F491724

General Info

Members Datasets Scaffolds Average Seq Length
1210 836 651 195

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2599185156|2599335741
Length 204
Sequence LVLASASPFRRMLLQNAGIAFTWQVAEIDERALEAPLAAEGASPERVATVLAQAKAEAVAAALREAQGEAGGTGPVVIGSDQTMSLGDRVFHKPASMEEAHEHLRALSGRTHRLNSAIALHQDSRTLWSHVSTARLKMRSLGDAFIARHLERVGEKALTSVGAYQLEGEGIQLFEAIEGDYFTILGLPLLPLLSELRRLSVIDA

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2509276019 Ensifer aridi TW10 Isolate Nodule
4 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
5 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
6 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
7 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
11 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
12 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
13 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
14 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
15 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
16 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
17 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
18 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
19 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
20 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
21 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
22 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
23 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
24 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
25 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
26 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
27 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
28 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
29 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
30 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
31 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
32 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
33 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
34 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
35 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
36 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
37 2516143018 Ensifer sp. BR816 Isolate Nodule
38 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
39 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
40 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
41 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
42 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
43 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
44 2519899620 Rhizobium sp. Pop5 Isolate Nodule
45 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
46 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
47 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
48 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
49 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
50 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
51 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
52 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
53 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
54 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
55 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
56 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
57 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
58 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
59 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
60 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
61 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
62 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
63 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
64 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
65 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
66 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
67 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
68 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
69 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
70 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
71 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
72 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
73 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
74 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
75 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
76 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
77 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
78 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
79 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
80 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
81 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
82 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
83 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
84 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
85 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
86 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
87 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
88 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
89 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
90 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
91 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
92 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
93 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
94 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
95 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
96 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
97 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
98 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
99 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
100 2643221557 Ensifer sp. Root558 Isolate Unclassified
101 2643221558 Rhizobium sp. Root149 Isolate Unclassified
102 2643221568 Rhizobium sp. Root564 Isolate Unclassified
103 2643221582 Rhizobium sp. Root651 Isolate Unclassified
104 2643221599 Rhizobium sp. Root708 Isolate Unclassified
105 2643221607 Rhizobium sp. Root73 Isolate Unclassified
106 2643221610 Ensifer sp. Root74 Isolate Unclassified
107 2643221618 Ensifer sp. Root231 Isolate Unclassified
108 2643221626 Ensifer sp. Root31 Isolate Unclassified
109 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
110 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
111 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
112 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
113 2643221655 Ensifer sp. Root1252 Isolate Unclassified
114 2643221659 Ensifer sp. Root127 Isolate Unclassified
115 2643221668 Ensifer sp. Root423 Isolate Unclassified
116 2643221675 Ensifer sp. Root1298 Isolate Unclassified
117 2643221680 Ensifer sp. Root1312 Isolate Unclassified
118 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
119 2643221688 Rhizobium sp. Root482 Isolate Unclassified
120 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
121 2643221693 Rhizobium sp. Root491 Isolate Unclassified
122 2643221698 Ensifer sp. Root142 Isolate Unclassified
123 2643221712 Ensifer sp. Root258 Isolate Unclassified
124 2643221718 Rhizobium sp. Root268 Isolate Unclassified
125 2643221723 Ensifer sp. Root278 Isolate Unclassified
126 2643221726 Ensifer sp. Root954 Isolate Unclassified
127 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
128 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
129 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
130 2718217882 Rhizobium sp. N741 Isolate Nodule
131 2718217927 Rhizobium sp. N324 Isolate Nodule
132 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
133 2718218009 Rhizobium sp. N561 Isolate Nodule
134 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
135 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
136 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
137 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
138 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
139 2718218363 Rhizobium sp. N113 Isolate Nodule
140 2718218365 Rhizobium sp. N731 Isolate Nodule
141 2718218366 Rhizobium sp. N621 Isolate Nodule
142 2718218423 Rhizobium sp. N941 Isolate Nodule
143 2721755514 Rhizobium sp. N6212 Isolate Nodule
144 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
145 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
146 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
147 2721755809 Rhizobium sp. N541 Isolate Nodule
148 2721755810 Rhizobium sp. N871 Isolate Nodule
149 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
150 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
151 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
152 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
153 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
154 2728369365 Rhizobium sp. N1341 Isolate Nodule
155 2728369397 Rhizobium sp. N1314 Isolate Nodule
156 2738541293 Rhizobium sp. GV031 Isolate Unclassified
157 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
158 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
159 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
160 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
161 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
162 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
163 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
164 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
165 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
166 2791355256 Rhizobium sp. M10 Isolate Nodule
167 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
168 2791355260 Rhizobium sp. L9 Isolate Nodule
169 2791355261 Rhizobium sp. J15 Isolate Nodule
170 2791355262 Rhizobium sp. M1 Isolate Nodule
171 2791355263 Rhizobium chutanense C5 Isolate Nodule
172 2791355264 Rhizobium sp. S9 Isolate Nodule
173 2791355265 Rhizobium sp. H4 Isolate Nodule
174 2791355266 Rhizobium sp. L43 Isolate Nodule
175 2791355267 Rhizobium sp. L18 Isolate Nodule
176 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
177 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
178 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
179 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
180 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
181 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
182 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
183 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
184 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
185 2802429633 Rhizobium anhuiense J3 Isolate Nodule
186 2802429634 Rhizobium anhuiense S10 Isolate Nodule
187 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
188 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
189 2802429637 Rhizobium anhuiense C15 Isolate Nodule
190 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
191 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
192 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
193 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
194 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
195 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
196 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
197 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
198 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
199 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
200 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
201 2838048938 Rhizobium pisi 27/80 Isolate Nodule
202 2838061910 Rhizobium phaseoli L15 Isolate Nodule
203 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
204 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
205 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
206 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
207 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
208 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
209 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
210 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
211 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
212 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
213 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
214 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
215 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
216 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
217 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
218 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
219 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
220 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
221 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
222 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
223 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
224 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
225 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
226 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
227 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
228 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
229 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
230 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
231 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
232 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
233 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
234 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
235 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
236 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
237 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
238 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
239 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
240 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
241 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
242 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
243 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
244 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
245 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
246 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
247 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
248 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
249 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
250 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
251 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
252 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
253 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
254 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
255 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
256 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
257 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
258 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
259 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
260 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
261 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
262 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
263 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
264 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
265 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
266 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
267 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
268 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
269 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
270 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
271 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
272 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
273 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
274 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
275 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
276 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
277 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
278 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
279 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
280 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
281 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
282 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
283 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
284 2844163670 Ensifer sp. 1H6 Isolate Unclassified
285 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
286 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
287 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
288 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
289 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
290 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
291 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
292 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
293 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
294 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
295 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
296 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
297 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
298 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
299 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
300 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
301 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
302 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
303 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
304 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
305 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
306 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
307 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
308 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
309 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
310 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
311 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
312 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
313 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
314 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
315 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
316 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
317 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
318 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
319 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
320 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
321 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
