507 |
| 411 | Ga0111539_10078212 | 3300009094 | Bacteria | 3892 |
| 412 | Ga0105245_10007246 | 3300009098 | Bacteria | 9713 |
| 413 | Ga0105245_10049059 | 3300009098 | Bacteria | 3779 |
| 414 | Ga0105245_10083814 | 3300009098 | Bacteria | 2919 |
| 415 | Ga0105245_10102331 | 3300009098 | Bacteria | 2653 |
| 416 | Ga0105245_10205801 | 3300009098 | Bacteria | 1892 |
| 417 | Ga0105245_10221109 | 3300009098 | Bacteria | 1827 |
| 418 | Ga0105247_10006527 | 3300009101 | Bacteria | 7222 |
| 419 | Ga0105247_10063272 | 3300009101 | Bacteria | 2296 |
| 420 | Ga0105247_10097883 | 3300009101 | Bacteria | 1872 |
| 421 | Ga0105247_10128880 | 3300009101 | Bacteria | 1647 |
| 422 | Ga0114129_10816361 | 3300009147 | Bacteria | 1188 |
| 423 | Ga0105243_10045381 | 3300009148 | Bacteria | 3454 |
| 424 | Ga0105243_10119327 | 3300009148 | Bacteria | 2221 |
| 425 | Ga0105243_10578849 | 3300009148 | Bacteria | 1077 |
| 426 | Ga0105243_10949310 | 3300009148 | Bacteria | 859 |
| 427 | Ga0105243_11654072 | 3300009148 | Unclassified | 668 |
| 428 | Ga0105241_10006955 | 3300009174 | Bacteria | 8325 |
| 429 | Ga0105241_10036314 | 3300009174 | Bacteria | 3707 |
| 430 | Ga0105241_10076388 | 3300009174 | Unclassified | 2612 |
| 431 | Ga0105241_10456835 | 3300009174 | Bacteria | 1131 |
| 432 | Ga0105241_10462693 | 3300009174 | Bacteria | 1124 |
| 433 | Ga0105241_10524216 | 3300009174 | Bacteria | 1060 |
| 434 | Ga0105241_10576017 | 3300009174 | Bacteria | 1014 |
| 435 | Ga0105242_10012281 | 3300009176 | Bacteria | 6593 |
| 436 | Ga0105242_10014388 | 3300009176 | Bacteria | 6130 |
| 437 | Ga0105242_10093708 | 3300009176 | Bacteria | 2532 |
| 438 | Ga0105242_10433937 | 3300009176 | Bacteria | 1234 |
| 439 | Ga0105242_10888027 | 3300009176 | Bacteria | 890 |
| 440 | Ga0105242_11030095 | 3300009176 | Bacteria | 833 |
| 441 | Ga0105242_11072811 | 3300009176 | Bacteria | 818 |
| 442 | Ga0105248_10003392 | 3300009177 | Bacteria | 17704 |
| 443 | Ga0105248_10004108 | 3300009177 | Bacteria | 16099 |
| 444 | Ga0105248_10007334 | 3300009177 | Bacteria | 12102 |
| 445 | Ga0105248_10035732 | 3300009177 | Bacteria | 5558 |
| 446 | Ga0105248_10095507 | 3300009177 | Bacteria | 3347 |
| 447 | Ga0105248_10746186 | 3300009177 | Bacteria | 1105 |
| 448 | Ga0105248_10932140 | 3300009177 | Bacteria | 981 |
| 449 | Ga0105248_11047804 | 3300009177 | Bacteria | 922 |
| 450 | Ga0105248_12691484 | 3300009177 | Unclassified | 567 |
| 451 | Ga0105237_10017698 | 3300009545 | Bacteria | 7386 |
| 452 | Ga0105237_10124734 | 3300009545 | Bacteria | 2569 |
| 453 | Ga0105237_10339726 | 3300009545 | Bacteria | 1506 |
| 454 | Ga0105237_10471731 | 3300009545 | Bacteria | 1261 |
| 455 | Ga0105237_10761496 | 3300009545 | Bacteria | 975 |
| 456 | Ga0105238_10000099 | 3300009551 | Bacteria | 97818 |
| 457 | Ga0105238_10138906 | 3300009551 | Bacteria | 2407 |
| 458 | Ga0105238_10154742 | 3300009551 | Bacteria | 2268 |
| 459 | Ga0105238_10388461 | 3300009551 | Bacteria | 1388 |
| 460 | Ga0105238_11346887 | 3300009551 | Bacteria | 740 |
| 461 | Ga0105249_10009430 | 3300009553 | Bacteria | 8544 |
| 462 | Ga0105249_10014370 | 3300009553 | Bacteria | 6999 |
| 463 | Ga0105249_10246876 | 3300009553 | Bacteria | 1768 |
| 464 | Ga0105249_10650461 | 3300009553 | Bacteria | 1112 |
| 465 | Ga0099796_10002278 | 3300010159 | Bacteria | 4174 |
| 466 | Ga0099796_10015019 | 3300010159 | Bacteria | 2252 |
| 467 | Ga0099796_10048407 | 3300010159 | Bacteria | 1466 |
| 468 | Ga0099796_10095122 | 3300010159 | Bacteria | 1113 |
| 469 | Ga0099796_10113727 | 3300010159 | Bacteria | 1033 |
| 470 | Ga0105239_10097587 | 3300010375 | Bacteria | 3247 |
| 471 | Ga0105239_10311771 | 3300010375 | Bacteria | 1773 |
| 472 | Ga0105239_11171213 | 3300010375 | Bacteria | 885 |
| 473 | Ga0105239_12096509 | 3300010375 | Bacteria | 657 |
| 474 | Ga0105239_12659479 | 3300010375 | Bacteria | 584 |
| 475 | Ga0105246_10062177 | 3300011119 | Bacteria | 2600 |
| 476 | Ga0105246_11249138 | 3300011119 | Bacteria | 686 |
| 477 | Ga0157373_10032405 | 3300013100 | Bacteria | 3762 |
| 478 | Ga0157373_10101168 | 3300013100 | Bacteria | 2028 |
| 479 | Ga0157373_10297976 | 3300013100 | Bacteria | 1144 |
| 480 | Ga0157371_10009565 | 3300013102 | Bacteria | 7623 |
| 481 | Ga0157371_10172700 | 3300013102 | Bacteria | 1545 |
| 482 | Ga0157371_10453640 | 3300013102 | Bacteria | 943 |
| 483 | Ga0157370_10021505 | 3300013104 | Bacteria | 6428 |
| 484 | Ga0157370_10028570 | 3300013104 | Bacteria | 5484 |
| 485 | Ga0157370_10098581 | 3300013104 | Bacteria | 2740 |
| 486 | Ga0157370_10160799 | 3300013104 | Bacteria | 2089 |
| 487 | Ga0157370_10547831 | 3300013104 | Bacteria | 1060 |
| 488 | Ga0157370_10856658 | 3300013104 | Bacteria | 826 |
| 489 | Ga0157370_11612312 | 3300013104 | Bacteria | 583 |
| 490 | Ga0157369_10000042 | 3300013105 | Bacteria | 181784 |
| 491 | Ga0157369_10008948 | 3300013105 | Bacteria | 11468 |
| 492 | Ga0157369_10126770 | 3300013105 | Bacteria | 2706 |
| 493 | Ga0157369_10279093 | 3300013105 | Bacteria | 1740 |
| 494 | Ga0157369_10549482 | 3300013105 | Bacteria | 1194 |
| 495 | Ga0157374_10001481 | 3300013296 | Bacteria | 19823 |
| 496 | Ga0157374_10012750 | 3300013296 | Bacteria | 7325 |
| 497 | Ga0157374_10052809 | 3300013296 | Bacteria | 3787 |
| 498 | Ga0157374_10223247 | 3300013296 | Bacteria | 1849 |
| 499 | Ga0157374_10297353 | 3300013296 | Bacteria | 1596 |
| 500 | Ga0157378_10003695 | 3300013297 | Bacteria | 13572 |
| 501 | Ga0157378_10015632 | 3300013297 | Bacteria | 6647 |
| 502 | Ga0157378_10092887 | 3300013297 | Bacteria | 2746 |
| 503 | Ga0157378_10114327 | 3300013297 | Bacteria | 2479 |
| 504 | Ga0157378_10276658 | 3300013297 | Bacteria | 1617 |
| 505 | Ga0157378_10657367 | 3300013297 | Bacteria | 1064 |
| 506 | Ga0157378_11184342 | 3300013297 | Bacteria | 803 |
| 507 | Ga0163162_10000673 | 3300013306 | Bacteria | 31751 |
| 508 | Ga0163162_10001514 | 3300013306 | Bacteria | 21645 |
| 509 | Ga0163162_10009150 | 3300013306 | Bacteria | 9636 |
| 510 | Ga0163162_10027940 | 3300013306 | Bacteria | 5580 |
| 511 | Ga0163162_10028597 | 3300013306 | Bacteria | 5517 |
| 512 | Ga0163162_10123185 | 3300013306 | Bacteria | 2698 |
| 513 | Ga0163162_10248439 | 3300013306 | Bacteria | 1911 |
| 514 | Ga0163162_10742114 | 3300013306 | Bacteria | 1101 |
| 515 | Ga0157372_10000452 | 3300013307 | Bacteria | 45098 |
| 516 | Ga0157372_10041887 | 3300013307 | Bacteria | 5063 |
| 517 | Ga0157372_10084660 | 3300013307 | Bacteria | 3595 |
| 518 | Ga0157372_10128249 | 3300013307 | Bacteria | 2917 |
| 519 | Ga0157372_10237390 | 3300013307 | Bacteria | 2115 |
| 520 | Ga0157372_10574153 | 3300013307 | Bacteria | 1314 |
| 521 | Ga0157375_10003814 | 3300013308 | Bacteria | 13070 |
| 522 | Ga0157375_10109975 | 3300013308 | Bacteria | 2852 |
| 523 | Ga0157375_10135894 | 3300013308 | Bacteria | 2582 |
| 524 | Ga0157375_10146288 | 3300013308 | Bacteria | 2494 |
| 525 | Ga0157375_10178225 | 3300013308 | Unclassified | 2276 |
| 526 | Ga0157375_10388929 | 3300013308 | Bacteria | 1561 |
| 527 | Ga0157375_10393549 | 3300013308 | Bacteria | 1552 |
| 528 | Ga0157375_11756800 | 3300013308 | Unclassified | 735 |
| 529 | Ga0157375_13614232 | 3300013308 | Bacteria | 514 |
| 530 | Ga0157375_13617286 | 3300013308 | Bacteria | 514 |
| 531 | Ga0163163_10002726 | 3300014325 | Bacteria | 14910 |
| 532 | Ga0163163_10010014 | 3300014325 | Bacteria | 8502 |
| 533 | Ga0163163_10021936 | 3300014325 | Bacteria | 6036 |
| 534 | Ga0163163_10091073 | 3300014325 | Unclassified | 3063 |
| 535 | Ga0163163_10145632 | 3300014325 | Bacteria | 2412 |
| 536 | Ga0163163_10262731 | 3300014325 | Bacteria | 1777 |
| 537 | Ga0163163_10284685 | 3300014325 | Bacteria | 1705 |
| 538 | Ga0163163_10862961 | 3300014325 | Bacteria | 968 |
| 539 | Ga0157379_10000870 | 3300014968 | Bacteria | 24440 |
| 540 | Ga0157379_10007089 | 3300014968 | Bacteria | 9691 |
| 541 | Ga0157379_10010297 | 3300014968 | Bacteria | 8141 |
| 542 | Ga0157379_10035103 | 3300014968 | Bacteria | 4470 |
| 543 | Ga0157379_10097776 | 3300014968 | Bacteria | 2635 |
| 544 | Ga0157379_11195782 | 3300014968 | Bacteria | 731 |
| 545 | Ga0157379_11488429 | 3300014968 | Unclassified | 658 |
| 546 | Ga0157379_11489368 | 3300014968 | Unclassified | 658 |
| 547 | Ga0157379_11500620 | 3300014968 | Unclassified | 656 |
| 548 | Ga0157376_10007457 | 3300014969 | Bacteria | 7811 |
| 549 | Ga0157376_10023237 | 3300014969 | Bacteria | 4850 |
| 550 | Ga0157376_10129997 | 3300014969 | Unclassified | 2246 |
| 551 | Ga0157376_10134531 | 3300014969 | Unclassified | 2211 |
| 552 | Ga0157376_10289764 | 3300014969 | Bacteria | 1545 |
| 553 | Ga0157376_10306409 | 3300014969 | Bacteria | 1505 |
| 554 | Ga0157376_10325377 | 3300014969 | Bacteria | 1463 |
| 555 | Ga0157376_10328247 | 3300014969 | Bacteria | 1457 |
| 556 | Ga0157376_10807144 | 3300014969 | Unclassified | 951 |
| 557 | Ga0157376_12777806 | 3300014969 | Unclassified | 529 |
| 558 | Ga0163161_10018428 | 3300017792 | Bacteria | 4893 |
| 559 | Ga0163161_10048642 | 3300017792 | Bacteria | 3063 |
| 560 | Ga0197907_10306173 | 3300020069 | Bacteria | 734 |
| 561 | Ga0197907_10725247 | 3300020069 | Bacteria | 1176 |
| 562 | Ga0197907_11359844 | 3300020069 | Bacteria | 928 |
| 563 | Ga0206356_10849476 | 3300020070 | Bacteria | 866 |
| 564 | Ga0206352_10060660 | 3300020078 | Bacteria | 1070 |
| 565 | Ga0206352_10885820 | 3300020078 | Bacteria | 694 |
| 566 | Ga0206350_10579448 | 3300020080 | Bacteria | 1024 |
| 567 | Ga0206350_10773452 | 3300020080 | Bacteria | 1024 |
| 568 | Ga0213874_10031857 | 3300021377 | Bacteria | 1528 |
| 569 | Ga0213874_10260659 | 3300021377 | Unclassified | 642 |
| 570 | Ga0213875_10133123 | 3300021388 | Bacteria | 1163 |
| 571 | Ga0224712_10342548 | 3300022467 | Bacteria | 705 |
| 572 | Ga0224712_10434296 | 3300022467 | Unclassified | 629 |
| 573 | Ga0228598_1021659 | 3300024227 | Bacteria | 1264 |
| 574 | Ga0207697_10002755 | 3300025315 | Bacteria | 8969 |
| 575 | Ga0207697_10163596 | 3300025315 | Bacteria | 971 |
| 576 | Ga0207656_10152100 | 3300025321 | Unclassified | 1096 |
| 577 | Ga0207682_10331651 | 3300025893 | Bacteria | 715 |
| 578 | Ga0207682_10542265 | 3300025893 | Bacteria | 550 |
| 579 | Ga0207692_10091650 | 3300025898 | Bacteria | 1649 |
| 580 | Ga0207692_10149311 | 3300025898 | Bacteria | 1337 |
| 581 | Ga0207692_10237352 | 3300025898 | Unclassified | 1087 |
| 582 | Ga0207692_10394183 | 3300025898 | Bacteria | 862 |
| 583 | Ga0207692_10597591 | 3300025898 | Unclassified | 709 |
| 584 | Ga0207642_10018281 | 3300025899 | Bacteria | 2687 |
| 585 | Ga0207642_10324892 | 3300025899 | Bacteria | 900 |
| 586 | Ga0207642_10421837 | 3300025899 | Bacteria | 803 |
| 587 | Ga0207642_10967459 | 3300025899 | Bacteria | 547 |
| 588 | Ga0207710_10059797 | 3300025900 | Bacteria | 1726 |
| 589 | Ga0207710_10435605 | 3300025900 | Unclassified | 676 |
| 590 | Ga0207688_10122211 | 3300025901 | Bacteria | 1520 |
| 591 | Ga0207688_10671930 | 3300025901 | Bacteria | 654 |
| 592 | Ga0207680_10003597 | 3300025903 | Bacteria | 7283 |
| 593 | Ga0207680_10007874 | 3300025903 | Bacteria | 5210 |
| 594 | Ga0207680_10197413 | 3300025903 | Bacteria | 1369 |
| 595 | Ga0207680_10344926 | 3300025903 | Bacteria | 1045 |
| 596 | Ga0207680_10368708 | 3300025903 | Bacteria | 1011 |
| 597 | Ga0207680_10442649 | 3300025903 | Bacteria | 922 |
| 598 | Ga0207685_10136818 | 3300025905 | Bacteria | 1094 |
| 599 | Ga0207685_10185399 | 3300025905 | Bacteria | 967 |
| 600 | Ga0207685_10196792 | 3300025905 | Bacteria | 944 |
| 601 | Ga0207685_10268246 | 3300025905 | Unclassified | 833 |