322 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
323 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
324 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
325 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
326 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
327 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
328 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
329 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
330 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
331 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
332 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
333 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
334 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
335 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
336 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
337 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
338 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
339 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
340 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
341 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
342 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
343 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
344 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
345 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
346 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
347 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
348 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
349 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
350 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
351 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
352 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
353 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
354 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
355 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
356 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
357 2933599457 Rhizobium phaseoli M3 Isolate Nodule
358 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
359 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
360 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
361 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
362 2936381700 Rhizobium chutanense C16 Isolate Unclassified
363 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
364 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
365 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
366 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
367 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
368 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
369 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
370 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
371 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
372 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
373 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
374 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
375 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
376 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
377 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
378 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
379 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
380 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
381 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
382 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
383 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
384 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
385 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
386 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
387 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
388 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
389 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
390 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
391 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
392 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
393 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
394 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
395 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
396 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
397 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
398 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
399 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
400 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
401 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
402 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
403 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
404 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
405 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
406 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
407 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
408 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
409 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
410 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
411 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
412 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
413 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
414 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
415 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
416 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
417 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
418 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
419 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
420 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
421 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
422 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
423 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
424 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
425 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
426 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
427 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
428 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
429 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
430 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
431 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
432 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
433 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
434 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
435 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
436 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
437 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
438 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
439 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
440 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
441 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
442 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
443 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
444 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
445 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
446 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
447 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
448 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
449 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
450 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
451 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
452 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
453 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
454 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
455 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
456 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
457 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
458 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
459 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
460 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
461 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
462 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
463 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
464 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
465 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
466 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
467 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
468 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
469 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
470 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
471 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
472 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
473 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
474 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
475 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
476 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
477 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
478 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
479 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
480 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
481 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
482 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
483 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
484 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
485 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
486 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
487 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
488 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
489 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
490 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
491 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
492 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
493 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
494 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
495 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
496 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
497 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
498 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
499 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
500 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
501 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
502 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
503 2996887358 Rhizobium sp. R711 Isolate Nodule
504 2996893221 Rhizobium sp. R635 Isolate Nodule
505 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
506 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
507 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
508 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
509 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
510 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
511 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
512 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
513 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
514 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
515 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
516 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
517 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
518 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
519 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
520 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
521 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
522 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
523 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
524 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
525 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
526 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
527 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
528 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
529 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
530 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
531 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
532 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
533 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
534 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
535 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
536 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
537 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
538 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
539 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
540 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
541 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
542 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
543 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
544 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
545 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
546 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
547 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
548 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
549 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
550 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
551 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
552 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
553 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
554 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
555 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
556 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
557 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
558 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
559 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
560 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
561 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
562 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
563 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
564 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
565 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
566 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
567 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
568 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
569 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
570 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
571 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
572 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
573 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
574 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
575 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
576 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
577 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
578 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
579 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
580 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
581 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
582 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
583 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
584 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
585 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
586 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
587 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
588 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
589 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
590 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
591 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
592 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
593 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
594 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
595 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
596 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
597 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
598 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
599 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
600 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
601 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
602 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
603 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
604 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
605 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
606 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
607 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
608 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
609 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
610 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
611 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
612 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
613 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
614 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
615 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
616 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
617 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
618 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
619 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
620 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
621 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
622 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
623 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
624 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
625 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
626 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
627 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
628 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
629 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
630 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
631 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
632 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
633 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
634 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
635 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
636 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
637 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
638 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
639 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
640 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
641 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
642 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
643 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
644 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
645 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
646 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
647 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
648 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
649 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
650 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
651 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
652 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
653 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
654 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
655 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
656 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
657 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
658 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
659 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
660 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
661 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
662 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
663 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
664 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
665 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
666 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
667 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
668 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
669 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
670 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
671 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
672 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
673 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
674 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
675 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
676 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
677 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
678 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
679 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
680 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
681 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
682 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
683 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
684 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
685 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
686 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
687 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
688 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
689 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
690 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
691 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
692 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
693 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
694 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
695 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
696 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
697 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
698 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
699 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
700 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
701 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
702 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
703 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
704 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
705 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
706 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
707 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
708 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
709 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
710 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
711 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
712 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
713 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
714 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
715 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
716 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
717 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
718 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
719 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
720 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
721 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
722 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
723 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
724 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
725 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
726 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
727 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
728 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
729 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
730 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
731 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
732 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
733 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
734 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
735 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
736 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
737 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
738 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
739 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
740 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
741 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
742 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
743 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
744 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
745 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
746 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
747 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
748 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
749 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
750 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
751 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
752 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
753 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
754 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
755 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
756 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
757 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
758 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
759 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
760 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
761 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
762 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
763 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
764 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
765 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
766 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
767 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
768 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
769 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
770 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
771 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
772 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
773 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
774 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
775 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
776 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
777 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
778 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
779 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
780 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
781 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
782 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
783 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
784 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
785 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
786 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
787 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
788 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
789 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
790 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
791 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
792 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
793 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
794 8005258706 Rhizobium sp. R693 Isolate Nodule
795 8005275841 Rhizobium sp. N4311 Isolate Nodule
796 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
797 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
798 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
799 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
800 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
801 8005321885 Rhizobium sp. R72 Isolate Nodule
802 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
803 8005382845 Rhizobium sp. R634 Isolate Nodule
804 8005395548 Rhizobium sp. R339 Isolate Nodule
805 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
806 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
807 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
808 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
809 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
810 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
811 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
812 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
813 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
814 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
815 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
816 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
817 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
818 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
819 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
820 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
821 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
822 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
823 8018176218 Rhizobium sp. N122 Isolate Nodule
824 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
825 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
826 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
827 8024501048 Rhizobium sp. H4 Isolate Nodule
828 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
829 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
830 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
831 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
832 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
833 8056382006 Rhizobium croatiense 13T Isolate Nodule
834 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
835 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
836 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 53.72
Metatranscriptomes 0.08
Isolates 46.2

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0
Endosphere 19.59
Nodule 36.45
Rhizoplane 2.48
Rhizosphere 21.9
Stem 0
Stem Tuber 0
Unclassified 19.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_FSXC55064_g1 2010549000 Bacteria 833
2 JGI24740J21852_10026035 3300001979 Bacteria 1964
3 JGI24739J22299_10081966 3300001989 Bacteria 990
4 JGI25156J39149_1000055 3300002705 Bacteria 87733
5 JGI25162J39368_1000601 3300002737 Bacteria 25918
6 JGI25162J39368_1000903 3300002737 Bacteria 19226
7 JGI25154J39366_1000069 3300002738 Bacteria 96438
8 JGI25157J39369_1000076 3300002741 Bacteria 87678
9 JGI25152J39213_1000820 3300002773 Bacteria 15512
10 JGI25152J39213_1004374 3300002773 Bacteria 4468
11 JGI25152J39213_1005150 3300002773 Bacteria 3913
12 JGI25152J39213_1005217 3300002773 Bacteria 3867
13 JGI25152J39213_1007563 3300002773 Bacteria 2797
14 JGI25150J39212_1002566 3300002774 Bacteria 4466
15 JGI25159J45721_1000022 3300002987 Bacteria 119463
16 JGI25151J46595_10015738 3300003187 Bacteria 3322
17 JGI25151J46595_10018505 3300003187 Bacteria 2988
18 JGI25151J46595_10027614 3300003187 Bacteria 2272
19 JGI25165J46597_1000974 3300003214 Bacteria 19236
20 JGI25165J46597_1001602 3300003214 Bacteria 10851
21 JGI25153J46596_10005551 3300003215 Bacteria 6594
22 JGI25153J46596_10007489 3300003215 Bacteria 5357
23 JGI25153J46596_10008231 3300003215 Bacteria 5011
24 JGI25153J46596_10008269 3300003215 Bacteria 4994
25 JGI25153J46596_10018949 3300003215 Bacteria 2652
26 JGI25153J46596_10025293 3300003215 Bacteria 2124
27 rootH2_10005284 3300003320 Bacteria 7444
28 rootH2_10042438 3300003320 Bacteria 1017
29 rootL2_10134841 3300003322 Bacteria 1052
30 rootL2_10149035 3300003322 Bacteria 3339
31 rootH1_10039093 3300003323 Bacteria 3732
32 rootH1_10089746 3300003323 Bacteria 4427
33 JGI25160J50197_1000051 3300003354 Bacteria 132923
34 JGI25160J50197_1000056 3300003354 Bacteria 119463
35 JGI25160J50197_1018375 3300003354 Bacteria 2182
36 JGI25160J50197_1023427 3300003354 Bacteria 1780
37 JGI25161J50226_1000011 3300003374 Bacteria 210140
38 JGI25161J50226_1000214 3300003374 Bacteria 36702
39 JGI25161J50226_1000451 3300003374 Bacteria 19047
40 Ga0055526_1001114 3300003771 Bacteria 19551
41 Ga0055526_1005687 3300003771 Bacteria 7076
42 Ga0055526_1008790 3300003771 Bacteria 4974
43 Ga0055526_1017791 3300003771 Bacteria 2693
44 Ga0055526_1022906 3300003771 Bacteria 2104
45 Ga0055524_1000962 3300003775 Bacteria 18149
46 Ga0055524_1001562 3300003775 Bacteria 12886
47 Ga0055524_1005939 3300003775 Bacteria 5374
48 Ga0055524_1020707 3300003775 Bacteria 2205
49 Ga0055524_1025496 3300003775 Bacteria 1850
50 Ga0055524_1030108 3300003775 Bacteria 1588
51 Ga0055524_1037300 3300003775 Bacteria 1291
52 Ga0055524_1054140 3300003775 Bacteria 882
53 Ga0055524_1066820 3300003775 Bacteria 712
54 Ga0055536_1004552 3300003781 Bacteria 7046
55 Ga0055528_1000452 3300003790 Bacteria 32857
56 Ga0055528_1001012 3300003790 Bacteria 18669
57 Ga0055528_1006339 3300003790 Bacteria 5376
58 Ga0055528_1007110 3300003790 Bacteria 4997
59 Ga0055528_1026231 3300003790 Bacteria 1682
60 Ga0055528_1039685 3300003790 Bacteria 1072
61 Ga0055530_10039913 3300003791 Bacteria 1156
62 Ga0055540_1000597 3300003792 Bacteria 26126
63 Ga0055540_1006130 3300003792 Bacteria 4844
64 Ga0055540_1018940 3300003792 Bacteria 1870
65 Ga0055531_10001167 3300003794 Bacteria 20222
66 Ga0058692_1001407 3300003856 Bacteria 8879
67 Ga0058692_1004294 3300003856 Bacteria 4243
68 Ga0055543_1000041 3300004625 Bacteria 118501
69 Ga0055543_1000330 3300004625 Bacteria 32518
70 Ga0055543_1000383 3300004625 Bacteria 28950
71 Ga0055543_1003469 3300004625 Bacteria 4636
72 Ga0065165_1000155 3300005262 Bacteria 119501
73 Ga0065165_1000303 3300005262 Bacteria 82513
74 Ga0065165_1015648 3300005262 Bacteria 2884
75 Ga0065165_1021843 3300005262 Bacteria 2211
76 Ga0065165_1025941 3300005262 Bacteria 1936
77 Ga0065165_1036529 3300005262 Bacteria 1498
78 Ga0070666_10007959 3300005335 Bacteria 6554
79 Ga0070668_100101196 3300005347 Bacteria 2283
80 Ga0070669_100071717 3300005353 Bacteria 2563
81 Ga0070671_100161837 3300005355 Bacteria 1892
82 Ga0070667_100219060 3300005367 Bacteria 1694
83 Ga0070663_100025431 3300005455 Bacteria 3997
84 Ga0070662_100314094 3300005457 Bacteria 1276
85 Ga0070665_100005296 3300005548 Bacteria 13322
86 Ga0070665_100179520 3300005548 Bacteria 2118
87 Ga0070665_100842109 3300005548 Bacteria 930
88 Ga0070665_101617168 3300005548 Bacteria 656
89 Ga0068863_101282359 3300005841 Bacteria 739
90 Ga0081455_10139034 3300005937 Bacteria 1889
91 Ga0075365_10001383 3300006038 Bacteria 10915
92 Ga0075365_10006283 3300006038 Bacteria 6519
93 Ga0075368_10028925 3300006042 Bacteria 2142
94 Ga0075363_100091936 3300006048 Bacteria 1671
95 Ga0075364_10138669 3300006051 Bacteria 1635
96 Ga0075362_10054231 3300006177 Bacteria 1801
97 Ga0075362_10058519 3300006177 Bacteria 1738
98 Ga0075367_10000616 3300006178 Bacteria 13639
99 Ga0075367_10463416 3300006178 Bacteria 803
100 Ga0075369_10000392 3300006186 Bacteria 13230
101 Ga0075369_10016630 3300006186 Bacteria 2971
102 Ga0075369_10023970 3300006186 Bacteria 2526
103 Ga0075369_10085775 3300006186 Bacteria 1401
104 Ga0075366_10007979 3300006195 Bacteria 5862
105 Ga0075366_10203489 3300006195 Bacteria 1204
106 Ga0075370_10002288 3300006353 Bacteria 8836
107 Ga0075370_10033253 3300006353 Bacteria 2886
108 Ga0079104_1000310 3300006946 Bacteria 61815
109 Ga0079104_1001973 3300006946 Bacteria 12061
110 Ga0079104_1005380 3300006946 Bacteria 5133
111 Ga0099826_10000813 3300006948 Bacteria 16761
112 Ga0105251_10004120 3300009011 Bacteria 10148
113 Ga0105250_10014478 3300009092 Bacteria 3240
114 Ga0105240_10000142 3300009093 Bacteria 146932
115 Ga0105243_10129773 3300009148 Bacteria 2137
116 Ga0105243_10344871 3300009148 Bacteria 1366
117 Ga0105248_10156684 3300009177 Bacteria 2570
118 Ga0105249_10038514 3300009553 Bacteria 4338
119 Ga0123341_1000071 3300009765 Bacteria 43545
120 Ga0123342_1017422 3300009766 Bacteria 5975
121 Ga0123342_1031713 3300009766 Bacteria 2535
122 Ga0105246_10100765 3300011119 Bacteria 2102
123 Ga0157314_1005142 3300012500 Bacteria 985
124 Ga0157314_1011624 3300012500 Bacteria 779
125 Ga0157373_10013927 3300013100 Bacteria 5899
126 Ga0157371_10000071 3300013102 Bacteria 164088
127 Ga0157370_10000079 3300013104 Bacteria 107305
128 Ga0157370_10002835 3300013104 Bacteria 20731
129 Ga0157369_10092694 3300013105 Bacteria 3224
130 Ga0157369_10105276 3300013105 Bacteria 3004
131 Ga0157369_10411989 3300013105 Bacteria 1401
132 Ga0171463_1004 3300013249 Bacteria 437207
133 Ga0163162_10395178 3300013306 Bacteria 1515
134 Ga0183363_1217 3300015690 Bacteria 11179
135 Ga0214544_1000079 3300021320 Bacteria 121742
136 Ga0214542_1000064 3300021321 Bacteria 127681
137 Ga0214542_1012059 3300021321 Bacteria 11445
138 Ga0214543_1000015 3300021327 Bacteria 305679
139 Ga0214543_1000063 3300021327 Bacteria 127694