| 602 | Ga0207685_10461387 | 3300025905 | Bacteria | 662 |
| 603 | Ga0207685_10618681 | 3300025905 | Unclassified | 583 |
| 604 | Ga0207699_10084655 | 3300025906 | Bacteria | 1976 |
| 605 | Ga0207699_10230198 | 3300025906 | Unclassified | 1269 |
| 606 | Ga0207699_10418525 | 3300025906 | Bacteria | 957 |
| 607 | Ga0207699_11006665 | 3300025906 | Bacteria | 616 |
| 608 | Ga0207645_10000361 | 3300025907 | Bacteria | 37673 |
| 609 | Ga0207645_10009862 | 3300025907 | Bacteria | 6581 |
| 610 | Ga0207645_10037559 | 3300025907 | Bacteria | 3107 |
| 611 | Ga0207645_10123387 | 3300025907 | Bacteria | 1683 |
| 612 | Ga0207645_10561833 | 3300025907 | Bacteria | 774 |
| 613 | Ga0207643_10004581 | 3300025908 | Bacteria | 7425 |
| 614 | Ga0207643_10031919 | 3300025908 | Bacteria | 2939 |
| 615 | Ga0207705_11151419 | 3300025909 | Bacteria | 596 |
| 616 | Ga0207684_10002910 | 3300025910 | Bacteria | 16974 |
| 617 | Ga0207684_10011427 | 3300025910 | Bacteria | 7768 |
| 618 | Ga0207684_10064928 | 3300025910 | Bacteria | 3099 |
| 619 | Ga0207684_10150650 | 3300025910 | Unclassified | 2001 |
| 620 | Ga0207684_10189322 | 3300025910 | Bacteria | 1774 |
| 621 | Ga0207684_10283161 | 3300025910 | Bacteria | 1429 |
| 622 | Ga0207684_10605070 | 3300025910 | Bacteria | 936 |
| 623 | Ga0207654_10024104 | 3300025911 | Bacteria | 3268 |
| 624 | Ga0207654_10049001 | 3300025911 | Bacteria | 2420 |
| 625 | Ga0207654_10049338 | 3300025911 | Bacteria | 2414 |
| 626 | Ga0207654_10398838 | 3300025911 | Bacteria | 956 |
| 627 | Ga0207654_10590003 | 3300025911 | Unclassified | 792 |
| 628 | Ga0207707_10005894 | 3300025912 | Bacteria | 10716 |
| 629 | Ga0207707_10014130 | 3300025912 | Bacteria | 6957 |
| 630 | Ga0207707_10015546 | 3300025912 | Bacteria | 6630 |
| 631 | Ga0207707_10026439 | 3300025912 | Bacteria | 5072 |
| 632 | Ga0207707_10062066 | 3300025912 | Bacteria | 3252 |
| 633 | Ga0207707_10609703 | 3300025912 | Unclassified | 923 |
| 634 | Ga0207707_10938164 | 3300025912 | Bacteria | 713 |
| 635 | Ga0207707_11019757 | 3300025912 | Bacteria | 678 |
| 636 | Ga0207695_10008008 | 3300025913 | Bacteria | 13309 |
| 637 | Ga0207695_10012835 | 3300025913 | Bacteria | 10031 |
| 638 | Ga0207671_10115434 | 3300025914 | Bacteria | 2047 |
| 639 | Ga0207671_10293759 | 3300025914 | Unclassified | 1283 |
| 640 | Ga0207671_10311364 | 3300025914 | Bacteria | 1245 |
| 641 | Ga0207671_11483758 | 3300025914 | Unclassified | 524 |
| 642 | Ga0207693_10000777 | 3300025915 | Bacteria | 28620 |
| 643 | Ga0207693_10001269 | 3300025915 | Bacteria | 22512 |
| 644 | Ga0207693_10001447 | 3300025915 | Bacteria | 21016 |
| 645 | Ga0207693_10002318 | 3300025915 | Bacteria | 16545 |
| 646 | Ga0207693_10026151 | 3300025915 | Bacteria | 4620 |
| 647 | Ga0207693_10026692 | 3300025915 | Unclassified | 4569 |
| 648 | Ga0207693_10085877 | 3300025915 | Bacteria | 2465 |
| 649 | Ga0207693_10290993 | 3300025915 | Bacteria | 1280 |
| 650 | Ga0207693_10413956 | 3300025915 | Bacteria | 1054 |
| 651 | Ga0207693_10694761 | 3300025915 | Bacteria | 788 |
| 652 | Ga0207693_10775710 | 3300025915 | Bacteria | 740 |
| 653 | Ga0207663_10005767 | 3300025916 | Bacteria | 6270 |
| 654 | Ga0207663_10009058 | 3300025916 | Bacteria | 5242 |
| 655 | Ga0207663_10138785 | 3300025916 | Bacteria | 1690 |
| 656 | Ga0207663_10156217 | 3300025916 | Bacteria | 1605 |
| 657 | Ga0207663_10180080 | 3300025916 | Bacteria | 1508 |
| 658 | Ga0207663_10187161 | 3300025916 | Bacteria | 1484 |
| 659 | Ga0207663_10252749 | 3300025916 | Bacteria | 1298 |
| 660 | Ga0207663_10955122 | 3300025916 | Bacteria | 687 |
| 661 | Ga0207663_10957178 | 3300025916 | Unclassified | 686 |
| 662 | Ga0207663_11508331 | 3300025916 | Bacteria | 541 |
| 663 | Ga0207660_10000684 | 3300025917 | Bacteria | 22664 |
| 664 | Ga0207660_10021722 | 3300025917 | Bacteria | 4318 |
| 665 | Ga0207660_10093009 | 3300025917 | Bacteria | 2239 |
| 666 | Ga0207660_10567650 | 3300025917 | Bacteria | 923 |
| 667 | Ga0207662_11350365 | 3300025918 | Bacteria | 506 |
| 668 | Ga0207657_10004028 | 3300025919 | Bacteria | 15604 |
| 669 | Ga0207657_10004518 | 3300025919 | Bacteria | 14697 |
| 670 | Ga0207657_10954031 | 3300025919 | Bacteria | 659 |
| 671 | Ga0207649_10022890 | 3300025920 | Bacteria | 3611 |
| 672 | Ga0207649_10159370 | 3300025920 | Bacteria | 1562 |
| 673 | Ga0207649_10179871 | 3300025920 | Bacteria | 1479 |
| 674 | Ga0207649_10199749 | 3300025920 | Unclassified | 1412 |
| 675 | Ga0207652_10010119 | 3300025921 | Bacteria | 7597 |
| 676 | Ga0207652_10011865 | 3300025921 | Bacteria | 7030 |
| 677 | Ga0207652_10027041 | 3300025921 | Unclassified | 4780 |
| 678 | Ga0207652_10138316 | 3300025921 | Bacteria | 2176 |
| 679 | Ga0207652_10152798 | 3300025921 | Bacteria | 2067 |
| 680 | Ga0207652_10155121 | 3300025921 | Bacteria | 2051 |
| 681 | Ga0207646_10001994 | 3300025922 | Bacteria | 24538 |
| 682 | Ga0207646_10039010 | 3300025922 | Bacteria | 4275 |
| 683 | Ga0207646_10079104 | 3300025922 | Bacteria | 2939 |
| 684 | Ga0207646_10194131 | 3300025922 | Bacteria | 1833 |
| 685 | Ga0207646_10257807 | 3300025922 | Bacteria | 1576 |
| 686 | Ga0207681_10036637 | 3300025923 | Bacteria | 3237 |
| 687 | Ga0207681_10590195 | 3300025923 | Bacteria | 917 |
| 688 | Ga0207694_10002760 | 3300025924 | Bacteria | 14182 |
| 689 | Ga0207694_10171753 | 3300025924 | Bacteria | 1755 |
| 690 | Ga0207694_10862800 | 3300025924 | Bacteria | 765 |
| 691 | Ga0207694_11366578 | 3300025924 | Bacteria | 599 |
| 692 | Ga0207650_10000804 | 3300025925 | Bacteria | 24088 |
| 693 | Ga0207650_10022176 | 3300025925 | Bacteria | 4495 |
| 694 | Ga0207650_10033162 | 3300025925 | Bacteria | 3738 |
| 695 | Ga0207650_10039787 | 3300025925 | Bacteria | 3437 |
| 696 | Ga0207650_10041679 | 3300025925 | Bacteria | 3366 |
| 697 | Ga0207650_10548547 | 3300025925 | Bacteria | 969 |
| 698 | Ga0207659_10025373 | 3300025926 | Bacteria | 3982 |
| 699 | Ga0207659_10246913 | 3300025926 | Unclassified | 1447 |
| 700 | Ga0207687_10001741 | 3300025927 | Bacteria | 14985 |
| 701 | Ga0207687_10020007 | 3300025927 | Bacteria | 4439 |
| 702 | Ga0207687_10065354 | 3300025927 | Bacteria | 2583 |
| 703 | Ga0207687_10176541 | 3300025927 | Bacteria | 1652 |
| 704 | Ga0207687_10825956 | 3300025927 | Bacteria | 791 |
| 705 | Ga0207700_10000305 | 3300025928 | Bacteria | 29115 |
| 706 | Ga0207700_10016643 | 3300025928 | Bacteria | 4891 |
| 707 | Ga0207700_10040310 | 3300025928 | Bacteria | 3408 |
| 708 | Ga0207700_10200019 | 3300025928 | Bacteria | 1683 |
| 709 | Ga0207700_10739839 | 3300025928 | Unclassified | 879 |
| 710 | Ga0207700_11106663 | 3300025928 | Unclassified | 708 |
| 711 | Ga0207700_11374608 | 3300025928 | Bacteria | 628 |
| 712 | Ga0207664_10007467 | 3300025929 | Bacteria | 7583 |
| 713 | Ga0207664_10036088 | 3300025929 | Bacteria | 3819 |
| 714 | Ga0207664_10056135 | 3300025929 | Bacteria | 3127 |
| 715 | Ga0207664_10288997 | 3300025929 | Unclassified | 1440 |
| 716 | Ga0207664_11102765 | 3300025929 | Bacteria | 709 |
| 717 | Ga0207664_11238302 | 3300025929 | Bacteria | 665 |
| 718 | Ga0207644_10008450 | 3300025931 | Bacteria | 6738 |
| 719 | Ga0207644_10013287 | 3300025931 | Bacteria | 5485 |
| 720 | Ga0207644_10046896 | 3300025931 | Bacteria | 3081 |
| 721 | Ga0207644_10160598 | 3300025931 | Bacteria | 1746 |
| 722 | Ga0207644_11180456 | 3300025931 | Bacteria | 643 |
| 723 | Ga0207644_11405388 | 3300025931 | Unclassified | 586 |
| 724 | Ga0207690_10842168 | 3300025932 | Bacteria | 759 |
| 725 | Ga0207706_10000098 | 3300025933 | Bacteria | 91173 |
| 726 | Ga0207706_10006684 | 3300025933 | Bacteria | 10666 |
| 727 | Ga0207706_10076387 | 3300025933 | Bacteria | 2946 |
| 728 | Ga0207686_10000779 | 3300025934 | Bacteria | 19588 |
| 729 | Ga0207686_10007968 | 3300025934 | Bacteria | 5713 |
| 730 | Ga0207686_10069448 | 3300025934 | Bacteria | 2260 |
| 731 | Ga0207709_10025139 | 3300025935 | Bacteria | 3407 |
| 732 | Ga0207709_10913804 | 3300025935 | Bacteria | 714 |
| 733 | Ga0207670_10051596 | 3300025936 | Bacteria | 2762 |
| 734 | Ga0207670_10087503 | 3300025936 | Bacteria | 2195 |
| 735 | Ga0207670_10178283 | 3300025936 | Bacteria | 1599 |
| 736 | Ga0207670_10282414 | 3300025936 | Bacteria | 1294 |
| 737 | Ga0207670_10792886 | 3300025936 | Bacteria | 789 |
| 738 | Ga0207670_11398527 | 3300025936 | Bacteria | 594 |
| 739 | Ga0207669_10005385 | 3300025937 | Bacteria | 5738 |
| 740 | Ga0207669_10272117 | 3300025937 | Bacteria | 1273 |
| 741 | Ga0207669_10655313 | 3300025937 | Bacteria | 859 |
| 742 | Ga0207669_10715492 | 3300025937 | Bacteria | 824 |
| 743 | Ga0207669_11746803 | 3300025937 | Bacteria | 531 |
| 744 | Ga0207704_10253701 | 3300025938 | Bacteria | 1322 |
| 745 | Ga0207704_10284766 | 3300025938 | Bacteria | 1258 |
| 746 | Ga0207704_10469155 | 3300025938 | Bacteria | 1008 |
| 747 | Ga0207704_10647099 | 3300025938 | Bacteria | 870 |
| 748 | Ga0207665_10001318 | 3300025939 | Bacteria | 16739 |
| 749 | Ga0207665_10004596 | 3300025939 | Bacteria | 9167 |
| 750 | Ga0207665_10006712 | 3300025939 | Bacteria | 7632 |
| 751 | Ga0207665_10009496 | 3300025939 | Bacteria | 6388 |
| 752 | Ga0207665_10054324 | 3300025939 | Unclassified | 2700 |
| 753 | Ga0207665_10061227 | 3300025939 | Bacteria | 2550 |
| 754 | Ga0207665_10118639 | 3300025939 | Bacteria | 1867 |
| 755 | Ga0207665_10217046 | 3300025939 | Bacteria | 1400 |
| 756 | Ga0207691_10000022 | 3300025940 | Bacteria | 132936 |
| 757 | Ga0207691_10036841 | 3300025940 | Bacteria | 4531 |
| 758 | Ga0207691_10049775 | 3300025940 | Bacteria | 3839 |
| 759 | Ga0207691_10449848 | 3300025940 | Bacteria | 1096 |
| 760 | Ga0207691_10506159 | 3300025940 | Bacteria | 1025 |
| 761 | Ga0207691_10580425 | 3300025940 | Bacteria | 950 |
| 762 | Ga0207711_10000157 | 3300025941 | Bacteria | 73266 |
| 763 | Ga0207711_10002559 | 3300025941 | Bacteria | 16209 |
| 764 | Ga0207711_10005058 | 3300025941 | Bacteria | 11184 |
| 765 | Ga0207711_10013127 | 3300025941 | Bacteria | 6879 |
| 766 | Ga0207711_10014426 | 3300025941 | Bacteria | 6563 |
| 767 | Ga0207711_10179964 | 3300025941 | Bacteria | 1922 |
| 768 | Ga0207711_10483357 | 3300025941 | Bacteria | 1154 |
| 769 | Ga0207711_10606457 | 3300025941 | Bacteria | 1021 |
| 770 | Ga0207711_10848697 | 3300025941 | Bacteria | 850 |
| 771 | Ga0207689_10000606 | 3300025942 | Bacteria | 34343 |
| 772 | Ga0207689_10001125 | 3300025942 | Bacteria | 25810 |
| 773 | Ga0207689_10022295 | 3300025942 | Bacteria | 5325 |
| 774 | Ga0207689_10212837 | 3300025942 | Bacteria | 1597 |
| 775 | Ga0207661_10035590 | 3300025944 | Bacteria | 3882 |
| 776 | Ga0207661_10232730 | 3300025944 | Unclassified | 1632 |
| 777 | Ga0207661_11899163 | 3300025944 | Unclassified | 541 |
| 778 | Ga0207679_10004168 | 3300025945 | Bacteria | 8983 |
| 779 | Ga0207679_10179960 | 3300025945 | Bacteria | 1748 |
| 780 | Ga0207679_10408013 | 3300025945 | Unclassified | 1196 |
| 781 | Ga0207679_11488113 | 3300025945 | Bacteria | 621 |
| 782 | Ga0207667_10002055 | 3300025949 | Bacteria | 25228 |
| 783 | Ga0207667_10004035 | 3300025949 | Bacteria | 18038 |
| 784 | Ga0207667_10437199 | 3300025949 | Bacteria | 1330 |
| 785 | Ga0207667_10553580 | 3300025949 | Bacteria | 1163 |
| 786 | Ga0207667_10723689 | 3300025949 | Bacteria | 996 |
| 787 | Ga0207651_10015130 | 3300025960 | Bacteria | 4474 |
| 788 | Ga0207651_10281645 | 3300025960 | Bacteria | 1374 |
| 789 | Ga0207651_10491592 | 3300025960 | Bacteria | 1059 |
| 790 | Ga0207651_10654099 | 3300025960 | Bacteria | 923 |
| 791 | Ga0207712_10008062 | 3300025961 | Bacteria | 6664 |
| 792 | Ga0207712_10167273 | 3300025961 | Bacteria | 1715 |
| 793 | Ga0207712_11964537 | 3300025961 | Bacteria | 524 |
| 794 | Ga0207668_10005383 | 3300025972 | Bacteria | 7534 |
| 795 | Ga0207668_10011070 | 3300025972 | Bacteria | 5470 |
| 796 | Ga0207668_10143374 | 3300025972 | Bacteria | 1840 |
| 797 | Ga0207668_10186745 | 3300025972 | Bacteria | 1639 |
| 798 | Ga0207668_10441127 | 3300025972 | Bacteria | 1109 |
| 799 | Ga0207668_10648344 | 3300025972 | Unclassified | 924 |
| 800 | Ga0207668_12097904 | 3300025972 | Bacteria | 509 |
| 801 | Ga0207640_10005522 | 3300025981 | Bacteria | 6892 |
| 802 | Ga0207640_10314508 | 3300025981 | Bacteria | 1244 |
| 803 | Ga0207640_11187977 | 3300025981 | Unclassified | 678 |
| 804 | Ga0207658_10015565 | 3300025986 | Bacteria | 5218 |
| 805 | Ga0207658_10027983 | 3300025986 | Bacteria | 3966 |
| 806 | Ga0207658_10059347 | 3300025986 | Bacteria | 2850 |
| 807 | Ga0207658_10216053 | 3300025986 | Bacteria | 1610 |
| 808 | Ga0207658_10314596 | 3300025986 | Bacteria | 1353 |
| 809 | Ga0207658_10820504 | 3300025986 | Bacteria | 845 |
| 810 | Ga0207658_11193035 | 3300025986 | Bacteria | 696 |
| 811 | Ga0207658_11385148 | 3300025986 | Unclassified | 643 |
| 812 | Ga0207677_10001996 | 3300026023 | Bacteria | 10780 |
| 813 | Ga0207677_10016803 | 3300026023 | Bacteria | 4345 |
| 814 | Ga0207677_10025664 | 3300026023 | Bacteria | 3681 |
| 815 | Ga0207677_10037216 | 3300026023 | Unclassified | 3179 |
| 816 | Ga0207677_10140277 | 3300026023 | Bacteria | 1849 |
| 817 | Ga0207677_10310112 | 3300026023 | Bacteria | 1307 |
| 818 | Ga0207703_10000973 | 3300026035 | Bacteria | 27585 |
| 819 | Ga0207703_10002691 | 3300026035 | Bacteria | 15245 |
| 820 | Ga0207703_10025507 | 3300026035 | Bacteria | 4649 |
| 821 | Ga0207703_10236126 | 3300026035 | Bacteria | 1641 |
| 822 | Ga0207703_10294780 | 3300026035 | Bacteria | 1477 |
| 823 | Ga0207703_10577010 | 3300026035 | Bacteria | 1062 |
| 824 | Ga0207703_11860179 | 3300026035 | Bacteria | 578 |
| 825 | Ga0207703_11864203 | 3300026035 | Unclassified | 577 |
| 826 | Ga0207703_11900630 | 3300026035 | Bacteria | 571 |
| 827 | Ga0207639_10012754 | 3300026041 | Bacteria | 5862 |
| 828 | Ga0207639_10023656 | 3300026041 | Bacteria | 4437 |
| 829 | Ga0207639_10038405 | 3300026041 | Bacteria | 3561 |
| 830 | Ga0207639_10166810 | 3300026041 | Bacteria | 1861 |
| 831 | Ga0207678_10006292 | 3300026067 | Bacteria | 10543 |
| 832 | Ga0207678_10093626 | 3300026067 | Bacteria | 2567 |
| 833 | Ga0207702_10000303 | 3300026078 | Bacteria | 56839 |
| 834 | Ga0207702_10004933 | 3300026078 | Bacteria | 11722 |
| 835 | Ga0207702_10091249 | 3300026078 | Bacteria | 2667 |
| 836 | Ga0207702_10175137 | 3300026078 | Bacteria | 1971 |
| 837 | Ga0207702_10293342 | 3300026078 | Bacteria | 1541 |
| 838 | Ga0207702_11052417 | 3300026078 | Bacteria | 807 |
| 839 | Ga0207641_10003774 | 3300026088 | Bacteria | 13302 |
| 840 | Ga0207641_10034183 | 3300026088 | Bacteria | 4227 |
| 841 | Ga0207641_10036148 | 3300026088 | Unclassified | 4122 |
| 842 | Ga0207641_10122192 | 3300026088 | Bacteria | 2325 |
| 843 | Ga0207641_10170612 | 3300026088 | Bacteria | 1985 |
| 844 | Ga0207648_10001376 | 3300026089 | Bacteria | 26783 |
| 845 | Ga0207648_10005112 | 3300026089 | Bacteria | 13293 |
| 846 | Ga0207648_10009722 | 3300026089 | Bacteria | 9195 |
| 847 | Ga0207648_10033523 | 3300026089 | Bacteria | 4530 |
| 848 | Ga0207648_10359361 | 3300026089 | Bacteria | 1314 |
| 849 | Ga0207676_10003601 | 3300026095 | Bacteria | 10954 |
| 850 | Ga0207676_10478284 | 3300026095 | Bacteria | 1179 |
| 851 | Ga0207676_10642191 | 3300026095 | Bacteria | 1023 |
| 852 | Ga0207676_10967621 | 3300026095 | Bacteria | 837 |
| 853 | Ga0207676_11772558 | 3300026095 | Bacteria | 616 |
| 854 | Ga0207674_10041047 | 3300026116 | Bacteria | 4788 |
| 855 | Ga0207674_10093774 | 3300026116 | Bacteria | 2990 |
| 856 | Ga0207674_10133797 | 3300026116 | Bacteria | 2442 |
| 857 | Ga0207674_10222361 | 3300026116 | Bacteria | 1836 |
| 858 | Ga0207674_10225636 | 3300026116 | Bacteria | 1821 |
| 859 | Ga0207675_100019029 | 3300026118 | Bacteria | 6410 |
| 860 | Ga0207675_100108328 | 3300026118 | Bacteria | 2620 |
| 861 | Ga0207675_100191181 | 3300026118 | Bacteria | 1963 |
| 862 | Ga0207675_100644344 | 3300026118 | Unclassified | 1065 |
| 863 | Ga0207675_100833498 | 3300026118 | Bacteria | 937 |
| 864 | Ga0207675_100968778 | 3300026118 | Bacteria | 868 |
| 865 | Ga0207683_10001682 | 3300026121 | Bacteria | 19793 |
| 866 | Ga0207683_10004894 | 3300026121 | Bacteria | 11527 |
| 867 | Ga0207683_10143140 | 3300026121 | Bacteria | 2155 |
| 868 | Ga0207683_10224140 | 3300026121 | Bacteria | 1713 |
| 869 | Ga0207698_10029668 | 3300026142 | Bacteria | 3921 |
| 870 | Ga0207698_10191038 | 3300026142 | Bacteria | 1824 |
| 871 | Ga0209179_1004386 | 3300027512 | Bacteria | 2124 |
| 872 | Ga0209588_1022160 | 3300027671 | Bacteria | 1999 |
| 873 | Ga0209588_1059330 | 3300027671 | Bacteria | 1237 |
| 874 | Ga0209588_1061438 | 3300027671 | Bacteria | 1214 |
| 875 | Ga0209588_1167449 | 3300027671 | Bacteria | 692 |
| 876 | Ga0265354_1033384 | 3300028016 | Unclassified | 500 |
| 877 | Ga0268266_10012772 | 3300028379 | Bacteria | 7257 |
| 878 | Ga0268266_10026636 | 3300028379 | Bacteria | 4919 |
| 879 | Ga0268266_10028758 | 3300028379 | Bacteria | 4725 |
| 880 | Ga0268266_10464934 | 3300028379 | Bacteria | 1204 |
| 881 | Ga0268266_10486134 | 3300028379 | Bacteria | 1177 |
| 882 | Ga0268265_10013762 | 3300028380 | Bacteria | 5506 |
| 883 | Ga0268265_10013953 | 3300028380 | Bacteria | 5471 |
| 884 | Ga0268265_10109419 | 3300028380 | Bacteria | 2252 |
| 885 | Ga0268264_10001476 | 3300028381 | Bacteria | 21939 |
| 886 | Ga0268264_10006479 | 3300028381 | Bacteria | 9857 |
| 887 | Ga0268264_10017542 | 3300028381 | Bacteria | 5863 |
| 888 | Ga0268264_10119610 | 3300028381 | Bacteria | 2320 |
| 889 | Ga0268264_10362488 | 3300028381 | Bacteria | 1383 |
| 890 | Ga0268264_10491748 | 3300028381 | Bacteria | 1195 |
| 891 | Ga0268264_10842160 | 3300028381 | Bacteria | 918 |
| 892 | Ga0268264_11019754 | 3300028381 | Unclassified | 834 |
| 893 | Ga0268264_11398888 | 3300028381 | Bacteria | 710 |
| 894 | Ga0268264_11441675 | 3300028381 | Bacteria | 699 |
| 895 | Ga0268264_12020250 | 3300028381 | Bacteria | 586 |
| 896 | Ga0265338_10002470 | 3300028800 | Bacteria | 27614 |
| 897 | Ga0265338_10018073 | 3300028800 | Bacteria | 7565 |
| 898 | Ga0265338_10274351 | 3300028800 | Bacteria | 1235 |
| 899 | Ga0265762_1024219 | 3300030760 | Bacteria | 1128 |
| 900 | Ga0265763_1046302 | 3300030763 | Bacteria | 537 |
| 901 | Ga0265770_1003452 | 3300030878 | Bacteria | 2147 |
| 902 | Ga0265770_1121050 | 3300030878 | Bacteria | 551 |
| 903 | Ga0265760_10004593 | 3300031090 | Bacteria | 3957 |
| 904 | Ga0265330_10361925 | 3300031235 | Bacteria | 613 |
| 905 | Ga0265328_10049567 | 3300031239 | Bacteria | 1542 |
| 906 | Ga0265325_10199324 | 3300031241 | Bacteria | 924 |
| 907 | Ga0265329_10145859 | 3300031242 | Unclassified | 766 |
| 908 | Ga0265339_10039467 | 3300031249 | Bacteria | 2628 |
| 909 | Ga0265339_10491206 | 3300031249 | Unclassified | 567 |
| 910 | Ga0265327_10002192 | 3300031251 | Bacteria | 21440 |
| 911 | Ga0265316_10067485 | 3300031344 | Bacteria | 2766 |
| 912 | Ga0265314_10207696 | 3300031711 | Unclassified | 1152 |
| 913 | Ga0265342_10435418 | 3300031712 | Bacteria | 674 |
| 914 | Ga0316214_1011009 | 3300033545 | Unclassified | 1230 |
| 915 | Ga0373930_0001400 | 3300034816 | Bacteria | 3579 |
| 916 | Ga0373938_0066139 | 3300034957 | Bacteria | 855 |
| 917 | Ga0373926_0090662 | 3300035083 | Bacteria | 1136 |
| 918 | Ga0373926_0233855 | 3300035083 | Bacteria | 711 |
| 919 | Ga0373928_0031889 | 3300035084 | Bacteria | 1172 |
| 920 | Ga0373928_0071539 | 3300035084 | Bacteria | 859 |
| 921 | Ga0373934_0045775 | 3300035086 | Bacteria | 1730 |
| 922 | Ga0373934_0102977 | 3300035086 | Bacteria | 1154 |
| 923 | Ga0373944_0005961 | 3300035089 | Bacteria | 3225 |
| 924 | Ga0373944_0042335 | 3300035089 | Bacteria | 1412 |
| 925 | Ga0373949_0174866 | 3300035090 | Bacteria | 633 |
| 926 | Ga0373949_0265954 | 3300035090 | Bacteria | 535 |
| 927 | Ga0373923_0008097 | 3300035111 | Bacteria | 3730 |
| 928 | Ga0373923_0011162 | 3300035111 | Bacteria | 3289 |
| 929 | Ga0373923_0124386 | 3300035111 | Bacteria | 1155 |
| 930 | Ga0373923_0276439 | 3300035111 | Bacteria | 791 |
| 931 | Ga0373932_0035269 | 3300035112 | Bacteria | 1414 |
| 932 | Ga0373932_0195666 | 3300035112 | Unclassified | 716 |
| 933 | Ga0373936_0002796 | 3300035113 | Bacteria | 6504 |
| 934 | Ga0373936_0021212 | 3300035113 | Bacteria | 2526 |
| 935 | Ga0373936_0044835 | 3300035113 | Bacteria | 1780 |
| 936 | Ga0373939_0035171 | 3300035114 | Bacteria | 1474 |
| 937 | Ga0373941_0045222 | 3300035115 | Bacteria | 1377 |
| 938 | Ga0373945_0000643 | 3300035116 | Bacteria | 10068 |
| 939 | Ga0373945_0163324 | 3300035116 | Bacteria | 909 |
| 940 | Ga0373945_0168861 | 3300035116 | Unclassified | 895 |
| 941 | Ga0373953_0048994 | 3300035117 | Bacteria | 1703 |
| 942 | Ga0373953_0114642 | 3300035117 | Bacteria | 1142 |
| 943 | Ga0373953_0127178 | 3300035117 | Unclassified | 1085 |
| 944 | Ga0373953_0519849 | 3300035117 | Unclassified | 528 |
| 945 | Ga0373954_0001904 | 3300035118 | Bacteria | 8630 |
| 946 | Ga0373954_0040058 | 3300035118 | Bacteria | 2182 |
| 947 | Ga0373956_0051417 | 3300035119 | Bacteria | 1852 |
| 948 | Ga0373956_0115786 | 3300035119 | Bacteria | 1250 |
| 949 | Ga0373956_0177977 | 3300035119 | Bacteria | 1005 |
| 950 | Ga0373956_0371934 | 3300035119 | Unclassified | 681 |
| 951 | Ga0373956_0412764 | 3300035119 | Unclassified | 644 |
| 952 | Ga0373957_0028852 | 3300035120 | Bacteria | 2024 |
| 953 | Ga0373957_0100133 | 3300035120 | Bacteria | 1159 |
| 954 | Ga0373943_0000160 | 3300035170 | Bacteria | 26430 |
| 955 | Ga0373943_0003378 | 3300035170 | Bacteria | 7255 |
| 956 | Ga0373943_0025011 | 3300035170 | Bacteria | 2788 |
| 957 | Ga0373943_0038941 | 3300035170 | Bacteria | 2288 |
| 958 | Ga0373943_0039864 | 3300035170 | Bacteria | 2265 |
| 959 | Ga0373943_0286542 | 3300035170 | Bacteria | 932 |
| 960 | Ga0373946_0000797 | 3300035171 | Bacteria | 10751 |
| 961 | Ga0373946_0082813 | 3300035171 | Bacteria | 1408 |
| 962 | Ga0373946_0523929 | 3300035171 | Unclassified | 609 |
| 963 | Ga0373946_0589613 | 3300035171 | Bacteria | 576 |
| 964 | Ga0373955_0020382 | 3300035172 | Bacteria | 3333 |
| 965 | Ga0373955_0115660 | 3300035172 | Bacteria | 1554 |
| 966 | Ga0373955_0748662 | 3300035172 | Unclassified | 600 |
| 967 | Ga0373942_0255558 | 3300035207 | Unclassified | 597 |
| 968 | Ga0373924_0026937 | 3300035410 | Bacteria | 2283 |
| 969 | Ga0373924_0127322 | 3300035410 | Unclassified | 1107 |
| 970 | Ga0373924_0154874 | 3300035410 | Bacteria | 1003 |
| 971 | Ga0373931_0070233 | 3300035691 | Bacteria | 1910 |
| 972 | Ga0373931_0151155 | 3300035691 | Bacteria | 1353 |
| 973 | Ga0373931_1250075 | 3300035691 | Bacteria | 509 |
| 974 | Ga0373935_0000498 | 3300035692 | Bacteria | 20280 |
| 975 | Ga0373935_0002910 | 3300035692 | Bacteria | 9859 |
| 976 | Ga0373935_0060963 | 3300035692 | Bacteria | 2414 |
| 977 | Ga0373935_0574453 | 3300035692 | Bacteria | 823 |
| 978 | Ga0373935_0652200 | 3300035692 | Bacteria | 772 |
| 979 | Ga0373935_0992385 | 3300035692 | Unclassified | 624 |
| 980 | Ga0373927_0000604 | 3300035695 | Bacteria | 27351 |
| 981 | Ga0373927_0003383 | 3300035695 | Bacteria | 11483 |
| 982 | Ga0373927_0025939 | 3300035695 | Bacteria | 3831 |
| 983 | Ga0373927_0170861 | 3300035695 | Bacteria | 1425 |