140 Ga0228711_1000030 3300022739 Bacteria 94546
141 Ga0228710_1000002 3300022740 Bacteria 287279
142 Ga0209435_100031 3300025206 Bacteria 164115
143 Ga0209436_100013 3300025208 Bacteria 131492
144 Ga0209436_100428 3300025208 Bacteria 18888
145 Ga0209437_100179 3300025233 Bacteria 134210
146 Ga0209437_100181 3300025233 Bacteria 132953
147 Ga0209437_105251 3300025233 Bacteria 2214
148 Ga0207425_1001412 3300025245 Bacteria 10094
149 Ga0207425_1005147 3300025245 Bacteria 3776
150 Ga0207425_1030719 3300025245 Bacteria 1074
151 Ga0209646_1000102 3300025246 Bacteria 164115
152 Ga0209646_1004291 3300025246 Bacteria 2618
153 Ga0209026_1000096 3300025250 Bacteria 164115
154 Ga0209677_100353 3300025253 Bacteria 28643
155 Ga0209759_1000090 3300025256 Bacteria 164115
156 Ga0209129_1000029 3300025258 Bacteria 401149
157 Ga0209129_1000050 3300025258 Bacteria 267408
158 Ga0209129_1000289 3300025258 Bacteria 48018
159 Ga0209129_1000826 3300025258 Bacteria 19503
160 Ga0209129_1001114 3300025258 Bacteria 15657
161 Ga0209129_1001662 3300025258 Bacteria 12035
162 Ga0209129_1002660 3300025258 Bacteria 8461
163 Ga0209129_1036815 3300025258 Bacteria 790
164 Ga0209233_1000185 3300025261 Bacteria 133788
165 Ga0209233_1000212 3300025261 Bacteria 110364
166 Ga0209233_1000263 3300025261 Bacteria 79293
167 Ga0209673_1000033 3300025273 Bacteria 335369
168 Ga0209673_1000050 3300025273 Bacteria 285287
169 Ga0209673_1000370 3300025273 Bacteria 81047
170 Ga0209673_1001321 3300025273 Bacteria 24961
171 Ga0209673_1001329 3300025273 Bacteria 24789
172 Ga0209673_1003533 3300025273 Bacteria 9145
173 Ga0209673_1004386 3300025273 Bacteria 7591
174 Ga0209673_1006760 3300025273 Bacteria 5455
175 Ga0209673_1021110 3300025273 Bacteria 2287
176 Ga0209130_1000009 3300025284 Bacteria 498952
177 Ga0209130_1000058 3300025284 Bacteria 210250
178 Ga0209130_1000133 3300025284 Bacteria 119561
179 Ga0209130_1007568 3300025284 Bacteria 3331
180 Ga0209130_1010493 3300025284 Bacteria 2546
181 Ga0209130_1021620 3300025284 Bacteria 1448
182 Ga0209676_1012503 3300025292 Bacteria 3329
183 Ga0209025_1000042 3300025294 Bacteria 370577
184 Ga0209025_1000132 3300025294 Bacteria 197432
185 Ga0209025_1000536 3300025294 Bacteria 71932
186 Ga0209025_1000815 3300025294 Bacteria 50019
187 Ga0209025_1001644 3300025294 Bacteria 27573
188 Ga0209025_1006663 3300025294 Bacteria 8873
189 Ga0209025_1011082 3300025294 Bacteria 6006
190 Ga0209025_1014000 3300025294 Bacteria 4987
191 Ga0209025_1016811 3300025294 Bacteria 4279
192 Ga0209564_1000193 3300025295 Bacteria 141731
193 Ga0209564_1000227 3300025295 Bacteria 125497
194 Ga0209564_1000700 3300025295 Bacteria 49128
195 Ga0209564_1001108 3300025295 Bacteria 31835
196 Ga0209564_1004168 3300025295 Bacteria 9034
197 Ga0209564_1007892 3300025295 Bacteria 5383
198 Ga0209564_1022414 3300025295 Bacteria 2233
199 Ga0209564_1024268 3300025295 Bacteria 2076
200 Ga0209564_1027004 3300025295 Bacteria 1877
201 Ga0209758_1000299 3300025297 Bacteria 97367
202 Ga0209758_1000406 3300025297 Bacteria 73962
203 Ga0209758_1000864 3300025297 Bacteria 41937
204 Ga0209758_1001221 3300025297 Bacteria 32261
205 Ga0209758_1001412 3300025297 Bacteria 28454
206 Ga0209758_1001462 3300025297 Bacteria 27731
207 Ga0209758_1003168 3300025297 Bacteria 15434
208 Ga0209758_1029807 3300025297 Bacteria 2272
209 Ga0209758_1031603 3300025297 Bacteria 2168
210 Ga0209758_1032174 3300025297 Bacteria 2135
211 Ga0209758_1032301 3300025297 Bacteria 2128
212 Ga0209758_1072209 3300025297 Bacteria 1081
213 Ga0209050_1011077 3300025298 Bacteria 4332
214 Ga0209050_1011173 3300025298 Bacteria 4299
215 Ga0209050_1020388 3300025298 Bacteria 2469
216 Ga0209256_1000286 3300025299 Bacteria 88880
217 Ga0209256_1000459 3300025299 Bacteria 61577
218 Ga0209256_1001479 3300025299 Bacteria 24043
219 Ga0209256_1001610 3300025299 Bacteria 22074
220 Ga0209256_1001820 3300025299 Bacteria 19999
221 Ga0209256_1005684 3300025299 Bacteria 7012
222 Ga0209256_1008143 3300025299 Bacteria 4933
223 Ga0209256_1016485 3300025299 Bacteria 2515
224 Ga0209256_1019324 3300025299 Bacteria 2173
225 Ga0209256_1029148 3300025299 Bacteria 1543
226 Ga0209256_1043607 3300025299 Bacteria 1125
227 Ga0207426_1000131 3300025302 Bacteria 210250
228 Ga0207426_1000214 3300025302 Bacteria 137296
229 Ga0207426_1000248 3300025302 Bacteria 119561
230 Ga0207426_1000450 3300025302 Bacteria 65777
231 Ga0207426_1000682 3300025302 Bacteria 40955
232 Ga0209051_1000118 3300025303 Bacteria 149426
233 Ga0209051_1000547 3300025303 Bacteria 45743
234 Ga0209051_1001039 3300025303 Bacteria 26259
235 Ga0209051_1004006 3300025303 Bacteria 9339
236 Ga0209051_1013083 3300025303 Bacteria 3969
237 Ga0209051_1020276 3300025303 Bacteria 2869
238 Ga0209051_1035925 3300025303 Bacteria 1837
239 Ga0209051_1038917 3300025303 Bacteria 1725
240 Ga0209051_1068194 3300025303 Bacteria 1084
241 Ga0209051_1097889 3300025303 Bacteria 797
242 Ga0209257_1002918 3300025304 Bacteria 15767
243 Ga0209257_1006107 3300025304 Bacteria 7995
244 Ga0209257_1015028 3300025304 Bacteria 3262
245 Ga0207696_1064860 3300025711 Bacteria 1022
246 Ga0207680_10288585 3300025903 Bacteria 1141
247 Ga0207695_10000234 3300025913 Bacteria 146987
248 Ga0207671_10000234 3300025914 Bacteria 83448
249 Ga0207681_10185646 3300025923 Bacteria 1587
250 Ga0207681_10203140 3300025923 Bacteria 1523
251 Ga0207644_10234101 3300025931 Bacteria 1460
252 Ga0207709_10104110 3300025935 Bacteria 1883
253 Ga0207711_10113940 3300025941 Bacteria 2408
254 Ga0207712_10124029 3300025961 Bacteria 1959
255 Ga0207668_10188689 3300025972 Bacteria 1632
256 Ga0207668_10336706 3300025972 Bacteria 1257
257 Ga0207658_10104730 3300025986 Bacteria 2224
258 Ga0207678_10066768 3300026067 Bacteria 3088
259 Ga0207641_10799612 3300026088 Bacteria 933
260 Ga0209281_1000028 3300027111 Bacteria 440027
261 Ga0209281_1000030 3300027111 Bacteria 425931
262 Ga0209281_1000144 3300027111 Bacteria 172471
263 Ga0209371_1000037 3300027312 Bacteria 367074
264 Ga0209371_1001411 3300027312 Bacteria 16466
265 Ga0209371_1010567 3300027312 Bacteria 2822
266 Ga0209282_1000004 3300027666 Bacteria 425931
267 Ga0209282_1000695 3300027666 Bacteria 16757
268 Ga0209282_1047735 3300027666 Bacteria 2484
269 Ga0209813_10010477 3300027866 Bacteria 2399
270 Ga0268266_10007709 3300028379 Bacteria 9663
271 Ga0268266_10017319 3300028379 Bacteria 6150
272 Ga0268266_10019818 3300028379 Bacteria 5732
273 Ga0268266_10156974 3300028379 Bacteria 2056
274 Ga0268266_11277225 3300028379 Bacteria 709
275 Ga0307515_10001099 3300028794 Bacteria 61933
276 Ga0307515_10012908 3300028794 Bacteria 15667
277 Ga0268256_1000039 3300030500 Bacteria 354969
278 Ga0268256_1001490 3300030500 Bacteria 13902
279 Ga0268256_1007557 3300030500 Bacteria 3851
280 Ga0316181_1259233 3300030744 Bacteria 2240
281 Ga0307513_10000998 3300031456 Bacteria 40880
282 Ga0307513_10019403 3300031456 Bacteria 8094
283 Ga0307408_100136476 3300031548 Bacteria 1920
284 Ga0307408_100807009 3300031548 Bacteria 852
285 Ga0307405_10040495 3300031731 Bacteria 2822
286 Ga0307413_10581902 3300031824 Bacteria 913
287 Ga0307410_10218673 3300031852 Bacteria 1464
288 Ga0307406_10004352 3300031901 Bacteria 7707
289 Ga0307406_10224162 3300031901 Bacteria 1399
290 Ga0307412_10000412 3300031911 Bacteria 26116
291 Ga0307412_10070358 3300031911 Bacteria 2385
292 Ga0307412_10079765 3300031911 Bacteria 2259
293 Ga0315914_1000001 3300031967 Bacteria 416633
294 Ga0307409_100016139 3300031995 Bacteria 4932
295 Ga0307409_100091099 3300031995 Bacteria 2498
296 Ga0307416_100240160 3300032002 Bacteria 1755
297 Ga0315913_1000022 3300033430 Bacteria 94546
298 Ga0315915_1000002 3300033464 Bacteria 425854
299 Ga0436365_0373990 3300039437 Bacteria 2163
300 Ga0439436_0002644 3300041404 Bacteria 5400
301 Ga0439436_0021616 3300041404 Bacteria 1910
302 Ga0439438_016026 3300041405 Bacteria 2188
303 Ga0439439_0057980 3300041406 Bacteria 1025
304 Ga0439461_0013902 3300041410 Bacteria 1524
305 Ga0439465_0008572 3300041413 Bacteria 3226
306 Ga0439465_0019020 3300041413 Bacteria 2147
307 Ga0439465_0019581 3300041413 Bacteria 2116
308 Ga0439465_0028834 3300041413 Bacteria 1762
309 Ga0439465_0058711 3300041413 Bacteria 1272
310 Ga0439465_0090118 3300041413 Bacteria 1048
311 Ga0451791_1030467 3300041451 Bacteria 1562
312 Ga0451798_0608749 3300041458 Bacteria 2646
313 Ga0451833_0105464 3300041491 Bacteria 2560
314 Ga0451833_0360030 3300041491 Bacteria 2094
315 Ga0451833_1403877 3300041491 Bacteria 609
316 Ga0451835_0417831 3300041492 Bacteria 1308
317 Ga0451835_0867006 3300041492 Bacteria 2852
318 Ga0451835_1096416 3300041492 Bacteria 1288
319 Ga0451837_0030893 3300041494 Bacteria 2240
320 Ga0451837_0864410 3300041494 Bacteria 2088
321 Ga0451839_0137856 3300041496 Bacteria 2699
322 Ga0451841_0492521 3300041498 Bacteria 837
323 Ga0451841_0908703 3300041498 Bacteria 2132
324 Ga0451845_0191239 3300041501 Bacteria 987
325 Ga0451845_0378247 3300041501 Bacteria 2596
326 Ga0451847_0566208 3300041503 Bacteria 4555
327 Ga0451847_0712631 3300041503 Bacteria 1936
328 Ga0451849_0107853 3300041505 Bacteria 914
329 Ga0451849_0371279 3300041505 Bacteria 2007
330 Ga0451851_0266839 3300041507 Bacteria 1908
331 Ga0451851_0801872 3300041507 Bacteria 901
332 Ga0451843_0016801 3300041509 Bacteria 3598
333 Ga0451843_1111865 3300041509 Bacteria 1716
334 Ga0451855_0116657 3300041511 Bacteria 4353
335 Ga0451855_1140302 3300041511 Bacteria 642
336 Ga0451853_0435427 3300041512 Bacteria 1956
337 Ga0451853_1706919 3300041512 Bacteria 1094
338 Ga0451853_2867064 3300041512 Bacteria 908
339 Ga0439431_0050052 3300041997 Bacteria 1082
340 Ga0439445_0015504 3300042004 Bacteria 1867
341 Ga0439432_067265 3300042006 Bacteria 1097
342 Ga0439449_0014225 3300042007 Bacteria 2991
343 Ga0439449_0044100 3300042007 Bacteria 1654
344 Ga0439462_0031766 3300042015 Bacteria 1399
345 Ga0439462_0046742 3300042015 Bacteria 1160
346 Ga0450906_010148 3300042145 Bacteria 1786
347 Ga0450906_058020 3300042145 Bacteria 687
348 Ga0466966_0125012 3300044684 Bacteria 1578
349 Ga0466970_0001843 3300044765 Bacteria 10241
350 Ga0466957_0101388 3300044842 Bacteria 1815
351 Ga0466959_0114997 3300045049 Bacteria 1917
352 Ga0466958_0124339 3300045836 Bacteria 1617
353 Ga0466967_0579323 3300045976 Bacteria 1106
354 Ga0495627_120005 3300046453 Bacteria 743
355 Ga0495590_0033564 3300046457 Bacteria 1794
356 Ga0495638_0000110 3300046460 Bacteria 131410
357 Ga0495638_0099595 3300046460 Bacteria 1739
358 Ga0495650_0022871 3300046471 Bacteria 2989
359 Ga0495650_0097893 3300046471 Bacteria 1105
360 Ga0495650_0128404 3300046471 Bacteria 927
361 Ga0495605_0020885 3300046474 Bacteria 3475
362 Ga0495605_0021385 3300046474 Bacteria 3426
363 Ga0495662_0002722 3300046476 Bacteria 8931
364 Ga0495585_0017628 3300046492 Bacteria 4124
365 Ga0495585_0018413 3300046492 Bacteria 4028
366 Ga0495585_0020896 3300046492 Bacteria 3761
367 Ga0495596_0033622 3300046500 Bacteria 2040
368 Ga0495607_0009351 3300046501 Bacteria 6637
369 Ga0495607_0098099 3300046501 Bacteria 1574
370 Ga0495583_0009155 3300046506 Bacteria 5951
371 Ga0495583_0162869 3300046506 Bacteria 919
372 Ga0495606_0001343 3300046507 Bacteria 33471
373 Ga0495606_0018735 3300046507 Bacteria 5179
374 Ga0495606_0049333 3300046507 Bacteria 2762
375 Ga0495606_0087634 3300046507 Bacteria 1921
376 Ga0495606_0428377 3300046507 Bacteria 682
377 Ga0495610_0000363 3300046512 Bacteria 47378
378 Ga0495610_0023670 3300046512 Bacteria 3331
379 Ga0495610_0057323 3300046512 Bacteria 1868
380 Ga0495620_0021545 3300046515 Bacteria 3128
381 Ga0495620_0034097 3300046515 Bacteria 2304
382 Ga0495620_0035577 3300046515 Bacteria 2237
383 Ga0495620_0080771 3300046515 Bacteria 1315
384 Ga0495620_0134376 3300046515 Bacteria 969
385 Ga0495631_0036130 3300046518 Bacteria 2207
386 Ga0495632_0010305 3300046519 Bacteria 5548
387 Ga0495632_0012878 3300046519 Bacteria 4798
388 Ga0495643_0216381 3300046522 Bacteria 911
389 Ga0495643_0326937 3300046522 Bacteria 692
390 Ga0495643_0373454 3300046522 Bacteria 634
391 Ga0495644_0075191 3300046523 Bacteria 1272
392 Ga0495648_0095240 3300046524 Bacteria 1657
393 Ga0495648_0122881 3300046524 Bacteria 1392
394 Ga0495648_0172108 3300046524 Bacteria 1109
395 Ga0495652_0244882 3300046529 Bacteria 1332
396 Ga0495654_0042120 3300046530 Bacteria 2268
397 Ga0495609_0108052 3300046538 Bacteria 1202
398 Ga0495597_0043959 3300046542 Bacteria 1987
399 Ga0495622_0032703 3300046557 Bacteria 2428
400 Ga0495633_0023680 3300046558 Bacteria 3040
401 Ga0495633_0030340 3300046558 Bacteria 2626
402 Ga0495633_0129766 3300046558 Bacteria 1166
403 Ga0495656_0010068 3300046615 Bacteria 3424
404 Ga0495668_0019859 3300046616 Bacteria 3867
405 Ga0495668_0055795 3300046616 Bacteria 2181
406 Ga0495668_0190496 3300046616 Bacteria 1123
407 Ga0495668_0230887 3300046616 Bacteria 1013
408 Ga0495611_0021610 3300046648 Bacteria 2780
409 Ga0495625_0110161 3300046660 Bacteria 1882
410 Ga0495625_0124910 3300046660 Bacteria 1748
411 Ga0495625_0157467 3300046660 Bacteria 1523
412 Ga0495625_0301237 3300046660 Bacteria 1026
413 Ga0495661_0075172 3300046665 Bacteria 1964
414 Ga0495661_0120628 3300046665 Bacteria 1449
415 Ga0495588_0022965 3300046674 Bacteria 3084
416 Ga0495588_0132452 3300046674 Bacteria 1315
417 Ga0495588_0143506 3300046674 Bacteria 1261
418 Ga0495657_0056595 3300046675 Bacteria 2610
419 Ga0495658_0298967 3300046683 Bacteria 1018
420 Ga0495671_0044759 3300046692 Bacteria 2218
421 Ga0495649_0019639 3300046694 Bacteria 3796
422 Ga0495649_0226185 3300046694 Bacteria 967
423 Ga0495600_0330416 3300046809 Bacteria 957
424 Ga0495660_0181491 3300046810 Bacteria 1018
425 Ga0495604_0026659 3300047317 Bacteria 4599
426 Ga0495672_0021992 3300047320 Bacteria 4153
427 Ga0495676_0436259 3300047321 Bacteria 865
428 Ga0495683_0085475 3300047323 Bacteria 1534
429 Ga0495687_021278 3300047443 Bacteria 3142
430 Ga0495681_0035361 3300047470 Bacteria 2481
431 Ga0495681_0040126 3300047470 Bacteria 2281
432 Ga0495681_0185116 3300047470 Bacteria 853
433 Ga0495686_0001162 3300047472 Bacteria 30927
434 Ga0495686_0002138 3300047472 Bacteria 19314
435 Ga0495686_0019477 3300047472 Bacteria 4533
436 Ga0495686_0022887 3300047472 Bacteria 4128
437 Ga0495686_0070372 3300047472 Bacteria 2156
438 Ga0495686_0412445 3300047472 Bacteria 723
439 Ga0495686_0489337 3300047472 Bacteria 649
440 Ga0495615_0013503 3300048090 Bacteria 1708
441 Ga0495626_0054217 3300048091 Bacteria 1842
442 Ga0496100_0104274 3300048903 Bacteria 1959
443 Ga0496101_0126148 3300048904 Bacteria 1939
444 Ga0496101_0724997 3300048904 Bacteria 785
445 Ga0496102_0006022 3300048905 Bacteria 10327
446 Ga0496102_0051109 3300048905 Bacteria 3765
447 Ga0496103_0005771 3300048906 Bacteria 7389
448 Ga0496103_0032901 3300048906 Bacteria 3166
449 Ga0496104_0047950 3300048907 Bacteria 4027
450 Ga0496105_0022420 3300048908 Bacteria 5114
451 Ga0496106_0001205 3300048909 Bacteria 19322
452 Ga0496106_0140366 3300048909 Bacteria 1900
453 Ga0496107_0036741 3300048910 Bacteria 3514
454 Ga0496107_0051360 3300048910 Bacteria 2974
455 Ga0496108_0177714 3300048911 Bacteria 1843
456 Ga0496110_0026155 3300048913 Bacteria 4991
457 Ga0496111_0000529 3300048914 Bacteria 19781
458 Ga0496111_0077063 3300048914 Bacteria 2430
459 Ga0496113_0024324 3300048916 Bacteria 4303
460 Ga0496113_0062902 3300048916 Bacteria 2804
461 Ga0496113_0102738 3300048916 Bacteria 2217
462 Ga0496116_0000057 3300048919 Bacteria 281652
463 Ga0496116_0002951 3300048919 Bacteria 17324
464 Ga0496116_0010500 3300048919 Bacteria 7750
465 Ga0496116_0026331 3300048919 Bacteria 4257
466 Ga0496116_0052697 3300048919 Bacteria 2693
467 Ga0496116_0067419 3300048919 Bacteria 2285
468 Ga0496116_0125717 3300048919 Bacteria 1473
469 Ga0496116_0163627 3300048919 Bacteria 1217
470 Ga0496116_0199445 3300048919 Bacteria 1049
471 Ga0496116_0265186 3300048919 Bacteria 844
472 Ga0496117_0000031 3300048920 Bacteria 381048
473 Ga0496117_0006996 3300048920 Bacteria 11181
474 Ga0496117_0010245 3300048920 Bacteria 8588
475 Ga0496117_0011322 3300048920 Bacteria 7995
476 Ga0496117_0013741 3300048920 Bacteria 7033
477 Ga0496117_0115128 3300048920 Bacteria 1665
478 Ga0496117_0211283 3300048920 Bacteria 1088
479 Ga0496117_0229932 3300048920 Bacteria 1026
480 Ga0496118_0000208 3300048921 Bacteria 102645
481 Ga0496118_0008792 3300048921 Bacteria 10353
482 Ga0496118_0026767 3300048921 Bacteria 4903
483 Ga0496118_0082495 3300048921 Bacteria 2252
484 Ga0496118_0090333 3300048921 Bacteria 2111
485 Ga0496119_0015539 3300048922 Bacteria 5850
486 Ga0496119_0018993 3300048922 Bacteria 5086
487 Ga0496119_0023565 3300048922 Bacteria 4358
488 Ga0496119_0028959 3300048922 Bacteria 3767
489 Ga0496119_0069940 3300048922 Bacteria 2060
490 Ga0496119_0193071 3300048922 Bacteria 1059
491 Ga0496119_0247845 3300048922 Bacteria 899
492 Ga0496119_0304751 3300048922 Bacteria 784
493 Ga0496119_0305993 3300048922 Bacteria 782
494 Ga0496120_0000387 3300048923 Bacteria 71224
495 Ga0496120_0008826 3300048923 Bacteria 7237
496 Ga0496121_0000034 3300048924 Bacteria 377095
497 Ga0496121_0006665 3300048924 Bacteria 14205
498 Ga0496121_0013662 3300048924 Bacteria 8704
499 Ga0496121_0038317 3300048924 Bacteria 4248
500 Ga0496121_0064662 3300048924 Bacteria 2981
501 Ga0496121_0065145 3300048924 Bacteria 2966
502 Ga0496121_0081120 3300048924 Bacteria 2569
503 Ga0496121_0100435 3300048924 Bacteria 2233
504 Ga0496121_0172915 3300048924 Bacteria 1567
505 Ga0496121_0185395 3300048924 Bacteria 1497
506 Ga0496121_0221169 3300048924 Bacteria 1333
507 Ga0496121_0623855 3300048924 Bacteria 661
508 Ga0496122_0000023 3300048925 Bacteria 381035
509 Ga0496122_0000308 3300048925 Bacteria 107960
510 Ga0496122_0015251 3300048925 Bacteria 7354
511 Ga0496122_0015282 3300048925 Bacteria 7344
512 Ga0496122_0019377 3300048925 Bacteria 6218
513 Ga0496122_0020473 3300048925 Bacteria 5975
514 Ga0496122_0054737 3300048925 Bacteria 2993
515 Ga0496122_0058019 3300048925 Bacteria 2870
516 Ga0496122_0067660 3300048925 Bacteria 2570
517 Ga0496122_0084421 3300048925 Bacteria 2196
518 Ga0496122_0103079 3300048925 Bacteria 1900
519 Ga0496122_0272400 3300048925 Bacteria 931
520 Ga0496123_0000027 3300048926 Bacteria 306773
521 Ga0496123_0000066 3300048926 Bacteria 210327
522 Ga0496123_0005944 3300048926 Bacteria 12020
523 Ga0496123_0031587 3300048926 Bacteria 3850
524 Ga0496123_0033226 3300048926 Bacteria 3715
525 Ga0496123_0038852 3300048926 Bacteria 3339
526 Ga0496123_0039627 3300048926 Bacteria 3293
527 Ga0496123_0051313 3300048926 Bacteria 2747