| 984 | Ga0373933_0029117 | 3300035724 | Bacteria | 3190 |
| 985 | Ga0373933_0112617 | 3300035724 | Bacteria | 1699 |
| 986 | Ga0373933_0262488 | 3300035724 | Bacteria | 1114 |
| 987 | Ga0373933_0333282 | 3300035724 | Bacteria | 984 |
| 988 | Ga0373947_0000784 | 3300035725 | Bacteria | 19102 |
| 989 | Ga0373947_0018126 | 3300035725 | Bacteria | 4051 |
| 990 | Ga0373947_0032610 | 3300035725 | Bacteria | 3071 |
| 991 | Ga0373947_0867116 | 3300035725 | Bacteria | 616 |
| 992 | Ga0373937_0009697 | 3300036401 | Bacteria | 8392 |
| 993 | Ga0373937_0089131 | 3300036401 | Unclassified | 2856 |
| 994 | Ga0373937_0091876 | 3300036401 | Bacteria | 2812 |
| 995 | Ga0373937_0105573 | 3300036401 | Bacteria | 2618 |
| 996 | Ga0373937_0159692 | 3300036401 | Bacteria | 2113 |
| 997 | Ga0373937_0209308 | 3300036401 | Bacteria | 1835 |
| 998 | Ga0373937_0320563 | 3300036401 | Unclassified | 1466 |
| 999 | Ga0373937_0332676 | 3300036401 | Unclassified | 1438 |
| 1000 | Ga0373937_0333039 | 3300036401 | Unclassified | 1437 |
| 1001 | Ga0373937_0488566 | 3300036401 | Bacteria | 1169 |
| 1002 | Ga0373937_0659626 | 3300036401 | Bacteria | 992 |
| 1003 | Ga0373937_0699793 | 3300036401 | Bacteria | 960 |
| 1004 | Ga0373937_1195123 | 3300036401 | Unclassified | 709 |
| 1005 | Ga0373925_0001108 | 3300037068 | Bacteria | 24006 |
| 1006 | Ga0373925_0011747 | 3300037068 | Bacteria | 6335 |
| 1007 | Ga0373925_0012472 | 3300037068 | Bacteria | 6155 |
| 1008 | Ga0373925_0146968 | 3300037068 | Bacteria | 1848 |
| 1009 | Ga0373925_0182303 | 3300037068 | Bacteria | 1663 |
| 1010 | Ga0373925_0208898 | 3300037068 | Unclassified | 1555 |
| 1011 | Ga0373925_0240869 | 3300037068 | Bacteria | 1448 |
| 1012 | Ga0373925_0833930 | 3300037068 | Bacteria | 760 |
| 1013 | Ga0373925_1057410 | 3300037068 | Bacteria | 668 |
| 1014 | Ga0395898_0059841 | 3300037466 | Bacteria | 3704 |
| 1015 | Ga0436364_0313330 | 3300037853 | Bacteria | 1853 |
| 1016 | Ga0395901_1766414 | 3300038443 | Bacteria | 568 |
| 1017 | Ga0436360_0624810 | 3300039438 | Unclassified | 609 |
| 1018 | Ga0436363_0264165 | 3300039450 | Bacteria | 1598 |
| 1019 | Ga0436363_1259540 | 3300039450 | Bacteria | 1662 |
| 1020 | Ga0436362_0916830 | 3300039453 | Bacteria | 1071 |
| 1021 | Ga0451798_0030423 | 3300041458 | Bacteria | 1317 |
| 1022 | Ga0451849_0944457 | 3300041505 | Unclassified | 560 |
| 1023 | Ga0439448_0090858 | 3300042005 | Bacteria | 1032 |
| 1024 | Ga0439462_0070860 | 3300042015 | Unclassified | 947 |
| 1025 | Ga0466963_0001680 | 3300044694 | Bacteria | 12053 |
| 1026 | Ga0453684_1323260 | 3300044712 | Bacteria | 751 |
| 1027 | Ga0453684_1555099 | 3300044712 | Bacteria | 680 |
| 1028 | Ga0451576_0499488 | 3300045051 | Bacteria | 1278 |
| 1029 | Ga0466967_0157735 | 3300045976 | Bacteria | 2127 |
| 1030 | Ga0495592_0025116 | 3300046454 | Unclassified | 4524 |
| 1031 | Ga0495629_0035780 | 3300046459 | Bacteria | 3507 |
| 1032 | Ga0495629_0095064 | 3300046459 | Bacteria | 2079 |
| 1033 | Ga0495629_0180405 | 3300046459 | Bacteria | 1463 |
| 1034 | Ga0495629_0834606 | 3300046459 | Unclassified | 607 |
| 1035 | Ga0495653_0037336 | 3300046463 | Unclassified | 3818 |
| 1036 | Ga0495653_0105308 | 3300046463 | Bacteria | 2037 |
| 1037 | Ga0495580_0009055 | 3300046472 | Bacteria | 7853 |
| 1038 | Ga0495580_0037331 | 3300046472 | Bacteria | 3488 |
| 1039 | Ga0495580_0060543 | 3300046472 | Bacteria | 2660 |
| 1040 | Ga0495580_0143295 | 3300046472 | Bacteria | 1656 |
| 1041 | Ga0495580_0419296 | 3300046472 | Bacteria | 901 |
| 1042 | Ga0495580_0755907 | 3300046472 | Bacteria | 633 |
| 1043 | Ga0495580_0990251 | 3300046472 | Unclassified | 536 |
| 1044 | Ga0495582_0005851 | 3300046473 | Bacteria | 6852 |
| 1045 | Ga0495582_0034032 | 3300046473 | Bacteria | 2801 |
| 1046 | Ga0495639_0107733 | 3300046475 | Unclassified | 1320 |
| 1047 | Ga0495639_0126144 | 3300046475 | Bacteria | 1223 |
| 1048 | Ga0495639_0131946 | 3300046475 | Bacteria | 1196 |
| 1049 | Ga0495639_0499612 | 3300046475 | Unclassified | 621 |
| 1050 | Ga0495662_0150897 | 3300046476 | Bacteria | 1144 |
| 1051 | Ga0495662_0216905 | 3300046476 | Unclassified | 943 |
| 1052 | Ga0495662_0321385 | 3300046476 | Unclassified | 761 |
| 1053 | Ga0495664_0076384 | 3300046477 | Bacteria | 2005 |
| 1054 | Ga0495594_0234163 | 3300046499 | Bacteria | 1047 |
| 1055 | Ga0495594_0720931 | 3300046499 | Unclassified | 563 |
| 1056 | Ga0495608_0009336 | 3300046511 | Bacteria | 6859 |
| 1057 | Ga0495608_0043816 | 3300046511 | Unclassified | 2989 |
| 1058 | Ga0495608_0159912 | 3300046511 | Bacteria | 1433 |
| 1059 | Ga0495608_0559203 | 3300046511 | Unclassified | 689 |
| 1060 | Ga0495618_0005057 | 3300046514 | Bacteria | 8055 |
| 1061 | Ga0495618_0422841 | 3300046514 | Bacteria | 812 |
| 1062 | Ga0495628_0148087 | 3300046516 | Bacteria | 1789 |
| 1063 | Ga0495628_0422631 | 3300046516 | Bacteria | 971 |
| 1064 | Ga0495630_0135164 | 3300046517 | Bacteria | 1874 |
| 1065 | Ga0495630_0141086 | 3300046517 | Unclassified | 1832 |
| 1066 | Ga0495666_0193348 | 3300046526 | Bacteria | 937 |
| 1067 | Ga0495652_0762351 | 3300046529 | Unclassified | 647 |
| 1068 | Ga0495665_0008424 | 3300046531 | Bacteria | 5594 |
| 1069 | Ga0495665_0095224 | 3300046531 | Bacteria | 1563 |
| 1070 | Ga0495665_0380092 | 3300046531 | Bacteria | 717 |
| 1071 | Ga0495640_0128232 | 3300046533 | Bacteria | 1644 |
| 1072 | Ga0495640_0784898 | 3300046533 | Bacteria | 568 |
| 1073 | Ga0495640_0938128 | 3300046533 | Unclassified | 512 |
| 1074 | Ga0495586_0428393 | 3300046535 | Bacteria | 762 |
| 1075 | Ga0495586_0714884 | 3300046535 | Unclassified | 578 |
| 1076 | Ga0495587_0103415 | 3300046536 | Bacteria | 1640 |
| 1077 | Ga0495587_0330809 | 3300046536 | Bacteria | 850 |
| 1078 | Ga0495587_0663198 | 3300046536 | Unclassified | 573 |
| 1079 | Ga0495621_0312016 | 3300046539 | Bacteria | 654 |
| 1080 | Ga0495645_0010880 | 3300046543 | Bacteria | 6390 |
| 1081 | Ga0495645_0073501 | 3300046543 | Bacteria | 2463 |
| 1082 | Ga0495645_0160115 | 3300046543 | Bacteria | 1557 |
| 1083 | Ga0495645_0207159 | 3300046543 | Bacteria | 1326 |
| 1084 | Ga0495667_0000277 | 3300046559 | Bacteria | 33467 |
| 1085 | Ga0495667_0041756 | 3300046559 | Unclassified | 3041 |
| 1086 | Ga0495667_0079814 | 3300046559 | Bacteria | 2127 |
| 1087 | Ga0495667_0481210 | 3300046559 | Bacteria | 778 |
| 1088 | Ga0495635_0033843 | 3300046663 | Bacteria | 3544 |
| 1089 | Ga0495635_0140736 | 3300046663 | Bacteria | 1643 |
| 1090 | Ga0495635_0321246 | 3300046663 | Bacteria | 1036 |
| 1091 | Ga0495635_0465881 | 3300046663 | Bacteria | 834 |
| 1092 | Ga0495657_0000936 | 3300046675 | Bacteria | 25782 |
| 1093 | Ga0495657_0868776 | 3300046675 | Bacteria | 513 |
| 1094 | Ga0495599_0136614 | 3300046678 | Bacteria | 1522 |
| 1095 | Ga0495599_0462790 | 3300046678 | Unclassified | 750 |
| 1096 | Ga0495623_0193200 | 3300046679 | Bacteria | 1174 |
| 1097 | Ga0495623_0208504 | 3300046679 | Bacteria | 1120 |
| 1098 | Ga0495646_0540401 | 3300046680 | Bacteria | 596 |
| 1099 | Ga0495647_0440000 | 3300046681 | Unclassified | 602 |
| 1100 | Ga0495658_0088134 | 3300046683 | Bacteria | 1833 |
| 1101 | Ga0495658_0102203 | 3300046683 | Bacteria | 1712 |
| 1102 | Ga0495658_0127276 | 3300046683 | Unclassified | 1547 |
| 1103 | Ga0495613_0018921 | 3300046689 | Bacteria | 5131 |
| 1104 | Ga0495613_0113107 | 3300046689 | Bacteria | 1955 |
| 1105 | Ga0495624_0060288 | 3300046690 | Bacteria | 2379 |
| 1106 | Ga0495600_0008862 | 3300046809 | Bacteria | 6198 |
| 1107 | Ga0495600_0064066 | 3300046809 | Bacteria | 2402 |
| 1108 | Ga0495600_0241178 | 3300046809 | Unclassified | 1152 |
| 1109 | Ga0495581_0037666 | 3300047315 | Bacteria | 2799 |
| 1110 | Ga0495581_0183131 | 3300047315 | Bacteria | 1225 |
| 1111 | Ga0495581_0293544 | 3300047315 | Bacteria | 950 |
| 1112 | Ga0495604_0028112 | 3300047317 | Unclassified | 4473 |
| 1113 | Ga0495604_0177439 | 3300047317 | Bacteria | 1492 |
| 1114 | Ga0495604_0976042 | 3300047317 | Unclassified | 526 |
| 1115 | Ga0495636_0060324 | 3300047318 | Bacteria | 1602 |
| 1116 | Ga0495674_0006894 | 3300047319 | Bacteria | 10870 |
| 1117 | Ga0495674_0008196 | 3300047319 | Bacteria | 9970 |
| 1118 | Ga0495674_0014550 | 3300047319 | Bacteria | 7361 |
| 1119 | Ga0495674_0048386 | 3300047319 | Unclassified | 3763 |
| 1120 | Ga0495674_0151828 | 3300047319 | Bacteria | 1942 |
| 1121 | Ga0495674_0835440 | 3300047319 | Bacteria | 714 |
| 1122 | Ga0495674_1113107 | 3300047319 | Bacteria | 601 |
| 1123 | Ga0495680_0017498 | 3300047322 | Bacteria | 6118 |
| 1124 | Ga0495680_0027911 | 3300047322 | Bacteria | 4632 |
| 1125 | Ga0495680_0551130 | 3300047322 | Bacteria | 777 |
| 1126 | Ga0495675_0011783 | 3300047444 | Bacteria | 5494 |
| 1127 | Ga0495675_0450737 | 3300047444 | Unclassified | 744 |
| 1128 | Ga0495684_0004509 | 3300047471 | Bacteria | 10877 |
| 1129 | Ga0495684_0006624 | 3300047471 | Bacteria | 8984 |
| 1130 | Ga0495684_0019347 | 3300047471 | Bacteria | 5242 |
| 1131 | Ga0495684_0143359 | 3300047471 | Unclassified | 1790 |
| 1132 | Ga0495684_0656066 | 3300047471 | Unclassified | 701 |
| 1133 | Ga0495593_0186576 | 3300047673 | Bacteria | 1044 |
| 1134 | Ga0495593_0559818 | 3300047673 | Bacteria | 574 |
| 1135 | Ga0495602_0108261 | 3300048088 | Bacteria | 2263 |
| 1136 | Ga0495602_0178625 | 3300048088 | Bacteria | 1640 |
| 1137 | Ga0495602_0227694 | 3300048088 | Bacteria | 1403 |
| 1138 | Ga0495602_0636448 | 3300048088 | Bacteria | 730 |
| 1139 | Ga0496100_0038711 | 3300048903 | Bacteria | 3024 |
| 1140 | Ga0496100_0568110 | 3300048903 | Unclassified | 879 |
| 1141 | Ga0496101_0100746 | 3300048904 | Bacteria | 2162 |
| 1142 | Ga0496101_0780094 | 3300048904 | Bacteria | 754 |
| 1143 | Ga0496102_0001997 | 3300048905 | Bacteria | 17620 |
| 1144 | Ga0496102_0066898 | 3300048905 | Bacteria | 3294 |
| 1145 | Ga0496102_0209037 | 3300048905 | Bacteria | 1840 |
| 1146 | Ga0496102_0345836 | 3300048905 | Bacteria | 1400 |
| 1147 | Ga0496102_0565097 | 3300048905 | Bacteria | 1060 |
| 1148 | Ga0496103_0001993 | 3300048906 | Bacteria | 13163 |
| 1149 | Ga0496103_0103565 | 3300048906 | Bacteria | 1803 |
| 1150 | Ga0496103_0270413 | 3300048906 | Bacteria | 1093 |
| 1151 | Ga0496104_0045606 | 3300048907 | Bacteria | 4124 |
| 1152 | Ga0496104_0049267 | 3300048907 | Bacteria | 3973 |
| 1153 | Ga0496104_0116180 | 3300048907 | Bacteria | 2568 |
| 1154 | Ga0496104_0137482 | 3300048907 | Bacteria | 2347 |
| 1155 | Ga0496104_0281469 | 3300048907 | Bacteria | 1576 |
| 1156 | Ga0496105_0243784 | 3300048908 | Unclassified | 1458 |
| 1157 | Ga0496105_0576448 | 3300048908 | Bacteria | 876 |
| 1158 | Ga0496105_1099812 | 3300048908 | Unclassified | 590 |
| 1159 | Ga0496105_1271957 | 3300048908 | Unclassified | 538 |
| 1160 | Ga0496106_0098595 | 3300048909 | Bacteria | 2264 |
| 1161 | Ga0496106_0250873 | 3300048909 | Bacteria | 1415 |
| 1162 | Ga0496106_0268460 | 3300048909 | Unclassified | 1366 |
| 1163 | Ga0496106_0754506 | 3300048909 | Bacteria | 773 |
| 1164 | Ga0496106_1314096 | 3300048909 | Bacteria | 561 |
| 1165 | Ga0496107_0049959 | 3300048910 | Bacteria | 3014 |
| 1166 | Ga0496107_0145677 | 3300048910 | Bacteria | 1751 |
| 1167 | Ga0496107_0154798 | 3300048910 | Bacteria | 1697 |
| 1168 | Ga0496108_0080060 | 3300048911 | Bacteria | 2767 |
| 1169 | Ga0496108_0118247 | 3300048911 | Bacteria | 2271 |
| 1170 | Ga0496108_1705733 | 3300048911 | Unclassified | 518 |
| 1171 | Ga0496109_0188194 | 3300048912 | Bacteria | 1939 |
| 1172 | Ga0496109_0226694 | 3300048912 | Bacteria | 1758 |
| 1173 | Ga0496109_0300397 | 3300048912 | Bacteria | 1514 |
| 1174 | Ga0496109_0528493 | 3300048912 | Bacteria | 1113 |
| 1175 | Ga0496110_0249651 | 3300048913 | Bacteria | 1615 |
| 1176 | Ga0496110_1517823 | 3300048913 | Bacteria | 580 |
| 1177 | Ga0496112_0046227 | 3300048915 | Bacteria | 4269 |
| 1178 | Ga0496112_0836133 | 3300048915 | Bacteria | 844 |
| 1179 | Ga0496113_0105962 | 3300048916 | Bacteria | 2183 |
| 1180 | Ga0496114_0079332 | 3300048917 | Bacteria | 2771 |
| 1181 | Ga0496114_0661921 | 3300048917 | Unclassified | 918 |
| 1182 | Ga0496115_0017708 | 3300048918 | Bacteria | 5453 |
| 1183 | Ga0496115_0142954 | 3300048918 | Unclassified | 1974 |
| 1184 | Ga0496115_0185961 | 3300048918 | Bacteria | 1717 |
| 1185 | Ga0496115_0555761 | 3300048918 | Bacteria | 917 |
| 1186 | Ga0501034_0257266 | 3300049571 | Bacteria | 1689 |
| 1187 | Ga0501047_0055036 | 3300049581 | Bacteria | 3848 |
| 1188 | Ga0501069_0090666 | 3300049585 | Bacteria | 1729 |
| 1189 | Ga0501069_0218998 | 3300049585 | Bacteria | 1106 |
| 1190 | Ga0501069_0991254 | 3300049585 | Unclassified | 513 |
| 1191 | Ga0501070_0034390 | 3300049586 | Bacteria | 4238 |
| 1192 | Ga0501072_0133112 | 3300049588 | Bacteria | 1982 |
| 1193 | Ga0501073_0080602 | 3300049589 | Bacteria | 2264 |
| 1194 | Ga0501074_0098170 | 3300049590 | Bacteria | 2096 |
| 1195 | Ga0501079_0419524 | 3300049741 | Bacteria | 1050 |
| 1196 | Ga0501080_0014100 | 3300049742 | Bacteria | 7356 |
| 1197 | Ga0501083_0065455 | 3300049744 | Bacteria | 2421 |
| 1198 | nmdc:mga05p37_832854_c1 | 3300050507 | Unclassified | 1004 |
| 1199 | nmdc:mga08y16_212963_c1 | 3300050511 | Bacteria | 2001 |
| 1200 | nmdc:mga0n895_1232725_c1 | 3300050512 | Bacteria | 721 |
| 1201 | nmdc:mga0n895_255159_c1 | 3300050512 | Bacteria | 1779 |
| 1202 | nmdc:mga0n895_26581_c1 | 3300050512 | Bacteria | 5484 |
| 1203 | nmdc:mga0n895_654741_c1 | 3300050512 | Bacteria | 1049 |
| 1204 | nmdc:mga0n895_67222_c1 | 3300050512 | Bacteria | 3549 |
| 1205 | nmdc:mga0rr50_279874_c1 | 3300050513 | Bacteria | 1392 |
| 1206 | nmdc:mga0a205_1325787_c1 | 3300050515 | Unclassified | 567 |
| 1207 | Ga0495601_0042809 | 3300053077 | Bacteria | 2843 |
| 1208 | Ga0495612_0439229 | 3300053078 | Unclassified | 595 |
| 1209 | Ga0495595_0151911 | 3300053084 | Bacteria | 1140 |
| 1210 | Ga0495619_0021380 | 3300053085 | Unclassified | 4130 |
| 1211 | Ga0501084_0238509 | 3300054114 | Bacteria | 1535 |
| 1212 | Ga0501084_0578344 | 3300054114 | Bacteria | 949 |
| 1213 | Ga0587073_0044818 | 3300059492 | Bacteria | 979 |
| 1214 | Ga0587082_018394 | 3300059504 | Bacteria | 1111 |
| 1215 | Ga0587115_028856 | 3300059626 | Bacteria | 815 |
| 1216 | Ga0587067_178578 | 3300059640 | Bacteria | 551 |
| 1217 | Ga0587076_036248 | 3300059645 | Bacteria | 901 |
| 1218 | Ga0587078_022313 | 3300059646 | Bacteria | 808 |
| 1219 | Ga0587079_031963 | 3300059647 | Bacteria | 1017 |
| 1220 | Ga0501082_0828560 | 3300060353 | Bacteria | 809 |
| 1221 | Ga0099794_10048776 | |||
| 1222 | Ga0058861_10066547 | |||
| 1223 | Ga0058861_10853320 | |||
| 1224 | Ga0058861_12010396 | |||
| 1225 | Ga0058862_10230424 | |||
| 1226 | Ga0058862_12088404 | |||
| 1227 | Ga0065712_10148705 | |||
| 1228 | Ga0065712_10289847 | |||
| 1229 | Ga0065712_10659416 | |||
| 1230 | Ga0065712_10718242 | |||
| 1231 | Ga0065715_10133368 | |||
| 1232 | Ga0070676_10008159 | |||
| 1233 | Ga0070676_10011314 | |||
| 1234 | Ga0070676_10545856 | |||
| 1235 | Ga0070676_10915332 | |||
| 1236 | Ga0070683_100022089 | |||
| 1237 | Ga0070683_100100806 | |||
| 1238 | Ga0070683_100158802 | |||
| 1239 | Ga0070683_100331382 | |||
| 1240 | Ga0070690_100004580 | |||
| 1241 | Ga0070690_100038806 | |||
| 1242 | Ga0070690_100155963 | |||
| 1243 | Ga0070670_100000950 | |||
| 1244 | Ga0070670_100051859 | |||
| 1245 | Ga0070670_100118833 | |||
| 1246 | Ga0070670_100183310 | |||
| 1247 | Ga0070670_100420286 | |||
| 1248 | Ga0070670_101154275 | |||
| 1249 | Ga0070677_10245279 | |||
| 1250 | Ga0070677_10411659 | |||
| 1251 | Ga0068869_100003830 | |||
| 1252 | Ga0068869_100012520 | |||
| 1253 | Ga0068869_100015741 | |||
| 1254 | Ga0068869_100035741 | |||
| 1255 | Ga0068869_100225718 | |||
| 1256 | Ga0068869_101438714 | |||
| 1257 | Ga0068869_101864576 | |||
| 1258 | Ga0070666_10000307 | |||
| 1259 | Ga0070666_10006800 | |||
| 1260 | Ga0070666_10091506 | |||
| 1261 | Ga0070666_10142110 | |||
| 1262 | Ga0070666_10150328 | |||
| 1263 | Ga0070666_10249042 | |||
| 1264 | Ga0070666_10312040 | |||
| 1265 | Ga0070666_10417770 | |||
| 1266 | Ga0070666_11021236 | |||
| 1267 | Ga0070680_100023341 | |||
| 1268 | Ga0070680_100092194 | |||
| 1269 | Ga0070680_100183914 | |||
| 1270 | Ga0070682_100159384 | |||
| 1271 | Ga0070682_100222333 | |||
| 1272 | Ga0070682_100247461 | |||
| 1273 | Ga0070682_100871184 | |||
| 1274 | Ga0068868_100002020 | |||
| 1275 | Ga0068868_100002966 | |||
| 1276 | Ga0068868_100028342 | |||
| 1277 | Ga0068868_100070366 | |||
| 1278 | Ga0068868_100249670 | |||
| 1279 | Ga0068868_100346495 | |||
| 1280 | Ga0068868_100416448 | |||
| 1281 | Ga0068868_102264125 | |||
| 1282 | Ga0070660_100198597 | |||
| 1283 | Ga0070660_100322247 | |||
| 1284 | Ga0070660_101262901 | |||
| 1285 | Ga0070689_100127148 | |||
| 1286 | Ga0070689_100258752 | |||
| 1287 | Ga0070689_100276873 | |||
| 1288 | Ga0070689_100286294 | |||
| 1289 | Ga0070691_10148086 | |||
| 1290 | Ga0070687_101251987 | |||
| 1291 | Ga0070661_100010979 | |||
| 1292 | Ga0070661_100011400 | |||
| 1293 | Ga0070661_100017145 | |||
| 1294 | Ga0070661_100376373 | |||
| 1295 | Ga0070692_10017351 | |||
| 1296 | Ga0070692_10219897 | |||
| 1297 | Ga0070668_100009164 | |||
| 1298 | Ga0070668_100015740 | |||
| 1299 | Ga0070668_100109338 | |||
| 1300 | Ga0070668_100569390 | |||
| 1301 | Ga0070668_100691078 | |||
| 1302 | Ga0070668_101067396 | |||
| 1303 | Ga0070669_100009226 | |||
| 1304 | Ga0070669_100078187 | |||
| 1305 | Ga0070669_100456871 | |||
| 1306 | Ga0070675_100012308 | |||
| 1307 | Ga0070675_100015107 | |||
| 1308 | Ga0070675_100300466 | |||
| 1309 | Ga0070671_100006881 | |||
| 1310 | Ga0070671_100008247 | |||
| 1311 | Ga0070671_100213435 | |||
| 1312 | Ga0070674_100015074 | |||
| 1313 | Ga0070674_100027369 | |||
| 1314 | Ga0070674_101516609 | |||
| 1315 | Ga0070674_102038998 | |||
| 1316 | Ga0070673_100004008 | |||
| 1317 | Ga0070673_100140583 | |||
| 1318 | Ga0070673_100172456 | |||
| 1319 | Ga0070673_100273212 | |||
| 1320 | Ga0070673_100445271 | |||
| 1321 | Ga0070673_100550291 | |||
| 1322 | Ga0070673_102174569 | |||
| 1323 | Ga0070688_100006308 | |||
| 1324 | Ga0070688_100046463 | |||
| 1325 | Ga0070688_100963643 | |||
| 1326 | Ga0070659_100016993 | |||
| 1327 | Ga0070659_100755697 | |||
| 1328 | Ga0070659_101634578 | |||
| 1329 | Ga0070667_100001519 | |||
| 1330 | Ga0070667_100004143 | |||
| 1331 | Ga0070667_100023166 | |||
| 1332 | Ga0070667_100065830 | |||
| 1333 | Ga0070667_100147571 | |||
| 1334 | Ga0070667_100219284 | |||
| 1335 | Ga0070667_100257499 | |||
| 1336 | Ga0070667_100463753 | |||
| 1337 | Ga0070667_100672718 | |||
| 1338 | Ga0070709_10003057 | |||
| 1339 | Ga0070709_10033855 | |||
| 1340 | Ga0070709_10034812 | |||
| 1341 | Ga0070709_10103503 | |||
| 1342 | Ga0070709_10240879 | |||
| 1343 | Ga0070709_10294933 | |||
| 1344 | Ga0070709_10494140 | |||
| 1345 | Ga0070709_10593865 | |||
| 1346 | Ga0070709_10826113 | |||
| 1347 | Ga0070714_100034856 | |||
| 1348 | Ga0070714_100223181 | |||
| 1349 | Ga0070714_100867719 | |||
| 1350 | Ga0070714_101007189 | |||
| 1351 | Ga0070713_100004902 | |||
| 1352 | Ga0070713_100014740 | |||
| 1353 | Ga0070713_100016919 | |||
| 1354 | Ga0070713_100039281 | |||
| 1355 | Ga0070713_100955995 | |||
| 1356 | Ga0070713_101133704 | |||
| 1357 | Ga0070713_101271123 | |||
| 1358 | Ga0070710_10052393 | |||
| 1359 | Ga0070710_10074352 | |||
| 1360 | Ga0070710_10312082 | |||
| 1361 | Ga0070710_10317481 | |||
| 1362 | Ga0070701_11092581 | |||
| 1363 | Ga0070701_11156367 | |||
| 1364 | Ga0070711_100013269 | |||
| 1365 | Ga0070711_100017806 | |||
| 1366 | Ga0070711_100034081 | |||
| 1367 | Ga0070711_100060641 | |||
| 1368 | Ga0070711_100228661 | |||
| 1369 | Ga0070711_100403336 | |||
| 1370 | Ga0070711_101486970 | |||
| 1371 | Ga0070705_100099614 | |||
| 1372 | Ga0070705_100140125 | |||
| 1373 | Ga0070705_100585444 | |||
| 1374 | Ga0070694_100091962 | |||
| 1375 | Ga0070694_100289858 | |||
| 1376 | Ga0070708_100001177 | |||
| 1377 | Ga0070708_100003267 | |||
| 1378 | Ga0070708_100100428 | |||
| 1379 | Ga0070708_100329461 | |||
| 1380 | Ga0070708_100415306 | |||
| 1381 | Ga0070708_100593007 | |||
| 1382 | Ga0070708_101042416 | |||
| 1383 | Ga0070663_100010222 | |||
| 1384 | Ga0070663_100120004 | |||
| 1385 | Ga0070678_100009727 | |||
| 1386 | Ga0070678_100064384 | |||
| 1387 | Ga0070678_100157796 | |||
| 1388 | Ga0070662_100004776 | |||
| 1389 | Ga0070662_100008211 | |||
| 1390 | Ga0070681_10002028 | |||
| 1391 | Ga0070681_10014060 | |||
| 1392 | Ga0070681_10060328 | |||
| 1393 | Ga0070681_10552390 | |||
| 1394 | Ga0070681_10734524 | |||
| 1395 | Ga0070681_11130016 | |||
| 1396 | Ga0068867_100012126 | |||
| 1397 | Ga0068867_100023605 | |||
| 1398 | Ga0068867_100030550 | |||
| 1399 | Ga0068867_100238346 | |||
| 1400 | Ga0068867_100312573 | |||
| 1401 | Ga0068867_100936642 | |||
| 1402 | Ga0070685_10016951 | |||
| 1403 | Ga0070685_10061380 | |||
| 1404 | Ga0070685_10228219 | |||
| 1405 | Ga0070685_11121746 | |||
| 1406 | Ga0070706_100000852 | |||
| 1407 | Ga0070706_100070410 | |||
| 1408 | Ga0070706_100433995 | |||
| 1409 | Ga0070706_100632665 | |||
| 1410 | Ga0070707_100001948 | |||
| 1411 | Ga0070707_100100064 | |||
| 1412 | Ga0070707_100178281 | |||
| 1413 | Ga0070707_100192858 | |||
| 1414 | Ga0070707_100201406 | |||
| 1415 | Ga0070707_100202181 | |||
| 1416 | Ga0070707_100579781 | |||
| 1417 | Ga0070707_101408472 | |||
| 1418 | Ga0070698_100008866 | |||
| 1419 | Ga0070698_100047078 | |||
| 1420 | Ga0070698_100084976 | |||
| 1421 | Ga0070698_100149494 | |||
| 1422 | Ga0070698_100528179 | |||
| 1423 | Ga0070698_100652109 | |||
| 1424 | Ga0070698_101773191 | |||
| 1425 | Ga0070699_100041048 | |||
| 1426 | Ga0070699_100046528 | |||
| 1427 | Ga0070699_100085912 | |||
| 1428 | Ga0070699_100164649 | |||
| 1429 | Ga0070699_100395736 | |||
| 1430 | Ga0070679_100024800 | |||
| 1431 | Ga0070679_100024972 | |||
| 1432 | Ga0070679_100030000 | |||
| 1433 | Ga0070679_100040198 | |||
| 1434 | Ga0070679_100148036 | |||
| 1435 | Ga0070679_100333836 | |||
| 1436 | Ga0070679_101186630 | |||
| 1437 | Ga0070684_100679968 | |||
| 1438 | Ga0070697_100001492 | |||
| 1439 | Ga0070697_100002458 | |||
| 1440 | Ga0070697_100053092 | |||
| 1441 | Ga0070697_100089042 | |||
| 1442 | Ga0070697_100111686 | |||
| 1443 | Ga0070697_100369194 | |||
| 1444 | Ga0070697_100458103 | |||
| 1445 | Ga0070697_100982767 | |||
| 1446 | Ga0070697_101171192 | |||
| 1447 | Ga0070697_101259443 | |||
| 1448 | Ga0068853_100002937 | |||
| 1449 | Ga0068853_100017845 | |||
| 1450 | Ga0068853_100034977 | |||
| 1451 | Ga0068853_100129793 | |||
| 1452 | Ga0070672_100001186 | |||
| 1453 | Ga0070672_100050221 | |||
| 1454 | Ga0070672_100286715 | |||
| 1455 | Ga0070672_100356862 | |||
| 1456 | Ga0070672_100531042 | |||
| 1457 | Ga0070672_101302193 | |||
| 1458 | Ga0070686_100011604 | |||
| 1459 | Ga0070686_100704205 | |||
| 1460 | Ga0070695_100016051 | |||
| 1461 | Ga0070695_100052111 | |||
| 1462 | Ga0070696_100032942 | |||
| 1463 | Ga0070696_100133369 | |||
| 1464 | Ga0070696_100142096 | |||
| 1465 | Ga0070696_100165538 | |||
| 1466 | Ga0070696_100812987 | |||
| 1467 | Ga0070696_100957306 | |||