528 Ga0496123_0069926 3300048926 Bacteria 2200
529 Ga0496123_0077281 3300048926 Bacteria 2045
530 Ga0496123_0095838 3300048926 Bacteria 1744
531 Ga0496123_0135265 3300048926 Bacteria 1357
532 Ga0496124_0001215 3300048927 Bacteria 39879
533 Ga0496124_0018926 3300048927 Bacteria 6429
534 Ga0496124_0019169 3300048927 Bacteria 6381
535 Ga0496124_0055661 3300048927 Bacteria 3341
536 Ga0496124_0072398 3300048927 Bacteria 2854
537 Ga0496124_0079902 3300048927 Bacteria 2692
538 Ga0496124_0093369 3300048927 Bacteria 2449
539 Ga0496124_0105892 3300048927 Bacteria 2271
540 Ga0496124_0134174 3300048927 Bacteria 1962
541 Ga0496124_0275512 3300048927 Bacteria 1229
542 Ga0496124_0299037 3300048927 Bacteria 1163
543 Ga0496124_0302055 3300048927 Bacteria 1155
544 Ga0496124_0530945 3300048927 Bacteria 781
545 Ga0496124_0583804 3300048927 Bacteria 730
546 Ga0496124_0731918 3300048927 Bacteria 622
547 Ga0496125_0000030 3300048928 Bacteria 375023
548 Ga0496125_0000288 3300048928 Bacteria 99681
549 Ga0496125_0005090 3300048928 Bacteria 14802
550 Ga0496125_0028379 3300048928 Bacteria 5056
551 Ga0496125_0064201 3300048928 Bacteria 2920
552 Ga0496125_0077580 3300048928 Bacteria 2560
553 Ga0496125_0089748 3300048928 Bacteria 2310
554 Ga0496125_0146081 3300048928 Bacteria 1634
555 Ga0496125_0192797 3300048928 Bacteria 1344
556 Ga0496125_0212927 3300048928 Bacteria 1253
557 Ga0496125_0257381 3300048928 Bacteria 1096
558 Ga0496126_0000115 3300048929 Bacteria 188546
559 Ga0496126_0000258 3300048929 Bacteria 113843
560 Ga0496126_0024648 3300048929 Bacteria 5804
561 Ga0496126_0027664 3300048929 Bacteria 5413
562 Ga0496126_0070762 3300048929 Bacteria 3107
563 Ga0496126_0099049 3300048929 Bacteria 2553
564 Ga0496126_0391213 3300048929 Bacteria 1129
565 Ga0496126_0586851 3300048929 Bacteria 879
566 Ga0495678_006828 3300049459 Bacteria 6004
567 Ga0495678_040938 3300049459 Bacteria 1858
568 Ga0495682_0151204 3300049460 Bacteria 828
569 Ga0501031_0087362 3300049568 Bacteria 2033
570 Ga0501032_0038403 3300049569 Bacteria 3261
571 Ga0501033_0207310 3300049570 Bacteria 1399
572 Ga0501034_0026220 3300049571 Bacteria 5936
573 Ga0501034_0573887 3300049571 Bacteria 1035
574 Ga0501037_0034368 3300049573 Bacteria 3741
575 Ga0501038_0108219 3300049574 Bacteria 2305
576 Ga0501038_0111837 3300049574 Bacteria 2262
577 Ga0501043_0072981 3300049579 Bacteria 2695
578 Ga0501047_0524800 3300049581 Bacteria 1010
579 Ga0501047_0571384 3300049581 Bacteria 954
580 Ga0501068_0322095 3300049584 Bacteria 991
581 Ga0501068_0352923 3300049584 Bacteria 945
582 Ga0501073_0103824 3300049589 Bacteria 1973
583 Ga0501073_0132213 3300049589 Bacteria 1730
584 Ga0501223_063309 3300049663 Bacteria 724
585 Ga0501238_005148 3300049671 Bacteria 1650
586 Ga0501080_0049490 3300049742 Bacteria 3912
587 Ga0501083_0034342 3300049744 Bacteria 3468
588 Ga0501083_0201936 3300049744 Bacteria 1296
589 Ga0501280_000684 3300049776 Bacteria 7483
590 Ga0501035_0166702 3300049822 Bacteria 1905
591 Ga0501044_0185061 3300049823 Bacteria 2048
592 nmdc:mga03683_64094_c1 3300050489 Bacteria 1559
593 nmdc:mga03n38_366798_c1 3300050490 Bacteria 787
594 nmdc:mga00v17_141160_c1 3300050491 Bacteria 1545
595 nmdc:mga00v17_15_c1 3300050491 Bacteria 126234
596 nmdc:mga00v17_55968_c1 3300050491 Bacteria 2410
597 nmdc:mga0yw44_27717_c1 3300050492 Bacteria 3250
598 nmdc:mga0yw44_61109_c1 3300050492 Bacteria 2310
599 nmdc:mga0k408_110158_c1 3300050493 Bacteria 1628
600 nmdc:mga0k408_6544_c1 3300050493 Bacteria 6205
601 nmdc:mga06z11_104594_c1 3300050494 Bacteria 1559
602 nmdc:mga06z11_11797_c1 3300050494 Bacteria 3780
603 nmdc:mga06z11_305929_c1 3300050494 Bacteria 946
604 nmdc:mga06z11_79268_c1 3300050494 Bacteria 1758
605 nmdc:mga04h51_101109_c1 3300050495 Bacteria 1051
606 nmdc:mga04h51_5669_c1 3300050495 Bacteria 3192
607 nmdc:mga07m45_107257_c2 3300050496 Bacteria 1123
608 nmdc:mga07m45_53477_c1 3300050496 Bacteria 2282
609 nmdc:mga0sz30_155606_c1 3300050516 Bacteria 1012
610 nmdc:mga0sz30_2785_c1 3300050516 Bacteria 6238
611 nmdc:mga0sz30_37813_c1 3300050516 Bacteria 2021
612 nmdc:mga0sz30_735_c1 3300050516 Bacteria 11987
613 Ga0495601_0031472 3300053077 Bacteria 3298
614 Ga0495619_0087376 3300053085 Bacteria 2108
615 Ga0500647_0187058 3300053091 Bacteria 947
616 Ga0500651_0026274 3300053093 Bacteria 3658
617 Ga0500650_0170058 3300053098 Unclassified 1002
618 Ga0500560_025638 3300053107 Bacteria 1733
619 Ga0500562_006715 3300053108 Bacteria 2901
620 Ga0500562_050458 3300053108 Bacteria 1112
621 Ga0500569_001882 3300053109 Bacteria 4047
622 Ga0500594_0053542 3300053118 Bacteria 1143
623 Ga0500618_000513 3300053125 Bacteria 24523
624 Ga0500618_010829 3300053125 Bacteria 2435
625 Ga0500618_057121 3300053125 Bacteria 879
626 Ga0500628_053207 3300053129 Bacteria 967
627 Ga0500655_000659 3300053133 Bacteria 6845
628 Ga0500658_0001061 3300053134 Bacteria 11260
629 Ga0500658_0008567 3300053134 Bacteria 3778
630 Ga0500658_0010054 3300053134 Bacteria 3492
631 Ga0500658_0149475 3300053134 Bacteria 1052
632 Ga0500659_0069908 3300053135 Bacteria 1862
633 Ga0500561_0000223 3300053137 Bacteria 10314
634 Ga0500568_0000247 3300053139 Bacteria 45994
635 Ga0500568_0005405 3300053139 Bacteria 6604
636 Ga0500568_0037466 3300053139 Bacteria 1967
637 Ga0500577_0310032 3300053142 Bacteria 689
638 Ga0500588_0041375 3300053146 Bacteria 1390
639 Ga0500590_000271 3300053148 Bacteria 16202
640 Ga0500604_0001019 3300053151 Bacteria 7827
641 Ga0500604_0009464 3300053151 Bacteria 2596
642 Ga0500616_0002118 3300053153 Bacteria 17230
643 Ga0500616_0033586 3300053153 Bacteria 2798
644 Ga0500622_0000169 3300053156 Bacteria 70224
645 Ga0500622_0046522 3300053156 Bacteria 2243
646 Ga0500624_000633 3300053157 Bacteria 9342
647 Ga0500627_0013773 3300053158 Bacteria 3079
648 Ga0500627_0033906 3300053158 Bacteria 2161
649 Ga0500627_0104733 3300053158 Bacteria 1271
650 Ga0500633_0000081 3300053160 Bacteria 14125
651 Ga0587072_007015 3300059643 Bacteria 1737

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003781 Ga0055536_1004552 Ga0055536_10045523 139
2 3300046460 Ga0495638_0000110 Ga0495638_0000110_72534_73088 141
3 3300053098 Ga0500650_0170058 Ga0500650_0170058_41_595 141
4 3300003792 Ga0055540_1018940 Ga0055540_10189401 142
5 3300003794 Ga0055531_10001167 Ga0055531_100011676 142
6 3300025298 Ga0209050_1011173 Ga0209050_10111734 142
7 3300025303 Ga0209051_1000547 Ga0209051_10005475 142
8 3300025304 Ga0209257_1006107 Ga0209257_10061075 142
9 3300003215 JGI25153J46596_10005551 JGI25153J46596_100055519 143
10 3300025297 Ga0209758_1000406 Ga0209758_100040652 143
11 3300049663 Ga0501223_063309 Ga0501223_063309_27_554 148
12 iso_pu_bacteria 2818991461 2819688371 149
13 iso_pu_bacteria 2842509118 2842514681 151
14 3300005937 Ga0081455_10139034 Ga0081455_101390342 152
15 3300005262 Ga0065165_1015648 Ga0065165_10156483 155
16 3300005548 Ga0070665_100179520 Ga0070665_1001795203 155
17 3300025284 Ga0209130_1021620 Ga0209130_10216202 155
18 3300028379 Ga0268266_10019818 Ga0268266_100198183 155
19 3300044765 Ga0466970_0001843 Ga0466970_0001843_2416_3039 155
20 3300044842 Ga0466957_0101388 Ga0466957_0101388_297_920 155
21 3300045049 Ga0466959_0114997 Ga0466959_0114997_915_1538 155
22 3300045836 Ga0466958_0124339 Ga0466958_0124339_420_1043 155
23 3300045976 Ga0466967_0579323 Ga0466967_0579323_218_841 155
24 3300048914 Ga0496111_0000529 Ga0496111_0000529_13690_14238 155
25 3300048919 Ga0496116_0265186 Ga0496116_0265186_276_824 155
26 3300048924 Ga0496121_0185395 Ga0496121_0185395_251_799 155
27 3300048924 Ga0496121_0221169 Ga0496121_0221169_439_987 155
28 3300048925 Ga0496122_0015282 Ga0496122_0015282_4731_5279 155
29 3300048926 Ga0496123_0069926 Ga0496123_0069926_555_1103 155
30 3300048927 Ga0496124_0001215 Ga0496124_0001215_36396_36944 155
31 3300048927 Ga0496124_0093369 Ga0496124_0093369_753_1301 155
32 3300048927 Ga0496124_0530945 Ga0496124_0530945_46_594 155
33 3300048927 Ga0496124_0731918 Ga0496124_0731918_41_589 155
34 3300049671 Ga0501238_005148 Ga0501238_005148_983_1531 155
35 3300053125 Ga0500618_000513 Ga0500618_000513_9868_10416 155
36 3300003771 Ga0055526_1001114 Ga0055526_10011142 156
37 3300003775 Ga0055524_1030108 Ga0055524_10301082 156
38 3300003790 Ga0055528_1001012 Ga0055528_10010122 156
39 3300025273 Ga0209673_1000050 Ga0209673_1000050203 156
40 3300025295 Ga0209564_1000227 Ga0209564_100022769 156
41 3300025299 Ga0209256_1001610 Ga0209256_100161017 156
42 3300001989 JGI24739J22299_10081966 JGI24739J22299_100819662 157
43 3300041491 Ga0451833_1403877 Ga0451833_1403877_16_570 157
44 3300041511 Ga0451855_1140302 Ga0451855_1140302_34_588 157
45 3300044684 Ga0466966_0125012 Ga0466966_0125012_272_895 157
46 3300046457 Ga0495590_0033564 Ga0495590_0033564_1209_1763 157
47 3300046471 Ga0495650_0097893 Ga0495650_0097893_352_906 157
48 3300046476 Ga0495662_0002722 Ga0495662_0002722_5476_6030 157
49 3300046506 Ga0495583_0162869 Ga0495583_0162869_78_632 157
50 3300046507 Ga0495606_0001343 Ga0495606_0001343_5843_6397 157
51 3300046512 Ga0495610_0000363 Ga0495610_0000363_12144_12698 157
52 3300046515 Ga0495620_0021545 Ga0495620_0021545_2440_2994 157
53 3300046515 Ga0495620_0035577 Ga0495620_0035577_475_1029 157
54 3300046519 Ga0495632_0010305 Ga0495632_0010305_1025_1579 157
55 3300046522 Ga0495643_0216381 Ga0495643_0216381_101_655 157
56 3300046522 Ga0495643_0373454 Ga0495643_0373454_10_564 157
57 3300046524 Ga0495648_0172108 Ga0495648_0172108_81_635 157
58 3300046529 Ga0495652_0244882 Ga0495652_0244882_113_667 157
59 3300046557 Ga0495622_0032703 Ga0495622_0032703_1002_1556 157
60 3300046616 Ga0495668_0019859 Ga0495668_0019859_1471_2025 157
61 3300046648 Ga0495611_0021610 Ga0495611_0021610_1107_1661 157
62 3300046660 Ga0495625_0124910 Ga0495625_0124910_512_1066 157
63 3300046674 Ga0495588_0132452 Ga0495588_0132452_417_971 157
64 3300046675 Ga0495657_0056595 Ga0495657_0056595_156_710 157
65 3300046683 Ga0495658_0298967 Ga0495658_0298967_272_826 157
66 3300046809 Ga0495600_0330416 Ga0495600_0330416_92_646 157
67 3300047317 Ga0495604_0026659 Ga0495604_0026659_3485_4039 157
68 3300047320 Ga0495672_0021992 Ga0495672_0021992_392_946 157
69 3300047321 Ga0495676_0436259 Ga0495676_0436259_230_784 157
70 3300047472 Ga0495686_0001162 Ga0495686_0001162_12770_13324 157
71 3300047472 Ga0495686_0002138 Ga0495686_0002138_16062_16616 157
72 3300047472 Ga0495686_0070372 Ga0495686_0070372_17_571 157
73 3300047472 Ga0495686_0489337 Ga0495686_0489337_61_615 157
74 3300048904 Ga0496101_0724997 Ga0496101_0724997_32_586 157
75 3300048919 Ga0496116_0002951 Ga0496116_0002951_2692_3246 157
76 3300048919 Ga0496116_0010500 Ga0496116_0010500_6413_6967 157
77 3300048919 Ga0496116_0026331 Ga0496116_0026331_2308_2862 157
78 3300048919 Ga0496116_0052697 Ga0496116_0052697_949_1503 157
79 3300048919 Ga0496116_0067419 Ga0496116_0067419_1160_1714 157
80 3300048919 Ga0496116_0125717 Ga0496116_0125717_74_628 157
81 3300048920 Ga0496117_0115128 Ga0496117_0115128_733_1287 157
82 3300048921 Ga0496118_0008792 Ga0496118_0008792_6283_6837 157
83 3300048921 Ga0496118_0026767 Ga0496118_0026767_646_1200 157
84 3300048922 Ga0496119_0028959 Ga0496119_0028959_2609_3163 157
85 3300048922 Ga0496119_0193071 Ga0496119_0193071_334_888 157
86 3300048922 Ga0496119_0247845 Ga0496119_0247845_288_842 157
87 3300048922 Ga0496119_0305993 Ga0496119_0305993_116_670 157
88 3300048924 Ga0496121_0006665 Ga0496121_0006665_11177_11731 157
89 3300048924 Ga0496121_0013662 Ga0496121_0013662_6945_7499 157
90 3300048924 Ga0496121_0064662 Ga0496121_0064662_429_983 157
91 3300048924 Ga0496121_0081120 Ga0496121_0081120_948_1502 157
92 3300048924 Ga0496121_0623855 Ga0496121_0623855_39_593 157
93 3300048925 Ga0496122_0019377 Ga0496122_0019377_2440_2994 157
94 3300048925 Ga0496122_0020473 Ga0496122_0020473_5135_5689 157
95 3300048925 Ga0496122_0054737 Ga0496122_0054737_185_739 157
96 3300048925 Ga0496122_0084421 Ga0496122_0084421_743_1297 157
97 3300048926 Ga0496123_0031587 Ga0496123_0031587_2904_3458 157
98 3300048926 Ga0496123_0033226 Ga0496123_0033226_558_1112 157
99 3300048926 Ga0496123_0039627 Ga0496123_0039627_1259_1813 157
100 3300048927 Ga0496124_0019169 Ga0496124_0019169_2672_3226 157
101 3300048927 Ga0496124_0055661 Ga0496124_0055661_1884_2438 157
102 3300048927 Ga0496124_0072398 Ga0496124_0072398_1520_2074 157
103 3300048927 Ga0496124_0079902 Ga0496124_0079902_1838_2392 157
104 3300048927 Ga0496124_0105892 Ga0496124_0105892_1132_1686 157
105 3300048927 Ga0496124_0302055 Ga0496124_0302055_586_1140 157
106 3300048928 Ga0496125_0077580 Ga0496125_0077580_1889_2443 157
107 3300048928 Ga0496125_0257381 Ga0496125_0257381_527_1081 157
108 3300049459 Ga0495678_006828 Ga0495678_006828_1137_1691 157
109 3300049569 Ga0501032_0038403 Ga0501032_0038403_2438_2992 157
110 3300049570 Ga0501033_0207310 Ga0501033_0207310_366_920 157
111 3300049573 Ga0501037_0034368 Ga0501037_0034368_1086_1640 157
112 3300049574 Ga0501038_0108219 Ga0501038_0108219_975_1529 157
113 3300049581 Ga0501047_0524800 Ga0501047_0524800_131_685 157
114 3300049581 Ga0501047_0571384 Ga0501047_0571384_326_880 157
115 3300049584 Ga0501068_0322095 Ga0501068_0322095_391_945 157
116 3300049589 Ga0501073_0103824 Ga0501073_0103824_787_1341 157
117 3300049742 Ga0501080_0049490 Ga0501080_0049490_1013_1567 157
118 3300049744 Ga0501083_0201936 Ga0501083_0201936_63_617 157
119 3300049822 Ga0501035_0166702 Ga0501035_0166702_1057_1611 157
120 3300049823 Ga0501044_0185061 Ga0501044_0185061_935_1489 157
121 3300050494 nmdc:mga06z11_305929_c1 nmdc:mga06z11_305929_c1_19_573 157
122 3300053077 Ga0495601_0031472 Ga0495601_0031472_2380_2934 157
123 3300053085 Ga0495619_0087376 Ga0495619_0087376_1001_1555 157
124 3300053091 Ga0500647_0187058 Ga0500647_0187058_206_760 157
125 3300053108 Ga0500562_006715 Ga0500562_006715_860_1414 157
126 3300053108 Ga0500562_050458 Ga0500562_050458_383_937 157
127 3300053118 Ga0500594_0053542 Ga0500594_0053542_104_658 157
128 3300053134 Ga0500658_0010054 Ga0500658_0010054_2409_2963 157
129 3300053134 Ga0500658_0149475 Ga0500658_0149475_472_1026 157
130 3300053139 Ga0500568_0000247 Ga0500568_0000247_30438_30992 157
131 3300053146 Ga0500588_0041375 Ga0500588_0041375_371_925 157
132 3300053148 Ga0500590_000271 Ga0500590_000271_2043_2597 157
133 3300053153 Ga0500616_0002118 Ga0500616_0002118_3969_4523 157
134 3300053156 Ga0500622_0000169 Ga0500622_0000169_37682_38236 157
135 3300053156 Ga0500622_0046522 Ga0500622_0046522_755_1309 157
136 3300053158 Ga0500627_0104733 Ga0500627_0104733_544_1098 157
137 iso_pu_bacteria 2821123053 2821129199 164
138 iso_pu_bacteria 2838736955 2838742216 164
139 iso_pu_bacteria 2841840854 2841846072 164
140 iso_pu_bacteria 2842140634 2842145776 164
141 iso_pu_bacteria 2857531043 2857536140 164
142 3300047472 Ga0495686_0019477 Ga0495686_0019477_2525_3124 166
143 iso_pu_bacteria 2551306090 2551717198 166
144 iso_pu_bacteria 2551306090 2551718196 166
145 iso_pu_bacteria 2551306090 2551720993 166
146 iso_pu_bacteria 2585427633 2585998085 166
147 iso_pu_bacteria 2585427634 2586002664 166
148 iso_pu_bacteria 2854896431 2854897782 166
149 iso_pu_bacteria 2854916844 2854922323 166
150 iso_pu_bacteria 2919171160 2919176875 166
151 iso_pu_bacteria 2558860983 2561468559 167
152 iso_pu_bacteria 8054558443 8054559965 167
153 iso_pu_bacteria 8056875544 8056878369 167
154 3300006946 Ga0079104_1000310 Ga0079104_100031023 168
155 3300027111 Ga0209281_1000028 Ga0209281_1000028242 168
156 3300053133 Ga0500655_000659 Ga0500655_000659_2363_2950 168
157 iso_pu_bacteria 2508501122 2509108853 168
158 iso_pu_bacteria 2509276019 2509377983 168
159 iso_pu_bacteria 2509276021 2509389226 168
160 iso_pu_bacteria 2509276033 2509444789 168
161 iso_pu_bacteria 2510065019 2510135429 168
162 iso_pu_bacteria 2510065057 2510305830 168
163 iso_pu_bacteria 2510461076 2510896888 168
164 iso_pu_bacteria 2510917022 2511135837 168
165 iso_pu_bacteria 2510917028 2511185219 168
166 iso_pu_bacteria 2510917030 2511194247 168
167 iso_pu_bacteria 2511231052 2511498596 168
168 iso_pu_bacteria 2512047086 2512534745 168
169 iso_pu_bacteria 2512875026 2512973443 168
170 iso_pu_bacteria 2513237084 2513572872 168
171 iso_pu_bacteria 2513237085 2513580405 168
172 iso_pu_bacteria 2513237086 2513586356 168
173 iso_pu_bacteria 2513237088 2513597840 168
174 iso_pu_bacteria 2513237089 2513602040 168
175 iso_pu_bacteria 2513237091 2513615829 168
176 iso_pu_bacteria 2513237093 2513634907 168
177 iso_pu_bacteria 2513237103 2513711532 168
178 iso_pu_bacteria 2513237138 2513865119 168
179 iso_pu_bacteria 2513237140 2513885395 168
180 iso_pu_bacteria 2513237143 2513904664 168
181 iso_pu_bacteria 2513237144 2513912911 168
182 iso_pu_bacteria 2513237146 2513929504 168
183 iso_pu_bacteria 2513237156 2513983494 168
184 iso_pu_bacteria 2513237160 2514003361 168
185 iso_pu_bacteria 2513237162 2514023174 168
186 iso_pu_bacteria 2515075009 2515114601 168
187 iso_pu_bacteria 2515154107 2515612424 168
188 iso_pu_bacteria 2515154113 2515634979 168
189 iso_pu_bacteria 2515154114 2515644457 168
190 iso_pu_bacteria 2515154116 2515660966 168
191 iso_pu_bacteria 2515154134 2515741784 168
192 iso_pu_bacteria 2516143018 2516205704 168
193 iso_pu_bacteria 2516653046 2516894873 168
194 iso_pu_bacteria 2516653077 2517038244 168
195 iso_pu_bacteria 2516653085 2517078522 168
196 iso_pu_bacteria 2517093000 2517097261 168
197 iso_pu_bacteria 2517287029 2517408350 168
198 iso_pu_bacteria 2517487022 2517571554 168
199 iso_pu_bacteria 2519899620 2520376501 168
200 iso_pu_bacteria 2524023207 2524450309 168
201 iso_pu_bacteria 2524023209 2524461193 168
202 iso_pu_bacteria 2529292951 2530647173 168
203 iso_pu_bacteria 2534681796 2535519222 168
204 iso_pu_bacteria 2537561587 2537874468 168
205 iso_pu_bacteria 2551306084 2551678461 168
206 iso_pu_bacteria 2551306085 2551685182 168
207 iso_pu_bacteria 2551306086 2551694010 168
208 iso_pu_bacteria 2551306087 2551704502 168
209 iso_pu_bacteria 2551306089 2551710806 168
210 iso_pu_bacteria 2551306091 2551724604 168
211 iso_pu_bacteria 2551306092 2551734498 168
212 iso_pu_bacteria 2551306093 2551740731 168
213 iso_pu_bacteria 2554235003 2554248998 168
214 iso_pu_bacteria 2558860100 2558867516 168
215 iso_pu_bacteria 2558860242 2559296086 168
216 iso_pu_bacteria 2582581283 2585166496 168
217 iso_pu_bacteria 2582581294 2585201542 168
218 iso_pu_bacteria 2582581298 2585224117 168
219 iso_pu_bacteria 2582581299 2585231863 168
220 iso_pu_bacteria 2582581304 2585257165 168
221 iso_pu_bacteria 2582581306 2585267183 168