| 1468 | Ga0070693_100003714 | |||
| 1469 | Ga0070693_100143242 | |||
| 1470 | Ga0070693_100181277 | |||
| 1471 | Ga0070693_100791316 | |||
| 1472 | Ga0070665_100011794 | |||
| 1473 | Ga0070665_100354320 | |||
| 1474 | Ga0070665_100700936 | |||
| 1475 | Ga0070704_100003098 | |||
| 1476 | Ga0070704_100541231 | |||
| 1477 | Ga0068855_100010540 | |||
| 1478 | Ga0068855_100281501 | |||
| 1479 | Ga0068855_100551844 | |||
| 1480 | Ga0068855_100640922 | |||
| 1481 | Ga0070664_100000458 | |||
| 1482 | Ga0070664_100070558 | |||
| 1483 | Ga0068857_100022459 | |||
| 1484 | Ga0068857_100228430 | |||
| 1485 | Ga0068857_100499298 | |||
| 1486 | Ga0068857_101047179 | |||
| 1487 | Ga0068854_100005528 | |||
| 1488 | Ga0068854_100048778 | |||
| 1489 | Ga0068854_100074454 | |||
| 1490 | Ga0068854_100242223 | |||
| 1491 | Ga0068856_100004947 | |||
| 1492 | Ga0068856_100064436 | |||
| 1493 | Ga0068856_100205315 | |||
| 1494 | Ga0068856_100333132 | |||
| 1495 | Ga0070702_100006695 | |||
| 1496 | Ga0070702_100088175 | |||
| 1497 | Ga0070702_100150165 | |||
| 1498 | Ga0070702_100769510 | |||
| 1499 | Ga0070702_100840189 | |||
| 1500 | Ga0068852_100095348 | |||
| 1501 | Ga0068852_100215233 | |||
| 1502 | Ga0068852_100259006 | |||
| 1503 | Ga0068852_100280198 | |||
| 1504 | Ga0068859_100001589 | |||
| 1505 | Ga0068859_100007804 | |||
| 1506 | Ga0068859_100038603 | |||
| 1507 | Ga0068859_100501292 | |||
| 1508 | Ga0068859_100618303 | |||
| 1509 | Ga0068859_100623137 | |||
| 1510 | Ga0068859_100988113 | |||
| 1511 | Ga0068859_102507480 | |||
| 1512 | Ga0068864_100001439 | |||
| 1513 | Ga0068864_100010797 | |||
| 1514 | Ga0068864_100014458 | |||
| 1515 | Ga0068864_100073651 | |||
| 1516 | Ga0068864_100116325 | |||
| 1517 | Ga0068864_100143020 | |||
| 1518 | Ga0068864_102344108 | |||
| 1519 | Ga0068866_10044089 | |||
| 1520 | Ga0068866_10089447 | |||
| 1521 | Ga0068866_10133346 | |||
| 1522 | Ga0068861_100026229 | |||
| 1523 | Ga0068861_100027309 | |||
| 1524 | Ga0068861_100070652 | |||
| 1525 | Ga0068861_100245438 | |||
| 1526 | Ga0068861_101270071 | |||
| 1527 | Ga0068851_10003793 | |||
| 1528 | Ga0068851_10144790 | |||
| 1529 | Ga0068851_10228430 | |||
| 1530 | Ga0068870_10007895 | |||
| 1531 | Ga0068870_10238450 | |||
| 1532 | Ga0068863_100008488 | |||
| 1533 | Ga0068863_100014056 | |||
| 1534 | Ga0068863_100047519 | |||
| 1535 | Ga0068863_100167472 | |||
| 1536 | Ga0068863_100508714 | |||
| 1537 | Ga0068863_101838137 | |||
| 1538 | Ga0068858_100007581 | |||
| 1539 | Ga0068858_100013060 | |||
| 1540 | Ga0068858_100026578 | |||
| 1541 | Ga0068858_100129041 | |||
| 1542 | Ga0068858_100709384 | |||
| 1543 | Ga0068858_100989881 | |||
| 1544 | Ga0068858_101128329 | |||
| 1545 | Ga0068860_100015899 | |||
| 1546 | Ga0068860_100022961 | |||
| 1547 | Ga0068860_100023141 | |||
| 1548 | Ga0068860_100024545 | |||
| 1549 | Ga0068860_100095512 | |||
| 1550 | Ga0068860_100327059 | |||
| 1551 | Ga0068860_100664342 | |||
| 1552 | Ga0068860_101000283 | |||
| 1553 | Ga0068860_101626115 | |||
| 1554 | Ga0068862_100008280 | |||
| 1555 | Ga0068862_100020689 | |||
| 1556 | Ga0068862_100026490 | |||
| 1557 | Ga0081455_10035713 | |||
| 1558 | Ga0070717_10002892 | |||
| 1559 | Ga0070717_10092736 | |||
| 1560 | Ga0070717_10098886 | |||
| 1561 | Ga0070717_10283116 | |||
| 1562 | Ga0070717_10293220 | |||
| 1563 | Ga0070717_10312903 | |||
| 1564 | Ga0070717_10445135 | |||
| 1565 | Ga0070717_10556301 | |||
| 1566 | Ga0070717_11087821 | |||
| 1567 | Ga0070717_11543988 | |||
| 1568 | Ga0070715_10010911 | |||
| 1569 | Ga0070715_10113239 | |||
| 1570 | Ga0070715_10175492 | |||
| 1571 | Ga0070715_10240646 | |||
| 1572 | Ga0070715_10476186 | |||
| 1573 | Ga0070716_100011744 | |||
| 1574 | Ga0070716_100030497 | |||
| 1575 | Ga0070716_100038872 | |||
| 1576 | Ga0070716_100141287 | |||
| 1577 | Ga0070712_100000418 | |||
| 1578 | Ga0070712_100019574 | |||
| 1579 | Ga0070712_100048651 | |||
| 1580 | Ga0070712_100266664 | |||
| 1581 | Ga0070712_100312721 | |||
| 1582 | Ga0070712_100427164 | |||
| 1583 | Ga0070712_100775610 | |||
| 1584 | Ga0097621_100000014 | |||
| 1585 | Ga0097621_100009268 | |||
| 1586 | Ga0097621_100022241 | |||
| 1587 | Ga0097621_100091058 | |||
| 1588 | Ga0097621_100115333 | |||
| 1589 | Ga0097621_100127642 | |||
| 1590 | Ga0097621_100179492 | |||
| 1591 | Ga0097621_100272470 | |||
| 1592 | Ga0097621_100280098 | |||
| 1593 | Ga0068871_100001999 | |||
| 1594 | Ga0068871_100004180 | |||
| 1595 | Ga0068871_100081616 | |||
| 1596 | Ga0068871_100116097 | |||
| 1597 | Ga0068871_100165111 | |||
| 1598 | Ga0068871_100344588 | |||
| 1599 | Ga0068871_100570102 | |||
| 1600 | Ga0068871_100723135 | |||
| 1601 | Ga0068871_100859184 | |||
| 1602 | Ga0075428_102077132 | |||
| 1603 | Ga0075434_100014175 | |||
| 1604 | Ga0075434_100172949 | |||
| 1605 | Ga0075434_100314527 | |||
| 1606 | Ga0075434_100598976 | |||
| 1607 | Ga0075434_100735382 | |||
| 1608 | Ga0068865_100009058 | |||
| 1609 | Ga0068865_100193421 | |||
| 1610 | Ga0068865_100321070 | |||
| 1611 | Ga0068865_100491206 | |||
| 1612 | Ga0068865_100668187 | |||
| 1613 | Ga0068865_101656819 | |||
| 1614 | Ga0097620_100001589 | |||
| 1615 | Ga0097620_100007804 | |||
| 1616 | Ga0097620_100038602 | |||
| 1617 | Ga0097620_100501294 | |||
| 1618 | Ga0097620_100618296 | |||
| 1619 | Ga0097620_100623154 | |||
| 1620 | Ga0097620_100988080 | |||
| 1621 | Ga0075435_100138164 | |||
| 1622 | Ga0099794_10005281 | |||
| 1623 | Ga0099794_10129722 | |||
| 1624 | Ga0099794_10282159 | |||
| 1625 | Ga0099794_10284175 | |||
| 1626 | Ga0099795_10042049 | |||
| 1627 | Ga0099795_10187612 | |||
| 1628 | Ga0105251_10280838 | |||
| 1629 | Ga0105240_10022263 | |||
| 1630 | Ga0105240_10178654 | |||
| 1631 | Ga0111539_10078212 | |||
| 1632 | Ga0105245_10007246 | |||
| 1633 | Ga0105245_10049059 | |||
| 1634 | Ga0105245_10083814 | |||
| 1635 | Ga0105245_10102331 | |||
| 1636 | Ga0105245_10205801 | |||
| 1637 | Ga0105245_10221109 | |||
| 1638 | Ga0105247_10006527 | |||
| 1639 | Ga0105247_10063272 | |||
| 1640 | Ga0105247_10097883 | |||
| 1641 | Ga0105247_10128880 | |||
| 1642 | Ga0114129_10816361 | |||
| 1643 | Ga0105243_10045381 | |||
| 1644 | Ga0105243_10119327 | |||
| 1645 | Ga0105243_10578849 | |||
| 1646 | Ga0105243_10949310 | |||
| 1647 | Ga0105243_11654072 | |||
| 1648 | Ga0105241_10006955 | |||
| 1649 | Ga0105241_10036314 | |||
| 1650 | Ga0105241_10076388 | |||
| 1651 | Ga0105241_10456835 | |||
| 1652 | Ga0105241_10462693 | |||
| 1653 | Ga0105241_10524216 | |||
| 1654 | Ga0105241_10576017 | |||
| 1655 | Ga0105242_10012281 | |||
| 1656 | Ga0105242_10014388 | |||
| 1657 | Ga0105242_10093708 | |||
| 1658 | Ga0105242_10433937 | |||
| 1659 | Ga0105242_10888027 | |||
| 1660 | Ga0105242_11030095 | |||
| 1661 | Ga0105242_11072811 | |||
| 1662 | Ga0105248_10003392 | |||
| 1663 | Ga0105248_10004108 | |||
| 1664 | Ga0105248_10007334 | |||
| 1665 | Ga0105248_10035732 | |||
| 1666 | Ga0105248_10095507 | |||
| 1667 | Ga0105248_10746186 | |||
| 1668 | Ga0105248_10932140 | |||
| 1669 | Ga0105248_11047804 | |||
| 1670 | Ga0105248_12691484 | |||
| 1671 | Ga0105237_10017698 | |||
| 1672 | Ga0105237_10124734 | |||
| 1673 | Ga0105237_10339726 | |||
| 1674 | Ga0105237_10471731 | |||
| 1675 | Ga0105237_10761496 | |||
| 1676 | Ga0105238_10000099 | |||
| 1677 | Ga0105238_10138906 | |||
| 1678 | Ga0105238_10154742 | |||
| 1679 | Ga0105238_10388461 | |||
| 1680 | Ga0105238_11346887 | |||
| 1681 | Ga0105249_10009430 | |||
| 1682 | Ga0105249_10014370 | |||
| 1683 | Ga0105249_10246876 | |||
| 1684 | Ga0105249_10650461 | |||
| 1685 | Ga0099796_10002278 | |||
| 1686 | Ga0099796_10015019 | |||
| 1687 | Ga0099796_10048407 | |||
| 1688 | Ga0099796_10095122 | |||
| 1689 | Ga0099796_10113727 | |||
| 1690 | Ga0105239_10097587 | |||
| 1691 | Ga0105239_10311771 | |||
| 1692 | Ga0105239_11171213 | |||
| 1693 | Ga0105239_12096509 | |||
| 1694 | Ga0105239_12659479 | |||
| 1695 | Ga0105246_10062177 | |||
| 1696 | Ga0105246_11249138 | |||
| 1697 | Ga0157373_10032405 | |||
| 1698 | Ga0157373_10101168 | |||
| 1699 | Ga0157373_10297976 | |||
| 1700 | Ga0157371_10009565 | |||
| 1701 | Ga0157371_10172700 | |||
| 1702 | Ga0157371_10453640 | |||
| 1703 | Ga0157370_10021505 | |||
| 1704 | Ga0157370_10028570 | |||
| 1705 | Ga0157370_10098581 | |||
| 1706 | Ga0157370_10160799 | |||
| 1707 | Ga0157370_10547831 | |||
| 1708 | Ga0157370_10856658 | |||
| 1709 | Ga0157370_11612312 | |||
| 1710 | Ga0157369_10000042 | |||
| 1711 | Ga0157369_10008948 | |||
| 1712 | Ga0157369_10126770 | |||
| 1713 | Ga0157369_10279093 | |||
| 1714 | Ga0157369_10549482 | |||
| 1715 | Ga0157374_10001481 | |||
| 1716 | Ga0157374_10012750 | |||
| 1717 | Ga0157374_10052809 | |||
| 1718 | Ga0157374_10223247 | |||
| 1719 | Ga0157374_10297353 | |||
| 1720 | Ga0157378_10003695 | |||
| 1721 | Ga0157378_10015632 | |||
| 1722 | Ga0157378_10092887 | |||
| 1723 | Ga0157378_10114327 | |||
| 1724 | Ga0157378_10276658 | |||
| 1725 | Ga0157378_10657367 | |||
| 1726 | Ga0157378_11184342 | |||
| 1727 | Ga0163162_10000673 | |||
| 1728 | Ga0163162_10001514 | |||
| 1729 | Ga0163162_10009150 | |||
| 1730 | Ga0163162_10027940 | |||
| 1731 | Ga0163162_10028597 | |||
| 1732 | Ga0163162_10123185 | |||
| 1733 | Ga0163162_10248439 | |||
| 1734 | Ga0163162_10742114 | |||
| 1735 | Ga0157372_10000452 | |||
| 1736 | Ga0157372_10041887 | |||
| 1737 | Ga0157372_10084660 | |||
| 1738 | Ga0157372_10128249 | |||
| 1739 | Ga0157372_10237390 | |||
| 1740 | Ga0157372_10574153 | |||
| 1741 | Ga0157375_10003814 | |||
| 1742 | Ga0157375_10109975 | |||
| 1743 | Ga0157375_10135894 | |||
| 1744 | Ga0157375_10146288 | |||
| 1745 | Ga0157375_10178225 | |||
| 1746 | Ga0157375_10388929 | |||
| 1747 | Ga0157375_10393549 | |||
| 1748 | Ga0157375_11756800 | |||
| 1749 | Ga0157375_13614232 | |||
| 1750 | Ga0157375_13617286 | |||
| 1751 | Ga0163163_10002726 | |||
| 1752 | Ga0163163_10010014 | |||
| 1753 | Ga0163163_10021936 | |||
| 1754 | Ga0163163_10091073 | |||
| 1755 | Ga0163163_10145632 | |||
| 1756 | Ga0163163_10262731 | |||
| 1757 | Ga0163163_10284685 | |||
| 1758 | Ga0163163_10862961 | |||
| 1759 | Ga0157379_10000870 | |||
| 1760 | Ga0157379_10007089 | |||
| 1761 | Ga0157379_10010297 | |||
| 1762 | Ga0157379_10035103 | |||
| 1763 | Ga0157379_10097776 | |||
| 1764 | Ga0157379_11195782 | |||
| 1765 | Ga0157379_11488429 | |||
| 1766 | Ga0157379_11489368 | |||
| 1767 | Ga0157379_11500620 | |||
| 1768 | Ga0157376_10007457 | |||
| 1769 | Ga0157376_10023237 | |||
| 1770 | Ga0157376_10129997 | |||
| 1771 | Ga0157376_10134531 | |||
| 1772 | Ga0157376_10289764 | |||
| 1773 | Ga0157376_10306409 | |||
| 1774 | Ga0157376_10325377 | |||
| 1775 | Ga0157376_10328247 | |||
| 1776 | Ga0157376_10807144 | |||
| 1777 | Ga0157376_12777806 | |||
| 1778 | Ga0163161_10018428 | |||
| 1779 | Ga0163161_10048642 | |||
| 1780 | Ga0197907_10306173 | |||
| 1781 | Ga0197907_10725247 | |||
| 1782 | Ga0197907_11359844 | |||
| 1783 | Ga0206356_10849476 | |||
| 1784 | Ga0206352_10060660 | |||
| 1785 | Ga0206352_10885820 | |||
| 1786 | Ga0206350_10579448 | |||
| 1787 | Ga0206350_10773452 | |||
| 1788 | Ga0213874_10031857 | |||
| 1789 | Ga0213874_10260659 | |||
| 1790 | Ga0213875_10133123 | |||
| 1791 | Ga0224712_10342548 | |||
| 1792 | Ga0224712_10434296 | |||
| 1793 | Ga0228598_1021659 | |||
| 1794 | Ga0207697_10002755 | |||
| 1795 | Ga0207697_10163596 | |||
| 1796 | Ga0207656_10152100 | |||
| 1797 | Ga0207682_10331651 | |||
| 1798 | Ga0207682_10542265 | |||
| 1799 | Ga0207692_10091650 | |||
| 1800 | Ga0207692_10149311 | |||
| 1801 | Ga0207692_10237352 | |||
| 1802 | Ga0207692_10394183 | |||
| 1803 | Ga0207692_10597591 | |||
| 1804 | Ga0207642_10018281 | |||
| 1805 | Ga0207642_10324892 | |||
| 1806 | Ga0207642_10421837 | |||
| 1807 | Ga0207642_10967459 | |||
| 1808 | Ga0207710_10059797 | |||
| 1809 | Ga0207710_10435605 | |||
| 1810 | Ga0207688_10122211 | |||
| 1811 | Ga0207688_10671930 | |||
| 1812 | Ga0207680_10003597 | |||
| 1813 | Ga0207680_10007874 | |||
| 1814 | Ga0207680_10197413 | |||
| 1815 | Ga0207680_10344926 | |||
| 1816 | Ga0207680_10368708 | |||
| 1817 | Ga0207680_10442649 | |||
| 1818 | Ga0207685_10136818 | |||
| 1819 | Ga0207685_10185399 | |||
| 1820 | Ga0207685_10196792 | |||
| 1821 | Ga0207685_10268246 | |||
| 1822 | Ga0207685_10461387 | |||
| 1823 | Ga0207685_10618681 | |||
| 1824 | Ga0207699_10084655 | |||
| 1825 | Ga0207699_10230198 | |||
| 1826 | Ga0207699_10418525 | |||
| 1827 | Ga0207699_11006665 | |||
| 1828 | Ga0207645_10000361 | |||
| 1829 | Ga0207645_10009862 | |||
| 1830 | Ga0207645_10037559 | |||
| 1831 | Ga0207645_10123387 | |||
| 1832 | Ga0207645_10561833 | |||
| 1833 | Ga0207643_10004581 | |||
| 1834 | Ga0207643_10031919 | |||
| 1835 | Ga0207705_11151419 | |||
| 1836 | Ga0207684_10002910 | |||
| 1837 | Ga0207684_10011427 | |||
| 1838 | Ga0207684_10064928 | |||
| 1839 | Ga0207684_10150650 | |||
| 1840 | Ga0207684_10189322 | |||
| 1841 | Ga0207684_10283161 | |||
| 1842 | Ga0207684_10605070 | |||
| 1843 | Ga0207654_10024104 | |||
| 1844 | Ga0207654_10049001 | |||
| 1845 | Ga0207654_10049338 | |||
| 1846 | Ga0207654_10398838 | |||
| 1847 | Ga0207654_10590003 | |||
| 1848 | Ga0207707_10005894 | |||
| 1849 | Ga0207707_10014130 | |||
| 1850 | Ga0207707_10015546 | |||
| 1851 | Ga0207707_10026439 | |||
| 1852 | Ga0207707_10062066 | |||
| 1853 | Ga0207707_10609703 | |||
| 1854 | Ga0207707_10938164 | |||
| 1855 | Ga0207707_11019757 | |||
| 1856 | Ga0207695_10008008 | |||
| 1857 | Ga0207695_10012835 | |||
| 1858 | Ga0207671_10115434 | |||
| 1859 | Ga0207671_10293759 | |||
| 1860 | Ga0207671_10311364 | |||
| 1861 | Ga0207671_11483758 | |||
| 1862 | Ga0207693_10000777 | |||
| 1863 | Ga0207693_10001269 | |||
| 1864 | Ga0207693_10001447 | |||
| 1865 | Ga0207693_10002318 | |||
| 1866 | Ga0207693_10026151 | |||
| 1867 | Ga0207693_10026692 | |||
| 1868 | Ga0207693_10085877 | |||
| 1869 | Ga0207693_10290993 | |||
| 1870 | Ga0207693_10413956 | |||
| 1871 | Ga0207693_10694761 | |||
| 1872 | Ga0207693_10775710 | |||
| 1873 | Ga0207663_10005767 | |||
| 1874 | Ga0207663_10009058 | |||
| 1875 | Ga0207663_10138785 | |||
| 1876 | Ga0207663_10156217 | |||
| 1877 | Ga0207663_10180080 | |||
| 1878 | Ga0207663_10187161 | |||
| 1879 | Ga0207663_10252749 | |||
| 1880 | Ga0207663_10955122 | |||
| 1881 | Ga0207663_10957178 | |||
| 1882 | Ga0207663_11508331 | |||
| 1883 | Ga0207660_10000684 | |||
| 1884 | Ga0207660_10021722 | |||
| 1885 | Ga0207660_10093009 | |||
| 1886 | Ga0207660_10567650 | |||
| 1887 | Ga0207662_11350365 | |||
| 1888 | Ga0207657_10004028 | |||
| 1889 | Ga0207657_10004518 | |||
| 1890 | Ga0207657_10954031 | |||
| 1891 | Ga0207649_10022890 | |||
| 1892 | Ga0207649_10159370 | |||
| 1893 | Ga0207649_10179871 | |||
| 1894 | Ga0207649_10199749 | |||
| 1895 | Ga0207652_10010119 | |||
| 1896 | Ga0207652_10011865 | |||
| 1897 | Ga0207652_10027041 | |||
| 1898 | Ga0207652_10138316 | |||
| 1899 | Ga0207652_10152798 | |||
| 1900 | Ga0207652_10155121 | |||
| 1901 | Ga0207646_10001994 | |||
| 1902 | Ga0207646_10039010 | |||
| 1903 | Ga0207646_10079104 | |||
| 1904 | Ga0207646_10194131 | |||
| 1905 | Ga0207646_10257807 | |||
| 1906 | Ga0207681_10036637 | |||
| 1907 | Ga0207681_10590195 | |||
| 1908 | Ga0207694_10002760 | |||
| 1909 | Ga0207694_10171753 | |||
| 1910 | Ga0207694_10862800 | |||
| 1911 | Ga0207694_11366578 | |||
| 1912 | Ga0207650_10000804 | |||
| 1913 | Ga0207650_10022176 | |||
| 1914 | Ga0207650_10033162 | |||
| 1915 | Ga0207650_10039787 | |||
| 1916 | Ga0207650_10041679 | |||
| 1917 | Ga0207650_10548547 | |||
| 1918 | Ga0207659_10025373 | |||
| 1919 | Ga0207659_10246913 | |||
| 1920 | Ga0207687_10001741 | |||
| 1921 | Ga0207687_10020007 | |||
| 1922 | Ga0207687_10065354 | |||
| 1923 | Ga0207687_10176541 | |||
| 1924 | Ga0207687_10825956 | |||
| 1925 | Ga0207700_10000305 | |||
| 1926 | Ga0207700_10016643 | |||
| 1927 | Ga0207700_10040310 | |||
| 1928 | Ga0207700_10200019 | |||
| 1929 | Ga0207700_10739839 | |||
| 1930 | Ga0207700_11106663 | |||
| 1931 | Ga0207700_11374608 | |||
| 1932 | Ga0207664_10007467 | |||
| 1933 | Ga0207664_10036088 | |||
| 1934 | Ga0207664_10056135 | |||
| 1935 | Ga0207664_10288997 | |||
| 1936 | Ga0207664_11102765 | |||
| 1937 | Ga0207664_11238302 | |||
| 1938 | Ga0207644_10008450 | |||
| 1939 | Ga0207644_10013287 | |||
| 1940 | Ga0207644_10046896 | |||
| 1941 | Ga0207644_10160598 | |||
| 1942 | Ga0207644_11180456 | |||
| 1943 | Ga0207644_11405388 | |||
| 1944 | Ga0207690_10842168 | |||
| 1945 | Ga0207706_10000098 | |||
| 1946 | Ga0207706_10006684 | |||
| 1947 | Ga0207706_10076387 | |||
| 1948 | Ga0207686_10000779 | |||
| 1949 | Ga0207686_10007968 | |||
| 1950 | Ga0207686_10069448 | |||
| 1951 | Ga0207709_10025139 | |||
| 1952 | Ga0207709_10913804 | |||
| 1953 | Ga0207670_10051596 | |||
| 1954 | Ga0207670_10087503 | |||
| 1955 | Ga0207670_10178283 | |||
| 1956 | Ga0207670_10282414 | |||
| 1957 | Ga0207670_10792886 | |||
| 1958 | Ga0207670_11398527 | |||
| 1959 | Ga0207669_10005385 | |||
| 1960 | Ga0207669_10272117 | |||
| 1961 | Ga0207669_10655313 | |||
| 1962 | Ga0207669_10715492 | |||
| 1963 | Ga0207669_11746803 | |||
| 1964 | Ga0207704_10253701 | |||
| 1965 | Ga0207704_10284766 | |||
| 1966 | Ga0207704_10469155 | |||
| 1967 | Ga0207704_10647099 | |||
| 1968 | Ga0207665_10001318 | |||
| 1969 | Ga0207665_10004596 | |||
| 1970 | Ga0207665_10006712 | |||
| 1971 | Ga0207665_10009496 | |||
| 1972 | Ga0207665_10054324 | |||
| 1973 | Ga0207665_10061227 | |||
| 1974 | Ga0207665_10118639 | |||
| 1975 | Ga0207665_10217046 | |||
| 1976 | Ga0207691_10000022 | |||
| 1977 | Ga0207691_10036841 | |||
| 1978 | Ga0207691_10049775 | |||
| 1979 | Ga0207691_10449848 | |||
| 1980 | Ga0207691_10506159 | |||
| 1981 | Ga0207691_10580425 | |||
| 1982 | Ga0207711_10000157 | |||
| 1983 | Ga0207711_10002559 | |||
| 1984 | Ga0207711_10005058 | |||
| 1985 | Ga0207711_10013127 | |||
| 1986 | Ga0207711_10014426 | |||
| 1987 | Ga0207711_10179964 | |||
| 1988 | Ga0207711_10483357 | |||
| 1989 | Ga0207711_10606457 | |||
| 1990 | Ga0207711_10848697 | |||
| 1991 | Ga0207689_10000606 | |||
| 1992 | Ga0207689_10001125 | |||
| 1993 | Ga0207689_10022295 | |||
| 1994 | Ga0207689_10212837 | |||
| 1995 | Ga0207661_10035590 | |||
| 1996 | Ga0207661_10232730 | |||
| 1997 | Ga0207661_11899163 | |||
| 1998 | Ga0207679_10004168 | |||
| 1999 | Ga0207679_10179960 | |||
| 2000 | Ga0207679_10408013 | |||
| 2001 | Ga0207679_11488113 | |||
| 2002 | Ga0207667_10002055 | |||
| 2003 | Ga0207667_10004035 | |||
| 2004 | Ga0207667_10437199 | |||
| 2005 | Ga0207667_10553580 | |||
| 2006 | Ga0207667_10723689 | |||
| 2007 | Ga0207651_10015130 | |||
| 2008 | Ga0207651_10281645 | |||
| 2009 | Ga0207651_10491592 | |||
| 2010 | Ga0207651_10654099 | |||
| 2011 | Ga0207712_10008062 | |||
| 2012 | Ga0207712_10167273 | |||
| 2013 | Ga0207712_11964537 | |||
| 2014 | Ga0207668_10005383 | |||
| 2015 | Ga0207668_10011070 | |||
| 2016 | Ga0207668_10143374 | |||
| 2017 | Ga0207668_10186745 | |||
| 2018 | Ga0207668_10441127 | |||
| 2019 | Ga0207668_10648344 | |||
| 2020 | Ga0207668_12097904 | |||
| 2021 | Ga0207640_10005522 | |||
| 2022 | Ga0207640_10314508 | |||
| 2023 | Ga0207640_11187977 | |||
| 2024 | Ga0207658_10015565 | |||
| 2025 | Ga0207658_10027983 | |||
| 2026 | Ga0207658_10059347 | |||
| 2027 | Ga0207658_10216053 | |||
| 2028 | Ga0207658_10314596 | |||
| 2029 | Ga0207658_10820504 | |||
| 2030 | Ga0207658_11193035 | |||
| 2031 | Ga0207658_11385148 | |||
| 2032 | Ga0207677_10001996 | |||
| 2033 | Ga0207677_10016803 | |||
| 2034 | Ga0207677_10025664 | |||
| 2035 | Ga0207677_10037216 | |||
| 2036 | Ga0207677_10140277 | |||
| 2037 | Ga0207677_10310112 | |||
| 2038 | Ga0207703_10000973 | |||
| 2039 | Ga0207703_10002691 | |||
| 2040 | Ga0207703_10025507 | |||
| 2041 | Ga0207703_10236126 | |||
| 2042 | Ga0207703_10294780 | |||
| 2043 | Ga0207703_10577010 | |||
| 2044 | Ga0207703_11860179 | |||
| 2045 | Ga0207703_11864203 | |||
| 2046 | Ga0207703_11900630 | |||
| 2047 | Ga0207639_10012754 | |||
| 2048 | Ga0207639_10023656 | |||
| 2049 | Ga0207639_10038405 | |||
| 2050 | Ga0207639_10166810 | |||
| 2051 | Ga0207678_10006292 | |||
| 2052 | Ga0207678_10093626 | |||
| 2053 | Ga0207702_10000303 | |||
| 2054 | Ga0207702_10004933 | |||
| 2055 | Ga0207702_10091249 | |||
| 2056 | Ga0207702_10175137 | |||
| 2057 | Ga0207702_10293342 | |||
| 2058 | Ga0207702_11052417 | |||
| 2059 | Ga0207641_10003774 | |||
| 2060 | Ga0207641_10034183 | |||
| 2061 | Ga0207641_10036148 | |||
| 2062 | Ga0207641_10122192 | |||
| 2063 | Ga0207641_10170612 | |||
| 2064 | Ga0207648_10001376 | |||
| 2065 | Ga0207648_10005112 | |||
| 2066 | Ga0207648_10009722 | |||
| 2067 | Ga0207648_10033523 | |||
| 2068 | Ga0207648_10359361 | |||
| 2069 | Ga0207676_10003601 | |||
| 2070 | Ga0207676_10478284 | |||
| 2071 | Ga0207676_10642191 | |||
| 2072 | Ga0207676_10967621 | |||
| 2073 | Ga0207676_11772558 | |||
| 2074 | Ga0207674_10041047 | |||
| 2075 | Ga0207674_10093774 | |||
| 2076 | Ga0207674_10133797 | |||
| 2077 | Ga0207674_10222361 | |||
| 2078 | Ga0207674_10225636 | |||
| 2079 | Ga0207675_100019029 | |||
| 2080 | Ga0207675_100108328 | |||
| 2081 | Ga0207675_100191181 | |||
| 2082 | Ga0207675_100644344 | |||
| 2083 | Ga0207675_100833498 | |||
| 2084 | Ga0207675_100968778 | |||
| 2085 | Ga0207683_10001682 | |||
| 2086 | Ga0207683_10004894 | |||
| 2087 | Ga0207683_10143140 | |||
| 2088 | Ga0207683_10224140 | |||
| 2089 | Ga0207698_10029668 | |||
| 2090 | Ga0207698_10191038 | |||
| 2091 | Ga0209179_1004386 | |||
| 2092 | Ga0209588_1022160 | |||
| 2093 | Ga0209588_1059330 | |||
| 2094 | Ga0209588_1061438 | |||
| 2095 | Ga0209588_1167449 | |||
| 2096 | Ga0265354_1033384 | |||
| 2097 | Ga0268266_10012772 | |||
| 2098 | Ga0268266_10026636 | |||
| 2099 | Ga0268266_10028758 | |||
| 2100 | Ga0268266_10464934 | |||
| 2101 | Ga0268266_10486134 | |||
| 2102 | Ga0268265_10013762 | |||
| 2103 | Ga0268265_10013953 | |||
| 2104 | Ga0268265_10109419 | |||
| 2105 | Ga0268264_10001476 | |||
| 2106 | Ga0268264_10006479 | |||
| 2107 | Ga0268264_10017542 | |||
| 2108 | Ga0268264_10119610 | |||
| 2109 | Ga0268264_10362488 | |||
| 2110 | Ga0268264_10491748 | |||
| 2111 | Ga0268264_10842160 | |||
| 2112 | Ga0268264_11019754 | |||
| 2113 | Ga0268264_11398888 | |||
| 2114 | Ga0268264_11441675 | |||
| 2115 | Ga0268264_12020250 | |||
| 2116 | Ga0265338_10002470 | |||
| 2117 | Ga0265338_10018073 | |||
| 2118 | Ga0265338_10274351 | |||
| 2119 | Ga0265762_1024219 | |||
| 2120 | Ga0265763_1046302 | |||
| 2121 | Ga0265770_1003452 | |||
| 2122 | Ga0265770_1121050 | |||
| 2123 | Ga0265760_10004593 | |||
| 2124 | Ga0265330_10361925 | |||
| 2125 | Ga0265328_10049567 | |||
| 2126 | Ga0265325_10199324 | |||
| 2127 | Ga0265329_10145859 | |||
| 2128 | Ga0265339_10039467 | |||
| 2129 | Ga0265339_10491206 | |||
| 2130 | Ga0265327_10002192 | |||
| 2131 | Ga0265316_10067485 | |||
| 2132 | Ga0265314_10207696 | |||
| 2133 | Ga0265342_10435418 | |||
| 2134 | Ga0316214_1011009 | |||
| 2135 | Ga0373930_0001400 | |||
| 2136 | Ga0373938_0066139 | |||
| 2137 | Ga0373926_0090662 | |||
| 2138 | Ga0373926_0233855 | |||
| 2139 | Ga0373928_0031889 | |||
| 2140 | Ga0373928_0071539 | |||