222 iso_pu_bacteria 2582581307 2585272073 168
223 iso_pu_bacteria 2582581308 2585279622 168
224 iso_pu_bacteria 2582581315 2585327459 168
225 iso_pu_bacteria 2582581316 2585334002 168
226 iso_pu_bacteria 2582581866 2585396169 168
227 iso_pu_bacteria 2582581867 2585399949 168
228 iso_pu_bacteria 2585427526 2585529179 168
229 iso_pu_bacteria 2585427527 2585535701 168
230 iso_pu_bacteria 2585427528 2585542996 168
231 iso_pu_bacteria 2585427529 2585549817 168
232 iso_pu_bacteria 2585427530 2585551079 168
233 iso_pu_bacteria 2585427531 2585563382 168
234 iso_pu_bacteria 2585427590 2585821038 168
235 iso_pu_bacteria 2585427593 2585839235 168
236 iso_pu_bacteria 2585427594 2585845071 168
237 iso_pu_bacteria 2585427608 2585897197 168
238 iso_pu_bacteria 2585427609 2585909111 168
239 iso_pu_bacteria 2585428125 2587984525 168
240 iso_pu_bacteria 2599185156 2599335741 168
241 iso_pu_bacteria 2599185170 2599419954 168
242 iso_pu_bacteria 2599185210 2599603121 168
243 iso_pu_bacteria 2600254933 2600377450 168
244 iso_pu_bacteria 2600255279 2601610974 168
245 iso_pu_bacteria 2600255308 2601747748 168
246 iso_pu_bacteria 2615840624 2616297539 168
247 iso_pu_bacteria 2615840626 2616306409 168
248 iso_pu_bacteria 2615840698 2616551103 168
249 iso_pu_bacteria 2617270742 2617382334 168
250 iso_pu_bacteria 2643221558 2643814895 168
251 iso_pu_bacteria 2643221568 2643854814 168
252 iso_pu_bacteria 2643221582 2643921610 168
253 iso_pu_bacteria 2643221599 2644002653 168
254 iso_pu_bacteria 2643221607 2644052450 168
255 iso_pu_bacteria 2643221634 2644194640 168
256 iso_pu_bacteria 2643221636 2644201167 168
257 iso_pu_bacteria 2643221637 2644209674 168
258 iso_pu_bacteria 2643221643 2644240305 168
259 iso_pu_bacteria 2643221686 2644484728 168
260 iso_pu_bacteria 2643221688 2644492549 168
261 iso_pu_bacteria 2643221689 2644501248 168
262 iso_pu_bacteria 2643221693 2644521664 168
263 iso_pu_bacteria 2643221718 2644653202 168
264 iso_pu_bacteria 2657244999 2657682301 168
265 iso_pu_bacteria 2667528174 2671116018 168
266 iso_pu_bacteria 2690316117 2692319829 168
267 iso_pu_bacteria 2718217882 2719183140 168
268 iso_pu_bacteria 2718217927 2719387860 168
269 iso_pu_bacteria 2718217997 2719667480 168
270 iso_pu_bacteria 2718218009 2719733857 168
271 iso_pu_bacteria 2718218199 2720493900 168
272 iso_pu_bacteria 2718218232 2720615361 168
273 iso_pu_bacteria 2718218233 2720622149 168
274 iso_pu_bacteria 2718218235 2720633503 168
275 iso_pu_bacteria 2718218269 2720777201 168
276 iso_pu_bacteria 2718218363 2721149252 168
277 iso_pu_bacteria 2718218365 2721160654 168
278 iso_pu_bacteria 2718218366 2721166065 168
279 iso_pu_bacteria 2718218423 2721401493 168
280 iso_pu_bacteria 2721755514 2722842235 168
281 iso_pu_bacteria 2721755556 2723028799 168
282 iso_pu_bacteria 2721755684 2723562412 168
283 iso_pu_bacteria 2721755685 2723569108 168
284 iso_pu_bacteria 2721755809 2724040307 168
285 iso_pu_bacteria 2721755810 2724046613 168
286 iso_pu_bacteria 2721755819 2724091808 168
287 iso_pu_bacteria 2721755822 2724106373 168
288 iso_pu_bacteria 2721755823 2724112180 168
289 iso_pu_bacteria 2724679232 2725945791 168
290 iso_pu_bacteria 2728369352 2730109735 168
291 iso_pu_bacteria 2728369365 2730166375 168
292 iso_pu_bacteria 2728369397 2730300286 168
293 iso_pu_bacteria 2738541293 2738801014 168
294 iso_pu_bacteria 2738541333 2739037691 168
295 iso_pu_bacteria 2751185821 2753458470 168
296 iso_pu_bacteria 2765235942 2766064074 168
297 iso_pu_bacteria 2775507266 2778179227 168
298 iso_pu_bacteria 2791355082 2792582348 168
299 iso_pu_bacteria 2791355091 2792621798 168
300 iso_pu_bacteria 2791355092 2792628945 168
301 iso_pu_bacteria 2791355094 2792640085 168
302 iso_pu_bacteria 2791355253 2793281841 168
303 iso_pu_bacteria 2791355256 2793295453 168
304 iso_pu_bacteria 2791355259 2793317951 168
305 iso_pu_bacteria 2791355260 2793324573 168
306 iso_pu_bacteria 2791355261 2793329616 168
307 iso_pu_bacteria 2791355262 2793332412 168
308 iso_pu_bacteria 2791355263 2793339006 168
309 iso_pu_bacteria 2791355264 2793346776 168
310 iso_pu_bacteria 2791355265 2793356792 168
311 iso_pu_bacteria 2791355266 2793359196 168
312 iso_pu_bacteria 2791355267 2793366080 168
313 iso_pu_bacteria 2802428858 2802717080 168
314 iso_pu_bacteria 2802428859 2802724932 168
315 iso_pu_bacteria 2802428860 2802729682 168
316 iso_pu_bacteria 2802428861 2802737028 168
317 iso_pu_bacteria 2802428862 2802743433 168
318 iso_pu_bacteria 2802428863 2802749441 168
319 iso_pu_bacteria 2802429268 2804753805 168
320 iso_pu_bacteria 2802429605 2805930919 168
321 iso_pu_bacteria 2802429606 2805936768 168
322 iso_pu_bacteria 2802429633 2806047764 168
323 iso_pu_bacteria 2802429634 2806055340 168
324 iso_pu_bacteria 2802429635 2806062221 168
325 iso_pu_bacteria 2802429636 2806070020 168
326 iso_pu_bacteria 2802429637 2806076680 168
327 iso_pu_bacteria 2808606387 2808988088 168
328 iso_pu_bacteria 2818991439 2819561096 168
329 iso_pu_bacteria 2818991448 2819611983 168
330 iso_pu_bacteria 2818991453 2819638477 168
331 iso_pu_bacteria 2838016132 2838018146 168
332 iso_pu_bacteria 2838022645 2838023826 168
333 iso_pu_bacteria 2838029111 2838034130 168
334 iso_pu_bacteria 2838035591 2838042004 168
335 iso_pu_bacteria 2838042994 2838046766 168
336 iso_pu_bacteria 2838048938 2838050995 168
337 iso_pu_bacteria 2838061910 2838062761 168
338 iso_pu_bacteria 2838068647 2838072306 168
339 iso_pu_bacteria 2838074704 2838078053 168
340 iso_pu_bacteria 2838661181 2838668145 168
341 iso_pu_bacteria 2838668709 2838674239 168
342 iso_pu_bacteria 2838675328 2838678533 168
343 iso_pu_bacteria 2838680041 2838683698 168
344 iso_pu_bacteria 2838686498 2838693355 168
345 iso_pu_bacteria 2838694306 2838698226 168
346 iso_pu_bacteria 2838701080 2838706642 168
347 iso_pu_bacteria 2838707686 2838711341 168
348 iso_pu_bacteria 2838714209 2838718379 168
349 iso_pu_bacteria 2838719591 2838722829 168
350 iso_pu_bacteria 2838724970 2838728445 168
351 iso_pu_bacteria 2838729681 2838735349 168
352 iso_pu_bacteria 2838742623 2838748102 168
353 iso_pu_bacteria 2841846520 2841850385 168
354 iso_pu_bacteria 2841851746 2841857421 168
355 iso_pu_bacteria 2841859092 2841863362 168
356 iso_pu_bacteria 2841864319 2841867575 168
357 iso_pu_bacteria 2842077413 2842081142 168
358 iso_pu_bacteria 2842110456 2842116606 168
359 iso_pu_bacteria 2842118031 2842122081 168
360 iso_pu_bacteria 2842124991 2842129105 168
361 iso_pu_bacteria 2842130223 2842133426 168
362 iso_pu_bacteria 2842146304 2842148971 168
363 iso_pu_bacteria 2842152218 2842155663 168
364 iso_pu_bacteria 2842156927 2842162404 168
365 iso_pu_bacteria 2842163707 2842166895 168
366 iso_pu_bacteria 2842170452 2842174379 168
367 iso_pu_bacteria 2842175837 2842179040 168
368 iso_pu_bacteria 2842180545 2842186044 168
369 iso_pu_bacteria 2842187318 2842190803 168
370 iso_pu_bacteria 2842192696 2842194708 168
371 iso_pu_bacteria 2842198810 2842201181 168
372 iso_pu_bacteria 2842205361 2842207593 168
373 iso_pu_bacteria 2842211629 2842214873 168
374 iso_pu_bacteria 2842217011 2842221967 168
375 iso_pu_bacteria 2842224351 2842227594 168
376 iso_pu_bacteria 2842229732 2842235503 168
377 iso_pu_bacteria 2842237096 2842241095 168
378 iso_pu_bacteria 2842243621 2842249214 168
379 iso_pu_bacteria 2842250916 2842256433 168
380 iso_pu_bacteria 2842257432 2842263169 168
381 iso_pu_bacteria 2842264693 2842269266 168
382 iso_pu_bacteria 2842271015 2842277823 168
383 iso_pu_bacteria 2842278818 2842280696 168
384 iso_pu_bacteria 2842285085 2842290358 168
385 iso_pu_bacteria 2842291075 2842294799 168
386 iso_pu_bacteria 2842298080 2842302637 168
387 iso_pu_bacteria 2842304105 2842305634 168
388 iso_pu_bacteria 2842311132 2842311598 168
389 iso_pu_bacteria 2842317721 2842323658 168
390 iso_pu_bacteria 2842341865 2842346880 168
391 iso_pu_bacteria 2842357229 2842358861 168
392 iso_pu_bacteria 2842363717 2842366089 168
393 iso_pu_bacteria 2842370503 2842375183 168
394 iso_pu_bacteria 2842377471 2842381197 168
395 iso_pu_bacteria 2842384541 2842388268 168
396 iso_pu_bacteria 2842395702 2842395758 168
397 iso_pu_bacteria 2842402390 2842408192 168
398 iso_pu_bacteria 2842409023 2842414954 168
399 iso_pu_bacteria 2842415677 2842421537 168
400 iso_pu_bacteria 2842422224 2842425938 168
401 iso_pu_bacteria 2842428310 2842433450 168
402 iso_pu_bacteria 2842434925 2842439495 168
403 iso_pu_bacteria 2842441272 2842446197 168
404 iso_pu_bacteria 2842447887 2842448564 168
405 iso_pu_bacteria 2842462802 2842467699 168
406 iso_pu_bacteria 2842469257 2842474337 168
407 iso_pu_bacteria 2842475841 2842480902 168
408 iso_pu_bacteria 2842482326 2842485291 168
409 iso_pu_bacteria 2842489311 2842491350 168
410 iso_pu_bacteria 2842495871 2842501915 168
411 iso_pu_bacteria 2842502639 2842507487 168
412 iso_pu_bacteria 2842515876 2842519901 168
413 iso_pu_bacteria 2842521101 2842527066 168
414 iso_pu_bacteria 2842922631 2842926471 168
415 iso_pu_bacteria 2844163670 2844168163 168
416 iso_pu_bacteria 2844454524 2844456796 168
417 iso_pu_bacteria 2847417321 2847420947 168
418 iso_pu_bacteria 2848992105 2848995778 168
419 iso_pu_bacteria 2850079185 2850082761 168
420 iso_pu_bacteria 2852387548 2852387550 168
421 iso_pu_bacteria 2855825444 2855827507 168
422 iso_pu_bacteria 2855839649 2855842882 168
423 iso_pu_bacteria 2855872281 2855873642 168
424 iso_pu_bacteria 2857516855 2857519770 168
425 iso_pu_bacteria 2858800743 2858803560 168
426 iso_pu_bacteria 2891373044 2891377783 168
427 iso_pu_bacteria 2896384573 2896390077 168
428 iso_pu_bacteria 2899792073 2899794810 168
429 iso_pu_bacteria 2899845264 2899849437 168
430 iso_pu_bacteria 2913295892 2913300294 168
431 iso_pu_bacteria 2915980308 2915981705 168
432 iso_pu_bacteria 2915986958 2915991912 168
433 iso_pu_bacteria 2915993759 2915999558 168
434 iso_pu_bacteria 2916000859 2916004467 168
435 iso_pu_bacteria 2916007675 2916013449 168
436 iso_pu_bacteria 2916014648 2916019873 168
437 iso_pu_bacteria 2916021584 2916023939 168
438 iso_pu_bacteria 2916028427 2916031864 168
439 iso_pu_bacteria 2916035215 2916040505 168
440 iso_pu_bacteria 2916041962 2916043438 168
441 iso_pu_bacteria 2916048683 2916050637 168
442 iso_pu_bacteria 2916055098 2916058699 168
443 iso_pu_bacteria 2916061851 2916066476 168
444 iso_pu_bacteria 2916068649 2916074696 168
445 iso_pu_bacteria 2916076590 2916077660 168
446 iso_pu_bacteria 2919100787 2919107953 168
447 iso_pu_bacteria 2919114240 2919118364 168
448 iso_pu_bacteria 2919408235 2919411464 168
449 iso_pu_bacteria 2920760137 2920760207 168
450 iso_pu_bacteria 2920822456 2920826066 168
451 iso_pu_bacteria 2921201388 2921205060 168
452 iso_pu_bacteria 2921208531 2921212022 168
453 iso_pu_bacteria 2921237296 2921240348 168
454 iso_pu_bacteria 2921244191 2921245623 168
455 iso_pu_bacteria 2921250672 2921252794 168
456 iso_pu_bacteria 2921257292 2921260433 168
457 iso_pu_bacteria 2921263974 2921267517 168
458 iso_pu_bacteria 2921282425 2921287324 168
459 iso_pu_bacteria 2921289301 2921293988 168
460 iso_pu_bacteria 2921296804 2921302530 168
461 iso_pu_bacteria 2923556063 2923559960 168
462 iso_pu_bacteria 2924144063 2924144817 168
463 iso_pu_bacteria 2924150972 2924157668 168
464 iso_pu_bacteria 2924158325 2924158774 168
465 iso_pu_bacteria 2924165586 2924168518 168
466 iso_pu_bacteria 2924172951 2924175806 168
467 iso_pu_bacteria 2924179722 2924183459 168
468 iso_pu_bacteria 2924186466 2924190206 168
469 iso_pu_bacteria 2924193448 2924193477 168
470 iso_pu_bacteria 2924200457 2924201454 168
471 iso_pu_bacteria 2924207177 2924207798 168
472 iso_pu_bacteria 2924214083 2924214882 168
473 iso_pu_bacteria 2924221636 2924227141 168
474 iso_pu_bacteria 2924228884 2924234028 168
475 iso_pu_bacteria 2926754445 2926754893 168
476 iso_pu_bacteria 2926760298 2926762058 168
477 iso_pu_bacteria 2929138655 2929142010 168
478 iso_pu_bacteria 2933006813 2933010491 168
479 iso_pu_bacteria 2933011516 2933015837 168
480 iso_pu_bacteria 2933016740 2933017806 168
481 iso_pu_bacteria 2933570622 2933572141 168
482 iso_pu_bacteria 2933586486 2933592788 168
483 iso_pu_bacteria 2933594066 2933597425 168
484 iso_pu_bacteria 2933599457 2933602842 168
485 iso_pu_bacteria 2935894831 2935898120 168
486 iso_pu_bacteria 2935901341 2935903438 168
487 iso_pu_bacteria 2936367885 2936370088 168
488 iso_pu_bacteria 2936375103 2936379264 168
489 iso_pu_bacteria 2936381700 2936381758 168
490 iso_pu_bacteria 2936996657 2936997444 168
491 iso_pu_bacteria 2937002841 2937004092 168
492 iso_pu_bacteria 2937009748 2937010371 168
493 iso_pu_bacteria 2937016420 2937020637 168
494 iso_pu_bacteria 2937023124 2937023168 168
495 iso_pu_bacteria 2937029754 2937031717 168
496 iso_pu_bacteria 2937036028 2937037784 168
497 iso_pu_bacteria 2937042894 2937043164 168
498 iso_pu_bacteria 2937049772 2937053547 168
499 iso_pu_bacteria 2937056579 2937059365 168
500 iso_pu_bacteria 2937063883 2937070507 168
501 iso_pu_bacteria 2937071275 2937076109 168
502 iso_pu_bacteria 2937078374 2937081498 168
503 iso_pu_bacteria 2937084907 2937090870 168
504 iso_pu_bacteria 2937091812 2937093354 168
505 iso_pu_bacteria 2937098957 2937104319 168
506 iso_pu_bacteria 2937106411 2937113252 168
507 iso_pu_bacteria 2937113482 2937114252 168
508 iso_pu_bacteria 2937119839 2937120250 168
509 iso_pu_bacteria 2937126314 2937129769 168
510 iso_pu_bacteria 2937843397 2937843738 168
511 iso_pu_bacteria 2957375807 2957376784 168
512 iso_pu_bacteria 2957382221 2957384913 168
513 iso_pu_bacteria 2957388812 2957395188 168
514 iso_pu_bacteria 2957395598 2957399717 168
515 iso_pu_bacteria 2957402308 2957405539 168
516 iso_pu_bacteria 2957408893 2957411704 168
517 iso_pu_bacteria 2957415311 2957417461 168
518 iso_pu_bacteria 2957422303 2957422374 168
519 iso_pu_bacteria 2957430029 2957430088 168
520 iso_pu_bacteria 2957437181 2957441678 168
521 iso_pu_bacteria 2957443900 2957447647 168
522 iso_pu_bacteria 2957450854 2957454669 168
523 iso_pu_bacteria 2957457609 2957461008 168
524 iso_pu_bacteria 2957464669 2957466499 168
525 iso_pu_bacteria 2957471148 2957475385 168
526 iso_pu_bacteria 2957478035 2957481443 168
527 iso_pu_bacteria 2957484790 2957489075 168
528 iso_pu_bacteria 2957491536 2957494425 168
529 iso_pu_bacteria 2957498199 2957505164 168
530 iso_pu_bacteria 2957505466 2957508276 168
531 iso_pu_bacteria 2960584000 2960589437 168
532 iso_pu_bacteria 2960591022 2960592808 168
533 iso_pu_bacteria 2960597568 2960597889 168
534 iso_pu_bacteria 2960603979 2960607481 168
535 iso_pu_bacteria 2960610863 2960613669 168
536 iso_pu_bacteria 2960617483 2960619083 168
537 iso_pu_bacteria 2960624210 2960629070 168
538 iso_pu_bacteria 2960631154 2960634205 168
539 iso_pu_bacteria 2960637947 2960643575 168
540 iso_pu_bacteria 2960645483 2960650714 168
541 iso_pu_bacteria 2960652885 2960655916 168
542 iso_pu_bacteria 2960660292 2960663971 168
543 iso_pu_bacteria 2960667422 2960673297 168
544 iso_pu_bacteria 2960674078 2960674874 168
545 iso_pu_bacteria 2960680706 2960681733 168
546 iso_pu_bacteria 2960687367 2960689327 168
547 iso_pu_bacteria 2960693952 2960700659 168
548 iso_pu_bacteria 2964607997 2964608217 168
549 iso_pu_bacteria 2964615318 2964621661 168
550 iso_pu_bacteria 2964621998 2964625839 168
551 iso_pu_bacteria 2964628898 2964629542 168
552 iso_pu_bacteria 2964636051 2964639231 168
553 iso_pu_bacteria 2964643177 2964643600 168
554 iso_pu_bacteria 2964649959 2964655204 168
555 iso_pu_bacteria 2964656573 2964659987 168
556 iso_pu_bacteria 2964663802 2964669408 168
557 iso_pu_bacteria 2964670856 2964676858 168
558 iso_pu_bacteria 2964678106 2964681671 168
559 iso_pu_bacteria 2964685014 2964687461 168
560 iso_pu_bacteria 2964691889 2964695150 168
561 iso_pu_bacteria 2964698721 2964699168 168
562 iso_pu_bacteria 2964705432 2964711195 168
563 iso_pu_bacteria 2964712639 2964712651 168
564 iso_pu_bacteria 2964719344 2964719772 168
565 iso_pu_bacteria 2967664464 2967668266 168
566 iso_pu_bacteria 2967671571 2967675615 168
567 iso_pu_bacteria 2967678726 2967681256 168
568 iso_pu_bacteria 2967686174 2967692419 168
569 iso_pu_bacteria 2967693043 2967699407 168
570 iso_pu_bacteria 2967699805 2967704821 168
571 iso_pu_bacteria 2967706974 2967713017 168
572 iso_pu_bacteria 2967714385 2967721204 168
573 iso_pu_bacteria 2967721400 2967724954 168
574 iso_pu_bacteria 2967728569 2967731840 168
575 iso_pu_bacteria 2967735183 2967738471 168
576 iso_pu_bacteria 2967742019 2967745468 168
577 iso_pu_bacteria 2967748971 2967752608 168
578 iso_pu_bacteria 2967755722 2967757755 168
579 iso_pu_bacteria 2967762386 2967765788 168
580 iso_pu_bacteria 2967769361 2967770338 168
581 iso_pu_bacteria 2967775926 2967780507 168
582 iso_pu_bacteria 2970019648 2970021997 168
583 iso_pu_bacteria 2970026789 2970028670 168
584 iso_pu_bacteria 2970033650 2970038975 168
585 iso_pu_bacteria 2970040964 2970046607 168
586 iso_pu_bacteria 2970047711 2970049616 168
587 iso_pu_bacteria 2970054988 2970058828 168
588 iso_pu_bacteria 2970061556 2970066752 168
589 iso_pu_bacteria 2970068827 2970071182 168
590 iso_pu_bacteria 2970076120 2970076710 168
591 iso_pu_bacteria 2970082768 2970086757 168
592 iso_pu_bacteria 2970088815 2970092735 168
593 iso_pu_bacteria 2970095765 2970101179 168
594 iso_pu_bacteria 2970102677 2970104603 168
595 iso_pu_bacteria 2970109326 2970113935 168
596 iso_pu_bacteria 2970116247 2970118382 168
597 iso_pu_bacteria 2970122695 2970124498 168
598 iso_pu_bacteria 2970129317 2970133514 168
599 iso_pu_bacteria 2970136068 2970140885 168
600 iso_pu_bacteria 2970143518 2970147343 168
601 iso_pu_bacteria 2970149975 2970155849 168
602 iso_pu_bacteria 2970156795 2970161192 168
603 iso_pu_bacteria 2970164137 2970170747 168
604 iso_pu_bacteria 2970170962 2970174080 168
605 iso_pu_bacteria 2970177841 2970182110 168
606 iso_pu_bacteria 2970184632 2970189131 168
607 iso_pu_bacteria 2970191845 2970197905 168
608 iso_pu_bacteria 2977516862 2977520216 168
609 iso_pu_bacteria 2977523885 2977527405 168
610 iso_pu_bacteria 2977530762 2977531208 168
611 iso_pu_bacteria 2977537788 2977544462 168
612 iso_pu_bacteria 2977544691 2977547484 168
613 iso_pu_bacteria 2977551784 2977558004 168
614 iso_pu_bacteria 2977558990 2977564715 168
615 iso_pu_bacteria 2977565890 2977571320 168
616 iso_pu_bacteria 2977572785 2977577254 168
617 iso_pu_bacteria 2977579622 2977583335 168
618 iso_pu_bacteria 2978969890 2978972754 168
619 iso_pu_bacteria 2979089926 2979092673 168
620 iso_pu_bacteria 2979095461 2979099936 168
621 iso_pu_bacteria 2979100975 2979104645 168
622 iso_pu_bacteria 2984509177 2984513558 168
623 iso_pu_bacteria 2984518228 2984522862 168
624 iso_pu_bacteria 2984537506 2984542170 168
625 iso_pu_bacteria 2984587000 2984591006 168
626 iso_pu_bacteria 2984601300 2984601598 168
627 iso_pu_bacteria 2989349275 2989355082 168
628 iso_pu_bacteria 2996887358 2996890467 168
629 iso_pu_bacteria 2996893221 2996896200 168
630 iso_pu_bacteria 3003930520 3003931150 168
631 iso_pu_bacteria 3005416602 3005416878 168
632 iso_pu_bacteria 3005445848 3005449854 168
633 iso_pu_bacteria 3005452660 3005456145 168
634 iso_pu_bacteria 639633055 639645860 168
635 iso_pu_bacteria 643692032 643827535 168
636 iso_pu_bacteria 648276728 648737316 168
637 iso_pu_bacteria 650716007 650738503 168
638 iso_pu_bacteria 8003570095 8003573636 168
639 iso_pu_bacteria 8003992118 8003995463 168
640 iso_pu_bacteria 8003999396 8004003222 168
641 iso_pu_bacteria 8005258706 8005262654 168
642 iso_pu_bacteria 8005275841 8005282618 168
643 iso_pu_bacteria 8005282627 8005286567 168
644 iso_pu_bacteria 8005289223 8005291995 168
645 iso_pu_bacteria 8005301065 8005306134 168
646 iso_pu_bacteria 8005307578 8005309708 168
647 iso_pu_bacteria 8005314921 8005315918 168
648 iso_pu_bacteria 8005321885 8005324994 168
649 iso_pu_bacteria 8005376324 8005381382 168
650 iso_pu_bacteria 8005382845 8005387592 168
651 iso_pu_bacteria 8005395548 8005398428 168
652 iso_pu_bacteria 8005430974 8005431971 168
653 iso_pu_bacteria 8005460587 8005465296 168
654 iso_pu_bacteria 8005484373 8005487005 168
655 iso_pu_bacteria 8005497431 8005497874 168
656 iso_pu_bacteria 8005542996 8005546879 168
657 iso_pu_bacteria 8005556819 8005561361 168
658 iso_pu_bacteria 8005563573 8005565983 168
659 iso_pu_bacteria 8005570704 8005572033 168
660 iso_pu_bacteria 8005619151 8005623608 168
661 iso_pu_bacteria 8005626139 8005630831 168
662 iso_pu_bacteria 8005645114 8005645202 168
663 iso_pu_bacteria 8005658619 8005660972 168
664 iso_pu_bacteria 8005668836 8005669280 168
665 iso_pu_bacteria 8005682033 8005687352 168
666 iso_pu_bacteria 8005688590 8005694169 168
667 iso_pu_bacteria 8005695170 8005695815 168
668 iso_pu_bacteria 8018127388 8018128660 168
669 iso_pu_bacteria 8018163183 8018164902 168
670 iso_pu_bacteria 8018176218 8018177658 168
671 iso_pu_bacteria 8023680758 8023686739 168
672 iso_pu_bacteria 8024479707 8024484559 168
673 iso_pu_bacteria 8024486573 8024491022 168
674 iso_pu_bacteria 8024501048 8024504031 168
675 iso_pu_bacteria 8046767195 8046768362 168
676 iso_pu_bacteria 8049293176 8049296405 168
677 iso_pu_bacteria 8055431914 8055432965 168
678 iso_pu_bacteria 8056375014 8056380592 168
679 iso_pu_bacteria 8056382006 8056383348 168
680 iso_pu_bacteria 8057575449 8057581969 168
681 iso_pu_bacteria 8057874678 8057879477 168
682 iso_pu_bacteria 2599185352 2600193983 169
683 iso_pu_bacteria 2643221557 2643807931 169
684 iso_pu_bacteria 2643221610 2644068878 169
685 iso_pu_bacteria 2643221618 2644105753 169
686 iso_pu_bacteria 2643221626 2644146363 169
687 iso_pu_bacteria 2643221655 2644310366 169
688 iso_pu_bacteria 2643221659 2644334849 169
689 iso_pu_bacteria 2643221668 2644378396 169
690 iso_pu_bacteria 2643221675 2644419949 169
691 iso_pu_bacteria 2643221680 2644453305 169
692 iso_pu_bacteria 2643221698 2644544957 169
693 iso_pu_bacteria 2643221712 2644615393 169
694 iso_pu_bacteria 2643221723 2644675104 169
695 iso_pu_bacteria 2643221726 2644688668 169
696 iso_pu_bacteria 2941499720 2941501490 169
697 3300005548 Ga0070665_100842109 Ga0070665_1008421091 170
698 3300028379 Ga0268266_11277225 Ga0268266_112772251 170
699 3300039437 Ga0436365_0373990 Ga0436365_0373990_58_648 170
700 3300053158 Ga0500627_0033906 Ga0500627_0033906_1296_1895 170
701 3300048928 Ga0496125_0146081 Ga0496125_0146081_43_639 171
702 2010549000 RicEn_FSXC55064_g1 RicEn_475320 172
703 3300001979 JGI24740J21852_10026035 JGI24740J21852_100260353 172
704 3300002705 JGI25156J39149_1000055 JGI25156J39149_100005555 172
705 3300002737 JGI25162J39368_1000601 JGI25162J39368_100060127 172
706 3300002737 JGI25162J39368_1000903 JGI25162J39368_10009034 172
707 3300002738 JGI25154J39366_1000069 JGI25154J39366_100006939 172
708 3300002741 JGI25157J39369_1000076 JGI25157J39369_100007655 172
709 3300002773 JGI25152J39213_1000820 JGI25152J39213_10008209 172
710 3300002773 JGI25152J39213_1004374 JGI25152J39213_10043745 172
711 3300002773 JGI25152J39213_1005150 JGI25152J39213_10051505 172
712 3300002773 JGI25152J39213_1005217 JGI25152J39213_10052175 172
713 3300002773 JGI25152J39213_1007563 JGI25152J39213_10075632 172
714 3300002774 JGI25150J39212_1002566 JGI25150J39212_10025663 172
715 3300002987 JGI25159J45721_1000022 JGI25159J45721_100002232 172
716 3300003187 JGI25151J46595_10015738 JGI25151J46595_100157384 172
717 3300003187 JGI25151J46595_10018505 JGI25151J46595_100185053 172
718 3300003187 JGI25151J46595_10027614 JGI25151J46595_100276144 172
719 3300003214 JGI25165J46597_1000974 JGI25165J46597_10009744 172
720 3300003214 JGI25165J46597_1001602 JGI25165J46597_10016024 172
721 3300003215 JGI25153J46596_10007489 JGI25153J46596_100074892 172
722 3300003215 JGI25153J46596_10008231 JGI25153J46596_100082312 172
723 3300003215 JGI25153J46596_10008269 JGI25153J46596_100082696 172
724 3300003215 JGI25153J46596_10018949 JGI25153J46596_100189493 172
725 3300003215 JGI25153J46596_10025293 JGI25153J46596_100252932 172
726 3300003320 rootH2_10005284 rootH2_100052842 172
727 3300003320 rootH2_10042438 rootH2_100424382 172
728 3300003322 rootL2_10134841 rootL2_101348412 172
729 3300003322 rootL2_10149035 rootL2_101490354 172
730 3300003323 rootH1_10039093 rootH1_100390932 172
731 3300003323 rootH1_10089746 rootH1_100897463 172
732 3300003354 JGI25160J50197_1000051 JGI25160J50197_100005158 172
733 3300003354 JGI25160J50197_1000056 JGI25160J50197_100005669 172
734 3300003354 JGI25160J50197_1018375 JGI25160J50197_10183752 172
735 3300003354 JGI25160J50197_1023427 JGI25160J50197_10234272 172
736 3300003374 JGI25161J50226_1000011 JGI25161J50226_1000011136 172
737 3300003374 JGI25161J50226_1000214 JGI25161J50226_100021414 172
738 3300003374 JGI25161J50226_1000451 JGI25161J50226_100045111 172
739 3300003771 Ga0055526_1005687 Ga0055526_10056877 172
740 3300003771 Ga0055526_1008790 Ga0055526_10087902 172
741 3300003771 Ga0055526_1017791 Ga0055526_10177911 172
742 3300003771 Ga0055526_1022906 Ga0055526_10229062 172
743 3300003775 Ga0055524_1000962 Ga0055524_10009628 172
744 3300003775 Ga0055524_1001562 Ga0055524_10015622 172
745 3300003775 Ga0055524_1005939 Ga0055524_10059394 172
746 3300003775 Ga0055524_1020707 Ga0055524_10207072 172
747 3300003775 Ga0055524_1025496 Ga0055524_10254962 172
748 3300003775 Ga0055524_1037300 Ga0055524_10373002 172
749 3300003775 Ga0055524_1054140 Ga0055524_10541401 172
750 3300003775 Ga0055524_1066820 Ga0055524_10668201 172
751 3300003790 Ga0055528_1000452 Ga0055528_100045215 172
752 3300003790 Ga0055528_1006339 Ga0055528_10063392 172
753 3300003790 Ga0055528_1007110 Ga0055528_10071102 172
754 3300003790 Ga0055528_1026231 Ga0055528_10262313 172
755 3300003790 Ga0055528_1039685 Ga0055528_10396852 172
756 3300003791 Ga0055530_10039913 Ga0055530_100399132 172
757 3300003792 Ga0055540_1000597 Ga0055540_100059710 172
758 3300003792 Ga0055540_1006130 Ga0055540_10061306 172
759 3300003856 Ga0058692_1001407 Ga0058692_10014073 172
760 3300003856 Ga0058692_1004294 Ga0058692_10042944 172
761 3300004625 Ga0055543_1000041 Ga0055543_100004147 172
762 3300004625 Ga0055543_1000330 Ga0055543_100033021 172
763 3300004625 Ga0055543_1000383 Ga0055543_100038322 172
764 3300004625 Ga0055543_1003469 Ga0055543_10034695 172
765 3300005262 Ga0065165_1000155 Ga0065165_100015570 172
766 3300005262 Ga0065165_1000303 Ga0065165_100030316 172
767 3300005262 Ga0065165_1021843 Ga0065165_10218432 172
768 3300005262 Ga0065165_1025941 Ga0065165_10259412 172
769 3300005262 Ga0065165_1036529 Ga0065165_10365292 172
770 3300005335 Ga0070666_10007959 Ga0070666_100079594 172
771 3300005347 Ga0070668_100101196 Ga0070668_1001011963 172
772 3300005353 Ga0070669_100071717 Ga0070669_1000717172 172
773 3300005355 Ga0070671_100161837 Ga0070671_1001618372 172
774 3300005367 Ga0070667_100219060 Ga0070667_1002190602 172
775 3300005455 Ga0070663_100025431 Ga0070663_1000254314 172
776 3300005457 Ga0070662_100314094 Ga0070662_1003140942 172
777 3300005548 Ga0070665_100005296 Ga0070665_10000529611 172
778 3300005548 Ga0070665_101617168 Ga0070665_1016171681 172
779 3300005841 Ga0068863_101282359 Ga0068863_1012823591 172
780 3300006038 Ga0075365_10001383 Ga0075365_100013835 172
781 3300006038 Ga0075365_10006283 Ga0075365_100062838 172
782 3300006042 Ga0075368_10028925 Ga0075368_100289253 172
783 3300006048 Ga0075363_100091936 Ga0075363_1000919362 172
784 3300006051 Ga0075364_10138669 Ga0075364_101386692 172
785 3300006177 Ga0075362_10054231 Ga0075362_100542313 172
786 3300006177 Ga0075362_10058519 Ga0075362_100585192 172
787 3300006178 Ga0075367_10000616 Ga0075367_1000061612 172
788 3300006178 Ga0075367_10463416 Ga0075367_104634161 172
789 3300006186 Ga0075369_10000392 Ga0075369_100003924 172
790 3300006186 Ga0075369_10016630 Ga0075369_100166304 172
791 3300006186 Ga0075369_10023970 Ga0075369_100239702 172
792 3300006186 Ga0075369_10085775 Ga0075369_100857752 172
793 3300006195 Ga0075366_10007979 Ga0075366_100079792 172
794 3300006195 Ga0075366_10203489 Ga0075366_102034892 172
795 3300006353 Ga0075370_10002288 Ga0075370_100022887 172
796 3300006353 Ga0075370_10033253 Ga0075370_100332534 172
797 3300006946 Ga0079104_1001973 Ga0079104_10019738 172
798 3300006946 Ga0079104_1005380 Ga0079104_10053805 172
799 3300006948 Ga0099826_10000813 Ga0099826_1000081313 172
800 3300009011 Ga0105251_10004120 Ga0105251_100041207 172
801 3300009092 Ga0105250_10014478 Ga0105250_100144784 172
802 3300009093 Ga0105240_10000142 Ga0105240_1000014279 172
803 3300009148 Ga0105243_10129773 Ga0105243_101297732 172
804 3300009148 Ga0105243_10344871 Ga0105243_103448712 172
805 3300009177 Ga0105248_10156684 Ga0105248_101566843 172
806 3300009553 Ga0105249_10038514 Ga0105249_100385143 172
807 3300009765 Ga0123341_1000071 Ga0123341_100007134 172
808 3300009766 Ga0123342_1017422 Ga0123342_10174222 172
809 3300009766 Ga0123342_1031713 Ga0123342_10317132 172
810 3300011119 Ga0105246_10100765 Ga0105246_101007652 172
811 3300012500 Ga0157314_1005142 Ga0157314_10051422 172
812 3300012500 Ga0157314_1011624 Ga0157314_10116241 172
813 3300013100 Ga0157373_10013927 Ga0157373_100139276 172
814 3300013102 Ga0157371_10000071 Ga0157371_10000071100 172
815 3300013104 Ga0157370_10000079 Ga0157370_1000007948 172
816 3300013104 Ga0157370_10002835 Ga0157370_1000283516 172
817 3300013105 Ga0157369_10092694 Ga0157369_100926944 172
818 3300013105 Ga0157369_10105276 Ga0157369_101052763 172
819 3300013105 Ga0157369_10411989 Ga0157369_104119892 172
820 3300013249 Ga0171463_1004 Ga0171463_1004324 172
821 3300013306 Ga0163162_10395178 Ga0163162_103951782 172
822 3300015690 Ga0183363_1217 Ga0183363_12172 172
823 3300021320 Ga0214544_1000079 Ga0214544_100007961 172
824 3300021321 Ga0214542_1000064 Ga0214542_100006466 172
825 3300021321 Ga0214542_1012059 Ga0214542_101205910 172
826 3300021327 Ga0214543_1000015 Ga0214543_1000015197 172
827 3300021327 Ga0214543_1000063 Ga0214543_100006346 172
828 3300022739 Ga0228711_1000030 Ga0228711_100003015 172
829 3300022740 Ga0228710_1000002 Ga0228710_1000002189 172
830 3300025206 Ga0209435_100031 Ga0209435_10003188 172
831 3300025208 Ga0209436_100013 Ga0209436_10001364 172
832 3300025208 Ga0209436_100428 Ga0209436_1004289 172
833 3300025233 Ga0209437_100179 Ga0209437_10017961 172
834 3300025233 Ga0209437_100181 Ga0209437_10018159 172
835 3300025233 Ga0209437_105251 Ga0209437_1052512 172
836 3300025245 Ga0207425_1001412 Ga0207425_100141211 172
837 3300025245 Ga0207425_1005147 Ga0207425_10051475 172
838 3300025245 Ga0207425_1030719 Ga0207425_10307192 172
839 3300025246 Ga0209646_1000102 Ga0209646_100010288 172
840 3300025246 Ga0209646_1004291 Ga0209646_10042913 172
841 3300025250 Ga0209026_1000096 Ga0209026_100009688 172
842 3300025253 Ga0209677_100353 Ga0209677_10035323 172
843 3300025256 Ga0209759_1000090 Ga0209759_100009088 172
844 3300025258 Ga0209129_1000029 Ga0209129_1000029151 172
845 3300025258 Ga0209129_1000050 Ga0209129_100005058 172
846 3300025258 Ga0209129_1000289 Ga0209129_100028937 172
847 3300025258 Ga0209129_1000826 Ga0209129_100082615 172
848 3300025258 Ga0209129_1001114 Ga0209129_10011146 172
849 3300025258 Ga0209129_1001662 Ga0209129_10016625 172
850 3300025258 Ga0209129_1002660 Ga0209129_10026604 172
851 3300025258 Ga0209129_1036815 Ga0209129_10368151 172
852 3300025261 Ga0209233_1000185 Ga0209233_100018560 172
853 3300025261 Ga0209233_1000212 Ga0209233_100021265 172
854 3300025261 Ga0209233_1000263 Ga0209233_100026329 172
855 3300025273 Ga0209673_1000033 Ga0209673_100003356 172
856 3300025273 Ga0209673_1000370 Ga0209673_100037019 172
857 3300025273 Ga0209673_1001321 Ga0209673_10013217 172
858 3300025273 Ga0209673_1001329 Ga0209673_100132926 172
859 3300025273 Ga0209673_1003533 Ga0209673_100353311 172
860 3300025273 Ga0209673_1004386 Ga0209673_10043863 172
861 3300025273 Ga0209673_1006760 Ga0209673_10067604 172
862 3300025273 Ga0209673_1021110 Ga0209673_10211103 172
863 3300025284 Ga0209130_1000009 Ga0209130_100000959 172
864 3300025284 Ga0209130_1000058 Ga0209130_100005858 172
865 3300025284 Ga0209130_1000133 Ga0209130_100013369 172
866 3300025284 Ga0209130_1007568 Ga0209130_10075684 172
867 3300025284 Ga0209130_1010493 Ga0209130_10104933 172
868 3300025292 Ga0209676_1012503 Ga0209676_10125034 172
869 3300025294 Ga0209025_1000042 Ga0209025_100004285 172
870 3300025294 Ga0209025_1000132 Ga0209025_100013255 172
871 3300025294 Ga0209025_1000536 Ga0209025_100053629 172
872 3300025294 Ga0209025_1000815 Ga0209025_100081521 172
873 3300025294 Ga0209025_1001644 Ga0209025_100164425 172
874 3300025294 Ga0209025_1006663 Ga0209025_100666311 172
875 3300025294 Ga0209025_1011082 Ga0209025_10110823 172
876 3300025294 Ga0209025_1014000 Ga0209025_10140002 172
877 3300025294 Ga0209025_1016811 Ga0209025_10168113 172
878 3300025295 Ga0209564_1000193 Ga0209564_100019385 172
879 3300025295 Ga0209564_1000700 Ga0209564_100070047 172
880 3300025295 Ga0209564_1001108 Ga0209564_10011087 172
881 3300025295 Ga0209564_1004168 Ga0209564_10041685 172
882 3300025295 Ga0209564_1007892 Ga0209564_10078924 172
883 3300025295 Ga0209564_1022414 Ga0209564_10224143 172
884 3300025295 Ga0209564_1024268 Ga0209564_10242681 172
885 3300025295 Ga0209564_1027004 Ga0209564_10270042 172
886 3300025297 Ga0209758_1000299 Ga0209758_100029934 172
887 3300025297 Ga0209758_1000864 Ga0209758_100086415 172
888 3300025297 Ga0209758_1001221 Ga0209758_10012217 172
889 3300025297 Ga0209758_1001412 Ga0209758_100141215 172
890 3300025297 Ga0209758_1001462 Ga0209758_100146218 172
891 3300025297 Ga0209758_1003168 Ga0209758_10031682 172
892 3300025297 Ga0209758_1029807 Ga0209758_10298073 172
893 3300025297 Ga0209758_1031603 Ga0209758_10316033 172
894 3300025297 Ga0209758_1032174 Ga0209758_10321742 172
895 3300025297 Ga0209758_1032301 Ga0209758_10323012 172
896 3300025297 Ga0209758_1072209 Ga0209758_10722092 172
897 3300025298 Ga0209050_1011077 Ga0209050_10110773 172
898 3300025298 Ga0209050_1020388 Ga0209050_10203882 172
899 3300025299 Ga0209256_1000286 Ga0209256_100028613 172
900 3300025299 Ga0209256_1000459 Ga0209256_100045958 172
901 3300025299 Ga0209256_1001479 Ga0209256_100147917 172
902 3300025299 Ga0209256_1001820 Ga0209256_100182011 172
903 3300025299 Ga0209256_1005684 Ga0209256_10056847 172
904 3300025299 Ga0209256_1008143 Ga0209256_10081432 172
905 3300025299 Ga0209256_1016485 Ga0209256_10164853 172
906 3300025299 Ga0209256_1019324 Ga0209256_10193242 172
907 3300025299 Ga0209256_1029148 Ga0209256_10291481 172
908 3300025299 Ga0209256_1043607 Ga0209256_10436072 172
909 3300025302 Ga0207426_1000131 Ga0207426_100013158 172
910 3300025302 Ga0207426_1000214 Ga0207426_100021459 172
911 3300025302 Ga0207426_1000248 Ga0207426_100024869 172
912 3300025302 Ga0207426_1000450 Ga0207426_10004505 172
913 3300025302 Ga0207426_1000682 Ga0207426_100068221 172
914 3300025303 Ga0209051_1000118 Ga0209051_100011811 172
915 3300025303 Ga0209051_1001039 Ga0209051_100103915 172
916 3300025303 Ga0209051_1004006 Ga0209051_10040064 172
917 3300025303 Ga0209051_1013083 Ga0209051_10130832 172
918 3300025303 Ga0209051_1020276 Ga0209051_10202762 172
919 3300025303 Ga0209051_1035925 Ga0209051_10359252 172
920 3300025303 Ga0209051_1038917 Ga0209051_10389172 172
921 3300025303 Ga0209051_1068194 Ga0209051_10681942 172
922 3300025303 Ga0209051_1097889 Ga0209051_10978892 172
923 3300025304 Ga0209257_1002918 Ga0209257_10029186 172
924 3300025304 Ga0209257_1015028 Ga0209257_10150284 172
925 3300025711 Ga0207696_1064860 Ga0207696_10648602 172
926 3300025903 Ga0207680_10288585 Ga0207680_102885852 172
927 3300025913 Ga0207695_10000234 Ga0207695_1000023480 172
928 3300025914 Ga0207671_10000234 Ga0207671_1000023414 172
929 3300025923 Ga0207681_10185646 Ga0207681_101856462 172
930 3300025923 Ga0207681_10203140 Ga0207681_102031402 172
931 3300025931 Ga0207644_10234101 Ga0207644_102341012 172
932 3300025935 Ga0207709_10104110 Ga0207709_101041101 172
933 3300025941 Ga0207711_10113940 Ga0207711_101139401 172
934 3300025961 Ga0207712_10124029 Ga0207712_101240292 172
935 3300025972 Ga0207668_10188689 Ga0207668_101886892 172
936 3300025972 Ga0207668_10336706 Ga0207668_103367062 172
937 3300025986 Ga0207658_10104730 Ga0207658_101047302 172
938 3300026067 Ga0207678_10066768 Ga0207678_100667682 172
939 3300026088 Ga0207641_10799612 Ga0207641_107996122 172
940 3300027111 Ga0209281_1000030 Ga0209281_100003069 172
941 3300027111 Ga0209281_1000144 Ga0209281_100014429 172
942 3300027312 Ga0209371_1000037 Ga0209371_1000037277 172
943 3300027312 Ga0209371_1001411 Ga0209371_100141111 172
944 3300027312 Ga0209371_1010567 Ga0209371_10105673 172
945 3300027666 Ga0209282_1000004 Ga0209282_100000469 172
946 3300027666 Ga0209282_1000695 Ga0209282_10006958 172
947 3300027666 Ga0209282_1047735 Ga0209282_10477352 172
948 3300027866 Ga0209813_10010477 Ga0209813_100104773 172
949 3300028379 Ga0268266_10007709 Ga0268266_1000770911 172
950 3300028379 Ga0268266_10017319 Ga0268266_100173193 172
951 3300028379 Ga0268266_10156974 Ga0268266_101569742 172
952 3300028794 Ga0307515_10001099 Ga0307515_1000109920 172
953 3300028794 Ga0307515_10012908 Ga0307515_1001290811 172