| 2141 | Ga0373934_0045775 | |||
| 2142 | Ga0373934_0102977 | |||
| 2143 | Ga0373944_0005961 | |||
| 2144 | Ga0373944_0042335 | |||
| 2145 | Ga0373949_0174866 | |||
| 2146 | Ga0373949_0265954 | |||
| 2147 | Ga0373923_0008097 | |||
| 2148 | Ga0373923_0011162 | |||
| 2149 | Ga0373923_0124386 | |||
| 2150 | Ga0373923_0276439 | |||
| 2151 | Ga0373932_0035269 | |||
| 2152 | Ga0373932_0195666 | |||
| 2153 | Ga0373936_0002796 | |||
| 2154 | Ga0373936_0021212 | |||
| 2155 | Ga0373936_0044835 | |||
| 2156 | Ga0373939_0035171 | |||
| 2157 | Ga0373941_0045222 | |||
| 2158 | Ga0373945_0000643 | |||
| 2159 | Ga0373945_0163324 | |||
| 2160 | Ga0373945_0168861 | |||
| 2161 | Ga0373953_0048994 | |||
| 2162 | Ga0373953_0114642 | |||
| 2163 | Ga0373953_0127178 | |||
| 2164 | Ga0373953_0519849 | |||
| 2165 | Ga0373954_0001904 | |||
| 2166 | Ga0373954_0040058 | |||
| 2167 | Ga0373956_0051417 | |||
| 2168 | Ga0373956_0115786 | |||
| 2169 | Ga0373956_0177977 | |||
| 2170 | Ga0373956_0371934 | |||
| 2171 | Ga0373956_0412764 | |||
| 2172 | Ga0373957_0028852 | |||
| 2173 | Ga0373957_0100133 | |||
| 2174 | Ga0373943_0000160 | |||
| 2175 | Ga0373943_0003378 | |||
| 2176 | Ga0373943_0025011 | |||
| 2177 | Ga0373943_0038941 | |||
| 2178 | Ga0373943_0039864 | |||
| 2179 | Ga0373943_0286542 | |||
| 2180 | Ga0373946_0000797 | |||
| 2181 | Ga0373946_0082813 | |||
| 2182 | Ga0373946_0523929 | |||
| 2183 | Ga0373946_0589613 | |||
| 2184 | Ga0373955_0020382 | |||
| 2185 | Ga0373955_0115660 | |||
| 2186 | Ga0373955_0748662 | |||
| 2187 | Ga0373942_0255558 | |||
| 2188 | Ga0373924_0026937 | |||
| 2189 | Ga0373924_0127322 | |||
| 2190 | Ga0373924_0154874 | |||
| 2191 | Ga0373931_0070233 | |||
| 2192 | Ga0373931_0151155 | |||
| 2193 | Ga0373931_1250075 | |||
| 2194 | Ga0373935_0000498 | |||
| 2195 | Ga0373935_0002910 | |||
| 2196 | Ga0373935_0060963 | |||
| 2197 | Ga0373935_0574453 | |||
| 2198 | Ga0373935_0652200 | |||
| 2199 | Ga0373935_0992385 | |||
| 2200 | Ga0373927_0000604 | |||
| 2201 | Ga0373927_0003383 | |||
| 2202 | Ga0373927_0025939 | |||
| 2203 | Ga0373927_0170861 | |||
| 2204 | Ga0373933_0029117 | |||
| 2205 | Ga0373933_0112617 | |||
| 2206 | Ga0373933_0262488 | |||
| 2207 | Ga0373933_0333282 | |||
| 2208 | Ga0373947_0000784 | |||
| 2209 | Ga0373947_0018126 | |||
| 2210 | Ga0373947_0032610 | |||
| 2211 | Ga0373947_0867116 | |||
| 2212 | Ga0373937_0009697 | |||
| 2213 | Ga0373937_0089131 | |||
| 2214 | Ga0373937_0091876 | |||
| 2215 | Ga0373937_0105573 | |||
| 2216 | Ga0373937_0159692 | |||
| 2217 | Ga0373937_0209308 | |||
| 2218 | Ga0373937_0320563 | |||
| 2219 | Ga0373937_0332676 | |||
| 2220 | Ga0373937_0333039 | |||
| 2221 | Ga0373937_0488566 | |||
| 2222 | Ga0373937_0659626 | |||
| 2223 | Ga0373937_0699793 | |||
| 2224 | Ga0373937_1195123 | |||
| 2225 | Ga0373925_0001108 | |||
| 2226 | Ga0373925_0011747 | |||
| 2227 | Ga0373925_0012472 | |||
| 2228 | Ga0373925_0146968 | |||
| 2229 | Ga0373925_0182303 | |||
| 2230 | Ga0373925_0208898 | |||
| 2231 | Ga0373925_0240869 | |||
| 2232 | Ga0373925_0833930 | |||
| 2233 | Ga0373925_1057410 | |||
| 2234 | Ga0395898_0059841 | |||
| 2235 | Ga0436364_0313330 | |||
| 2236 | Ga0395901_1766414 | |||
| 2237 | Ga0436360_0624810 | |||
| 2238 | Ga0436363_0264165 | |||
| 2239 | Ga0436363_1259540 | |||
| 2240 | Ga0436362_0916830 | |||
| 2241 | Ga0451798_0030423 | |||
| 2242 | Ga0451849_0944457 | |||
| 2243 | Ga0439448_0090858 | |||
| 2244 | Ga0439462_0070860 | |||
| 2245 | Ga0466963_0001680 | |||
| 2246 | Ga0453684_1323260 | |||
| 2247 | Ga0453684_1555099 | |||
| 2248 | Ga0451576_0499488 | |||
| 2249 | Ga0466967_0157735 | |||
| 2250 | Ga0495592_0025116 | |||
| 2251 | Ga0495629_0035780 | |||
| 2252 | Ga0495629_0095064 | |||
| 2253 | Ga0495629_0180405 | |||
| 2254 | Ga0495629_0834606 | |||
| 2255 | Ga0495653_0037336 | |||
| 2256 | Ga0495653_0105308 | |||
| 2257 | Ga0495580_0009055 | |||
| 2258 | Ga0495580_0037331 | |||
| 2259 | Ga0495580_0060543 | |||
| 2260 | Ga0495580_0143295 | |||
| 2261 | Ga0495580_0419296 | |||
| 2262 | Ga0495580_0755907 | |||
| 2263 | Ga0495580_0990251 | |||
| 2264 | Ga0495582_0005851 | |||
| 2265 | Ga0495582_0034032 | |||
| 2266 | Ga0495639_0107733 | |||
| 2267 | Ga0495639_0126144 | |||
| 2268 | Ga0495639_0131946 | |||
| 2269 | Ga0495639_0499612 | |||
| 2270 | Ga0495662_0150897 | |||
| 2271 | Ga0495662_0216905 | |||
| 2272 | Ga0495662_0321385 | |||
| 2273 | Ga0495664_0076384 | |||
| 2274 | Ga0495594_0234163 | |||
| 2275 | Ga0495594_0720931 | |||
| 2276 | Ga0495608_0009336 | |||
| 2277 | Ga0495608_0043816 | |||
| 2278 | Ga0495608_0159912 | |||
| 2279 | Ga0495608_0559203 | |||
| 2280 | Ga0495618_0005057 | |||
| 2281 | Ga0495618_0422841 | |||
| 2282 | Ga0495628_0148087 | |||
| 2283 | Ga0495628_0422631 | |||
| 2284 | Ga0495630_0135164 | |||
| 2285 | Ga0495630_0141086 | |||
| 2286 | Ga0495666_0193348 | |||
| 2287 | Ga0495652_0762351 | |||
| 2288 | Ga0495665_0008424 | |||
| 2289 | Ga0495665_0095224 | |||
| 2290 | Ga0495665_0380092 | |||
| 2291 | Ga0495640_0128232 | |||
| 2292 | Ga0495640_0784898 | |||
| 2293 | Ga0495640_0938128 | |||
| 2294 | Ga0495586_0428393 | |||
| 2295 | Ga0495586_0714884 | |||
| 2296 | Ga0495587_0103415 | |||
| 2297 | Ga0495587_0330809 | |||
| 2298 | Ga0495587_0663198 | |||
| 2299 | Ga0495621_0312016 | |||
| 2300 | Ga0495645_0010880 | |||
| 2301 | Ga0495645_0073501 | |||
| 2302 | Ga0495645_0160115 | |||
| 2303 | Ga0495645_0207159 | |||
| 2304 | Ga0495667_0000277 | |||
| 2305 | Ga0495667_0041756 | |||
| 2306 | Ga0495667_0079814 | |||
| 2307 | Ga0495667_0481210 | |||
| 2308 | Ga0495635_0033843 | |||
| 2309 | Ga0495635_0140736 | |||
| 2310 | Ga0495635_0321246 | |||
| 2311 | Ga0495635_0465881 | |||
| 2312 | Ga0495657_0000936 | |||
| 2313 | Ga0495657_0868776 | |||
| 2314 | Ga0495599_0136614 | |||
| 2315 | Ga0495599_0462790 | |||
| 2316 | Ga0495623_0193200 | |||
| 2317 | Ga0495623_0208504 | |||
| 2318 | Ga0495646_0540401 | |||
| 2319 | Ga0495647_0440000 | |||
| 2320 | Ga0495658_0088134 | |||
| 2321 | Ga0495658_0102203 | |||
| 2322 | Ga0495658_0127276 | |||
| 2323 | Ga0495613_0018921 | |||
| 2324 | Ga0495613_0113107 | |||
| 2325 | Ga0495624_0060288 | |||
| 2326 | Ga0495600_0008862 | |||
| 2327 | Ga0495600_0064066 | |||
| 2328 | Ga0495600_0241178 | |||
| 2329 | Ga0495581_0037666 | |||
| 2330 | Ga0495581_0183131 | |||
| 2331 | Ga0495581_0293544 | |||
| 2332 | Ga0495604_0028112 | |||
| 2333 | Ga0495604_0177439 | |||
| 2334 | Ga0495604_0976042 | |||
| 2335 | Ga0495636_0060324 | |||
| 2336 | Ga0495674_0006894 | |||
| 2337 | Ga0495674_0008196 | |||
| 2338 | Ga0495674_0014550 | |||
| 2339 | Ga0495674_0048386 | |||
| 2340 | Ga0495674_0151828 | |||
| 2341 | Ga0495674_0835440 | |||
| 2342 | Ga0495674_1113107 | |||
| 2343 | Ga0495680_0017498 | |||
| 2344 | Ga0495680_0027911 | |||
| 2345 | Ga0495680_0551130 | |||
| 2346 | Ga0495675_0011783 | |||
| 2347 | Ga0495675_0450737 | |||
| 2348 | Ga0495684_0004509 | |||
| 2349 | Ga0495684_0006624 | |||
| 2350 | Ga0495684_0019347 | |||
| 2351 | Ga0495684_0143359 | |||
| 2352 | Ga0495684_0656066 | |||
| 2353 | Ga0495593_0186576 | |||
| 2354 | Ga0495593_0559818 | |||
| 2355 | Ga0495602_0108261 | |||
| 2356 | Ga0495602_0178625 | |||
| 2357 | Ga0495602_0227694 | |||
| 2358 | Ga0495602_0636448 | |||
| 2359 | Ga0496100_0038711 | |||
| 2360 | Ga0496100_0568110 | |||
| 2361 | Ga0496101_0100746 | |||
| 2362 | Ga0496101_0780094 | |||
| 2363 | Ga0496102_0001997 | |||
| 2364 | Ga0496102_0066898 | |||
| 2365 | Ga0496102_0209037 | |||
| 2366 | Ga0496102_0345836 | |||
| 2367 | Ga0496102_0565097 | |||
| 2368 | Ga0496103_0001993 | |||
| 2369 | Ga0496103_0103565 | |||
| 2370 | Ga0496103_0270413 | |||
| 2371 | Ga0496104_0045606 | |||
| 2372 | Ga0496104_0049267 | |||
| 2373 | Ga0496104_0116180 | |||
| 2374 | Ga0496104_0137482 | |||
| 2375 | Ga0496104_0281469 | |||
| 2376 | Ga0496105_0243784 | |||
| 2377 | Ga0496105_0576448 | |||
| 2378 | Ga0496105_1099812 | |||
| 2379 | Ga0496105_1271957 | |||
| 2380 | Ga0496106_0098595 | |||
| 2381 | Ga0496106_0250873 | |||
| 2382 | Ga0496106_0268460 | |||
| 2383 | Ga0496106_0754506 | |||
| 2384 | Ga0496106_1314096 | |||
| 2385 | Ga0496107_0049959 | |||
| 2386 | Ga0496107_0145677 | |||
| 2387 | Ga0496107_0154798 | |||
| 2388 | Ga0496108_0080060 | |||
| 2389 | Ga0496108_0118247 | |||
| 2390 | Ga0496108_1705733 | |||
| 2391 | Ga0496109_0188194 | |||
| 2392 | Ga0496109_0226694 | |||
| 2393 | Ga0496109_0300397 | |||
| 2394 | Ga0496109_0528493 | |||
| 2395 | Ga0496110_0249651 | |||
| 2396 | Ga0496110_1517823 | |||
| 2397 | Ga0496112_0046227 | |||
| 2398 | Ga0496112_0836133 | |||
| 2399 | Ga0496113_0105962 | |||
| 2400 | Ga0496114_0079332 | |||
| 2401 | Ga0496114_0661921 | |||
| 2402 | Ga0496115_0017708 | |||
| 2403 | Ga0496115_0142954 | |||
| 2404 | Ga0496115_0185961 | |||
| 2405 | Ga0496115_0555761 | |||
| 2406 | Ga0501034_0257266 | |||
| 2407 | Ga0501047_0055036 | |||
| 2408 | Ga0501069_0090666 | |||
| 2409 | Ga0501069_0218998 | |||
| 2410 | Ga0501069_0991254 | |||
| 2411 | Ga0501070_0034390 | |||
| 2412 | Ga0501072_0133112 | |||
| 2413 | Ga0501073_0080602 | |||
| 2414 | Ga0501074_0098170 | |||
| 2415 | Ga0501079_0419524 | |||
| 2416 | Ga0501080_0014100 | |||
| 2417 | Ga0501083_0065455 | |||
| 2418 | nmdc:mga05p37_832854_c1 | |||
| 2419 | nmdc:mga08y16_212963_c1 | |||
| 2420 | nmdc:mga0n895_1232725_c1 | |||
| 2421 | nmdc:mga0n895_255159_c1 | |||
| 2422 | nmdc:mga0n895_26581_c1 | |||
| 2423 | nmdc:mga0n895_654741_c1 | |||
| 2424 | nmdc:mga0n895_67222_c1 | |||
| 2425 | nmdc:mga0rr50_279874_c1 | |||
| 2426 | nmdc:mga0a205_1325787_c1 | |||
| 2427 | Ga0495601_0042809 | |||
| 2428 | Ga0495612_0439229 | |||
| 2429 | Ga0495595_0151911 | |||
| 2430 | Ga0495619_0021380 | |||
| 2431 | Ga0501084_0238509 | |||
| 2432 | Ga0501084_0578344 | |||
| 2433 | Ga0587073_0044818 | |||
| 2434 | Ga0587082_018394 | |||
| 2435 | Ga0587115_028856 | |||
| 2436 | Ga0587067_178578 | |||
| 2437 | Ga0587076_036248 | |||
| 2438 | Ga0587078_022313 | |||
| 2439 | Ga0587079_031963 | |||
| 2440 | Ga0501082_0828560 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.7853 | 1 | 116 |
| 4ty8-assembly4.cif.gz_D | an ligand-observed mass spectrometry-based approach integrated into the fragment based lead discovery pipeline | 0.7468 | 74 | 112 |
| 3jb6-assembly1.cif.gz_A | in situ structures of the segmented genome and rna polymerase complex inside a dsrna virus | 0.7253 | 73 | 113 |
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.7233 | 1 | 116 |
| 3hkw-assembly2.cif.gz_B | hcv ns5b genotype 1a in complex with 1,5 benzodiazepine inhibitor 6 | 0.7148 | 74 | 117 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7853 | 1 | 116 | 3.30.70.1060 |
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7233 | 1 | 116 | 3.30.70.1060 |
| 5jk8B00 | Mainly Alpha;Orthogonal Bundle;Phenylalanine Hydroxylase;Aromatic amino acid hydroxylase | 0.6598 | 2 | 115 | 1.10.800.10 |
| af_P0AB55_1_98_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6542 | 1 | 117 | 3.30.70.1060 |
| af_P0AB55_1_98_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6429 | 1 | 117 | 3.30.70.1060 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7GR02-F1-model_v4 | YCII-related domain-containing protein | 0.9464 | 1 | 116 |
|
| AF-A0A4R2HAE2-F1-model_v4 | YCII-related domain-containing protein | 0.9456 | 1 | 117 |
|
| AF-A0A2V7MY79-F1-model_v4 | YCII-related domain-containing protein | 0.9398 | 1 | 117 |
|
| AF-A0A2V7JB82-F1-model_v4 | YCII-related domain-containing protein | 0.9392 | 11 | 117 |
|
| AF-A0A7T9B4C9-F1-model_v4 | deleted | 0.9368 | 1 | 116 |
|