954 3300030500 Ga0268256_1000039 Ga0268256_100003931 172
955 3300030500 Ga0268256_1001490 Ga0268256_100149015 172
956 3300030500 Ga0268256_1007557 Ga0268256_10075574 172
957 3300030744 Ga0316181_1259233 Ga0316181_12592332 172
958 3300031456 Ga0307513_10000998 Ga0307513_1000099842 172
959 3300031456 Ga0307513_10019403 Ga0307513_100194033 172
960 3300031548 Ga0307408_100136476 Ga0307408_1001364763 172
961 3300031548 Ga0307408_100807009 Ga0307408_1008070091 172
962 3300031731 Ga0307405_10040495 Ga0307405_100404953 172
963 3300031824 Ga0307413_10581902 Ga0307413_105819022 172
964 3300031852 Ga0307410_10218673 Ga0307410_102186732 172
965 3300031901 Ga0307406_10004352 Ga0307406_100043523 172
966 3300031901 Ga0307406_10224162 Ga0307406_102241622 172
967 3300031911 Ga0307412_10000412 Ga0307412_1000041216 172
968 3300031911 Ga0307412_10070358 Ga0307412_100703583 172
969 3300031911 Ga0307412_10079765 Ga0307412_100797653 172
970 3300031967 Ga0315914_1000001 Ga0315914_1000001313 172
971 3300031995 Ga0307409_100016139 Ga0307409_1000161394 172
972 3300031995 Ga0307409_100091099 Ga0307409_1000910991 172
973 3300032002 Ga0307416_100240160 Ga0307416_1002401602 172
974 3300033430 Ga0315913_1000022 Ga0315913_100002215 172
975 3300033464 Ga0315915_1000002 Ga0315915_100000270 172
976 3300041404 Ga0439436_0002644 Ga0439436_0002644_1152_1751 172
977 3300041404 Ga0439436_0021616 Ga0439436_0021616_518_1117 172
978 3300041405 Ga0439438_016026 Ga0439438_016026_1078_1677 172
979 3300041406 Ga0439439_0057980 Ga0439439_0057980_16_615 172
980 3300041410 Ga0439461_0013902 Ga0439461_0013902_286_885 172
981 3300041413 Ga0439465_0008572 Ga0439465_0008572_2067_2666 172
982 3300041413 Ga0439465_0019020 Ga0439465_0019020_890_1489 172
983 3300041413 Ga0439465_0019581 Ga0439465_0019581_1331_1930 172
984 3300041413 Ga0439465_0028834 Ga0439465_0028834_710_1309 172
985 3300041413 Ga0439465_0058711 Ga0439465_0058711_559_1158 172
986 3300041413 Ga0439465_0090118 Ga0439465_0090118_115_714 172
987 3300041451 Ga0451791_1030467 Ga0451791_1030467_401_1000 172
988 3300041458 Ga0451798_0608749 Ga0451798_0608749_1841_2440 172
989 3300041491 Ga0451833_0105464 Ga0451833_0105464_814_1413 172
990 3300041491 Ga0451833_0360030 Ga0451833_0360030_514_1113 172
991 3300041492 Ga0451835_0417831 Ga0451835_0417831_541_1140 172
992 3300041492 Ga0451835_0867006 Ga0451835_0867006_1026_1625 172
993 3300041492 Ga0451835_1096416 Ga0451835_1096416_301_900 172
994 3300041494 Ga0451837_0030893 Ga0451837_0030893_406_1005 172
995 3300041494 Ga0451837_0864410 Ga0451837_0864410_572_1171 172
996 3300041496 Ga0451839_0137856 Ga0451839_0137856_618_1217 172
997 3300041498 Ga0451841_0492521 Ga0451841_0492521_184_783 172
998 3300041498 Ga0451841_0908703 Ga0451841_0908703_652_1251 172
999 3300041501 Ga0451845_0191239 Ga0451845_0191239_334_933 172
1000 3300041501 Ga0451845_0378247 Ga0451845_0378247_515_1114 172
1001 3300041503 Ga0451847_0566208 Ga0451847_0566208_2473_3072 172
1002 3300041503 Ga0451847_0712631 Ga0451847_0712631_119_718 172
1003 3300041505 Ga0451849_0107853 Ga0451849_0107853_261_860 172
1004 3300041505 Ga0451849_0371279 Ga0451849_0371279_981_1580 172
1005 3300041507 Ga0451851_0266839 Ga0451851_0266839_700_1299 172
1006 3300041507 Ga0451851_0801872 Ga0451851_0801872_118_717 172
1007 3300041509 Ga0451843_0016801 Ga0451843_0016801_464_1063 172
1008 3300041509 Ga0451843_1111865 Ga0451843_1111865_176_775 172
1009 3300041511 Ga0451855_0116657 Ga0451855_0116657_2348_2947 172
1010 3300041512 Ga0451853_0435427 Ga0451853_0435427_940_1539 172
1011 3300041512 Ga0451853_1706919 Ga0451853_1706919_353_952 172
1012 3300041512 Ga0451853_2867064 Ga0451853_2867064_255_854 172
1013 3300041997 Ga0439431_0050052 Ga0439431_0050052_124_723 172
1014 3300042004 Ga0439445_0015504 Ga0439445_0015504_600_1199 172
1015 3300042006 Ga0439432_067265 Ga0439432_067265_365_964 172
1016 3300042007 Ga0439449_0014225 Ga0439449_0014225_181_780 172
1017 3300042007 Ga0439449_0044100 Ga0439449_0044100_367_966 172
1018 3300042015 Ga0439462_0031766 Ga0439462_0031766_526_1125 172
1019 3300042015 Ga0439462_0046742 Ga0439462_0046742_192_791 172
1020 3300042145 Ga0450906_010148 Ga0450906_010148_1089_1688 172
1021 3300042145 Ga0450906_058020 Ga0450906_058020_55_654 172
1022 3300046453 Ga0495627_120005 Ga0495627_120005_79_678 172
1023 3300046460 Ga0495638_0099595 Ga0495638_0099595_999_1598 172
1024 3300046471 Ga0495650_0022871 Ga0495650_0022871_2282_2881 172
1025 3300046471 Ga0495650_0128404 Ga0495650_0128404_46_645 172
1026 3300046474 Ga0495605_0020885 Ga0495605_0020885_621_1220 172
1027 3300046474 Ga0495605_0021385 Ga0495605_0021385_408_1007 172
1028 3300046492 Ga0495585_0017628 Ga0495585_0017628_927_1526 172
1029 3300046492 Ga0495585_0018413 Ga0495585_0018413_2365_2964 172
1030 3300046492 Ga0495585_0020896 Ga0495585_0020896_2335_2934 172
1031 3300046500 Ga0495596_0033622 Ga0495596_0033622_730_1329 172
1032 3300046501 Ga0495607_0009351 Ga0495607_0009351_72_671 172
1033 3300046501 Ga0495607_0098099 Ga0495607_0098099_878_1477 172
1034 3300046506 Ga0495583_0009155 Ga0495583_0009155_2369_2968 172
1035 3300046507 Ga0495606_0018735 Ga0495606_0018735_273_872 172
1036 3300046507 Ga0495606_0049333 Ga0495606_0049333_694_1293 172
1037 3300046507 Ga0495606_0087634 Ga0495606_0087634_1030_1629 172
1038 3300046507 Ga0495606_0428377 Ga0495606_0428377_11_610 172
1039 3300046512 Ga0495610_0023670 Ga0495610_0023670_1665_2264 172
1040 3300046512 Ga0495610_0057323 Ga0495610_0057323_930_1529 172
1041 3300046515 Ga0495620_0034097 Ga0495620_0034097_780_1379 172
1042 3300046515 Ga0495620_0080771 Ga0495620_0080771_390_989 172
1043 3300046515 Ga0495620_0134376 Ga0495620_0134376_207_806 172
1044 3300046518 Ga0495631_0036130 Ga0495631_0036130_1114_1713 172
1045 3300046519 Ga0495632_0012878 Ga0495632_0012878_2406_3005 172
1046 3300046522 Ga0495643_0326937 Ga0495643_0326937_57_656 172
1047 3300046523 Ga0495644_0075191 Ga0495644_0075191_528_1127 172
1048 3300046524 Ga0495648_0095240 Ga0495648_0095240_957_1556 172
1049 3300046524 Ga0495648_0122881 Ga0495648_0122881_233_832 172
1050 3300046530 Ga0495654_0042120 Ga0495654_0042120_211_810 172
1051 3300046538 Ga0495609_0108052 Ga0495609_0108052_284_883 172
1052 3300046542 Ga0495597_0043959 Ga0495597_0043959_431_1030 172
1053 3300046558 Ga0495633_0023680 Ga0495633_0023680_219_818 172
1054 3300046558 Ga0495633_0030340 Ga0495633_0030340_1942_2541 172
1055 3300046558 Ga0495633_0129766 Ga0495633_0129766_219_818 172
1056 3300046615 Ga0495656_0010068 Ga0495656_0010068_1195_1794 172
1057 3300046616 Ga0495668_0055795 Ga0495668_0055795_716_1315 172
1058 3300046616 Ga0495668_0190496 Ga0495668_0190496_93_692 172
1059 3300046616 Ga0495668_0230887 Ga0495668_0230887_320_919 172
1060 3300046660 Ga0495625_0110161 Ga0495625_0110161_876_1475 172
1061 3300046660 Ga0495625_0157467 Ga0495625_0157467_535_1134 172
1062 3300046660 Ga0495625_0301237 Ga0495625_0301237_282_881 172
1063 3300046665 Ga0495661_0075172 Ga0495661_0075172_904_1503 172
1064 3300046665 Ga0495661_0120628 Ga0495661_0120628_13_612 172
1065 3300046674 Ga0495588_0022965 Ga0495588_0022965_1626_2225 172
1066 3300046674 Ga0495588_0143506 Ga0495588_0143506_390_989 172
1067 3300046692 Ga0495671_0044759 Ga0495671_0044759_1259_1858 172
1068 3300046694 Ga0495649_0019639 Ga0495649_0019639_2041_2640 172
1069 3300046694 Ga0495649_0226185 Ga0495649_0226185_278_877 172
1070 3300046810 Ga0495660_0181491 Ga0495660_0181491_117_716 172
1071 3300047323 Ga0495683_0085475 Ga0495683_0085475_547_1146 172
1072 3300047443 Ga0495687_021278 Ga0495687_021278_451_1050 172
1073 3300047470 Ga0495681_0035361 Ga0495681_0035361_959_1558 172
1074 3300047470 Ga0495681_0040126 Ga0495681_0040126_1374_1973 172
1075 3300047470 Ga0495681_0185116 Ga0495681_0185116_125_724 172
1076 3300047472 Ga0495686_0022887 Ga0495686_0022887_2856_3455 172
1077 3300047472 Ga0495686_0412445 Ga0495686_0412445_53_652 172
1078 3300048090 Ga0495615_0013503 Ga0495615_0013503_183_782 172
1079 3300048091 Ga0495626_0054217 Ga0495626_0054217_675_1274 172
1080 3300048903 Ga0496100_0104274 Ga0496100_0104274_596_1195 172
1081 3300048904 Ga0496101_0126148 Ga0496101_0126148_110_709 172
1082 3300048905 Ga0496102_0006022 Ga0496102_0006022_4352_4951 172
1083 3300048905 Ga0496102_0051109 Ga0496102_0051109_1655_2254 172
1084 3300048906 Ga0496103_0005771 Ga0496103_0005771_5701_6300 172
1085 3300048906 Ga0496103_0032901 Ga0496103_0032901_1382_1981 172
1086 3300048907 Ga0496104_0047950 Ga0496104_0047950_2181_2780 172
1087 3300048908 Ga0496105_0022420 Ga0496105_0022420_1447_2046 172
1088 3300048909 Ga0496106_0001205 Ga0496106_0001205_2780_3379 172
1089 3300048909 Ga0496106_0140366 Ga0496106_0140366_48_647 172
1090 3300048910 Ga0496107_0036741 Ga0496107_0036741_1423_2022 172
1091 3300048910 Ga0496107_0051360 Ga0496107_0051360_1285_1884 172
1092 3300048911 Ga0496108_0177714 Ga0496108_0177714_905_1504 172
1093 3300048913 Ga0496110_0026155 Ga0496110_0026155_1300_1899 172
1094 3300048914 Ga0496111_0077063 Ga0496111_0077063_1755_2354 172
1095 3300048916 Ga0496113_0024324 Ga0496113_0024324_3246_3845 172
1096 3300048916 Ga0496113_0062902 Ga0496113_0062902_2193_2792 172
1097 3300048916 Ga0496113_0102738 Ga0496113_0102738_29_628 172
1098 3300048919 Ga0496116_0000057 Ga0496116_0000057_56013_56612 172
1099 3300048919 Ga0496116_0163627 Ga0496116_0163627_419_1018 172
1100 3300048919 Ga0496116_0199445 Ga0496116_0199445_143_742 172
1101 3300048920 Ga0496117_0000031 Ga0496117_0000031_325196_325795 172
1102 3300048920 Ga0496117_0006996 Ga0496117_0006996_7073_7672 172
1103 3300048920 Ga0496117_0010245 Ga0496117_0010245_3011_3610 172
1104 3300048920 Ga0496117_0011322 Ga0496117_0011322_7216_7815 172
1105 3300048920 Ga0496117_0013741 Ga0496117_0013741_4181_4780 172
1106 3300048920 Ga0496117_0211283 Ga0496117_0211283_45_644 172
1107 3300048920 Ga0496117_0229932 Ga0496117_0229932_110_709 172
1108 3300048921 Ga0496118_0000208 Ga0496118_0000208_69597_70196 172
1109 3300048921 Ga0496118_0082495 Ga0496118_0082495_375_974 172
1110 3300048921 Ga0496118_0090333 Ga0496118_0090333_1349_1948 172
1111 3300048922 Ga0496119_0015539 Ga0496119_0015539_2163_2762 172
1112 3300048922 Ga0496119_0018993 Ga0496119_0018993_2630_3229 172
1113 3300048922 Ga0496119_0023565 Ga0496119_0023565_1670_2269 172
1114 3300048922 Ga0496119_0069940 Ga0496119_0069940_95_694 172
1115 3300048922 Ga0496119_0304751 Ga0496119_0304751_46_645 172
1116 3300048923 Ga0496120_0000387 Ga0496120_0000387_48039_48638 172
1117 3300048923 Ga0496120_0008826 Ga0496120_0008826_2549_3148 172
1118 3300048924 Ga0496121_0000034 Ga0496121_0000034_57900_58499 172
1119 3300048924 Ga0496121_0038317 Ga0496121_0038317_94_693 172
1120 3300048924 Ga0496121_0065145 Ga0496121_0065145_1409_2008 172
1121 3300048924 Ga0496121_0100435 Ga0496121_0100435_1062_1661 172
1122 3300048924 Ga0496121_0172915 Ga0496121_0172915_114_713 172
1123 3300048925 Ga0496122_0000023 Ga0496122_0000023_325184_325783 172
1124 3300048925 Ga0496122_0000308 Ga0496122_0000308_65391_65990 172
1125 3300048925 Ga0496122_0015251 Ga0496122_0015251_2404_3003 172
1126 3300048925 Ga0496122_0058019 Ga0496122_0058019_271_870 172
1127 3300048925 Ga0496122_0067660 Ga0496122_0067660_526_1125 172
1128 3300048925 Ga0496122_0103079 Ga0496122_0103079_95_694 172
1129 3300048925 Ga0496122_0272400 Ga0496122_0272400_194_793 172
1130 3300048926 Ga0496123_0000027 Ga0496123_0000027_55253_55852 172
1131 3300048926 Ga0496123_0000066 Ga0496123_0000066_65158_65757 172
1132 3300048926 Ga0496123_0005944 Ga0496123_0005944_10975_11574 172
1133 3300048926 Ga0496123_0038852 Ga0496123_0038852_1431_2030 172
1134 3300048926 Ga0496123_0051313 Ga0496123_0051313_1035_1634 172
1135 3300048926 Ga0496123_0077281 Ga0496123_0077281_860_1459 172
1136 3300048926 Ga0496123_0095838 Ga0496123_0095838_794_1393 172
1137 3300048926 Ga0496123_0135265 Ga0496123_0135265_474_1073 172
1138 3300048927 Ga0496124_0018926 Ga0496124_0018926_2400_2999 172
1139 3300048927 Ga0496124_0134174 Ga0496124_0134174_1302_1901 172
1140 3300048927 Ga0496124_0275512 Ga0496124_0275512_339_938 172
1141 3300048927 Ga0496124_0299037 Ga0496124_0299037_226_825 172
1142 3300048927 Ga0496124_0583804 Ga0496124_0583804_66_665 172
1143 3300048928 Ga0496125_0000030 Ga0496125_0000030_316440_317039 172
1144 3300048928 Ga0496125_0000288 Ga0496125_0000288_76897_77496 172
1145 3300048928 Ga0496125_0005090 Ga0496125_0005090_551_1150 172
1146 3300048928 Ga0496125_0028379 Ga0496125_0028379_2336_2935 172
1147 3300048928 Ga0496125_0064201 Ga0496125_0064201_136_735 172
1148 3300048928 Ga0496125_0089748 Ga0496125_0089748_441_1040 172
1149 3300048928 Ga0496125_0192797 Ga0496125_0192797_133_732 172
1150 3300048928 Ga0496125_0212927 Ga0496125_0212927_436_1035 172
1151 3300048929 Ga0496126_0000115 Ga0496126_0000115_56097_56696 172
1152 3300048929 Ga0496126_0000258 Ga0496126_0000258_64387_64986 172
1153 3300048929 Ga0496126_0024648 Ga0496126_0024648_3133_3732 172
1154 3300048929 Ga0496126_0027664 Ga0496126_0027664_184_795 172
1155 3300048929 Ga0496126_0070762 Ga0496126_0070762_1821_2420 172
1156 3300048929 Ga0496126_0099049 Ga0496126_0099049_1028_1627 172
1157 3300048929 Ga0496126_0391213 Ga0496126_0391213_102_701 172
1158 3300048929 Ga0496126_0586851 Ga0496126_0586851_102_701 172
1159 3300049459 Ga0495678_040938 Ga0495678_040938_163_762 172
1160 3300049460 Ga0495682_0151204 Ga0495682_0151204_99_698 172
1161 3300049568 Ga0501031_0087362 Ga0501031_0087362_737_1348 172
1162 3300049571 Ga0501034_0026220 Ga0501034_0026220_3710_4309 172
1163 3300049571 Ga0501034_0573887 Ga0501034_0573887_228_839 172
1164 3300049574 Ga0501038_0111837 Ga0501038_0111837_559_1170 172
1165 3300049579 Ga0501043_0072981 Ga0501043_0072981_1771_2382 172
1166 3300049584 Ga0501068_0352923 Ga0501068_0352923_24_623 172
1167 3300049589 Ga0501073_0132213 Ga0501073_0132213_854_1453 172
1168 3300049744 Ga0501083_0034342 Ga0501083_0034342_1196_1795 172
1169 3300049776 Ga0501280_000684 Ga0501280_000684_6702_7301 172
1170 3300050489 nmdc:mga03683_64094_c1 nmdc:mga03683_64094_c1_381_980 172
1171 3300050490 nmdc:mga03n38_366798_c1 nmdc:mga03n38_366798_c1_25_624 172
1172 3300050491 nmdc:mga00v17_141160_c1 nmdc:mga00v17_141160_c1_284_883 172
1173 3300050491 nmdc:mga00v17_15_c1 nmdc:mga00v17_15_c1_73267_73866 172
1174 3300050491 nmdc:mga00v17_55968_c1 nmdc:mga00v17_55968_c1_1768_2367 172
1175 3300050492 nmdc:mga0yw44_27717_c1 nmdc:mga0yw44_27717_c1_972_1571 172
1176 3300050492 nmdc:mga0yw44_61109_c1 nmdc:mga0yw44_61109_c1_425_1024 172
1177 3300050493 nmdc:mga0k408_110158_c1 nmdc:mga0k408_110158_c1_25_624 172
1178 3300050493 nmdc:mga0k408_6544_c1 nmdc:mga0k408_6544_c1_402_1001 172
1179 3300050494 nmdc:mga06z11_104594_c1 nmdc:mga06z11_104594_c1_681_1280 172
1180 3300050494 nmdc:mga06z11_11797_c1 nmdc:mga06z11_11797_c1_2272_2871 172
1181 3300050494 nmdc:mga06z11_79268_c1 nmdc:mga06z11_79268_c1_838_1437 172
1182 3300050495 nmdc:mga04h51_101109_c1 nmdc:mga04h51_101109_c1_81_680 172
1183 3300050495 nmdc:mga04h51_5669_c1 nmdc:mga04h51_5669_c1_2337_2936 172
1184 3300050496 nmdc:mga07m45_107257_c2 nmdc:mga07m45_107257_c2_118_717 172
1185 3300050496 nmdc:mga07m45_53477_c1 nmdc:mga07m45_53477_c1_1520_2119 172
1186 3300050516 nmdc:mga0sz30_155606_c1 nmdc:mga0sz30_155606_c1_268_867 172
1187 3300050516 nmdc:mga0sz30_2785_c1 nmdc:mga0sz30_2785_c1_4684_5283 172
1188 3300050516 nmdc:mga0sz30_37813_c1 nmdc:mga0sz30_37813_c1_1240_1839 172
1189 3300050516 nmdc:mga0sz30_735_c1 nmdc:mga0sz30_735_c1_8356_8955 172
1190 3300053093 Ga0500651_0026274 Ga0500651_0026274_1787_2386 172
1191 3300053107 Ga0500560_025638 Ga0500560_025638_476_1075 172
1192 3300053109 Ga0500569_001882 Ga0500569_001882_1881_2480 172
1193 3300053125 Ga0500618_010829 Ga0500618_010829_1540_2139 172
1194 3300053125 Ga0500618_057121 Ga0500618_057121_140_739 172
1195 3300053129 Ga0500628_053207 Ga0500628_053207_264_863 172
1196 3300053134 Ga0500658_0001061 Ga0500658_0001061_5377_5976 172
1197 3300053134 Ga0500658_0008567 Ga0500658_0008567_1195_1794 172
1198 3300053135 Ga0500659_0069908 Ga0500659_0069908_878_1477 172
1199 3300053137 Ga0500561_0000223 Ga0500561_0000223_781_1380 172
1200 3300053139 Ga0500568_0005405 Ga0500568_0005405_3551_4150 172
1201 3300053139 Ga0500568_0037466 Ga0500568_0037466_992_1591 172
1202 3300053142 Ga0500577_0310032 Ga0500577_0310032_41_640 172
1203 3300053151 Ga0500604_0001019 Ga0500604_0001019_1213_1812 172
1204 3300053151 Ga0500604_0009464 Ga0500604_0009464_1341_1940 172
1205 3300053153 Ga0500616_0033586 Ga0500616_0033586_951_1550 172
1206 3300053157 Ga0500624_000633 Ga0500624_000633_6234_6833 172
1207 3300053158 Ga0500627_0013773 Ga0500627_0013773_1395_1994 172
1208 3300053160 Ga0500633_0000081 Ga0500633_0000081_13410_14009 172
1209 3300059643 Ga0587072_007015 Ga0587072_007015_266_865 172
1210 iso_pu_bacteria 2989771324 2989771767 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02545

Maf

Maf-like protein

1

199

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lu1-assembly1.cif.gz_A crystal structure of the uncharacterized maf protein ycef from e. coli, mutant d69a 0.8989 5 170
4jhc-assembly1.cif.gz_A crystal structure of the uncharacterized maf protein ycef from e. coli 0.8975 4 170
4heb-assembly1.cif.gz_A the crystal structure of maf protein of bacillus subtilis 0.8878 4 170
4heb-assembly1.cif.gz_B the crystal structure of maf protein of bacillus subtilis 0.8775 4 170
1exc-assembly1.cif.gz_A crystal structure of b. subtilis maf protein complexed with d-(utp) 0.8744 1 170
ID Description Score Start End Superfamily
4p0uA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9019 5 170 3.90.950.10
4hebA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8878 4 170 3.90.950.10
3u6gB00 Mainly Beta;Sandwich;Lipoxygenase-1; 0.8504 107 130 2.60.60.60
4lu1B00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8476 5 170 3.90.950.10
af_O14141_27_232_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.843 2 171 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A528LHS3-F1-model_v4 Septum formation inhibitor Maf 0.9664 87 170 GO:0009117
GO:0047429
AF-A0A434SAP5-F1-model_v4 Septum formation inhibitor Maf 0.9527 1 131 GO:0009117
GO:0047429
AF-A0A352KCX7-F1-model_v4 Septum formation protein Maf 0.9492 4 116 GO:0009117
GO:0047429
AF-A0A2E0BM59-F1-model_v4 Septum formation inhibitor Maf 0.9427 91 170 GO:0009117
GO:0047429
AF-A0A434SAP5-F1-model_v4 Septum formation inhibitor Maf 0.9388 1 131 GO:0009117
GO:0047429

Feature Viewer

pLDDT pTM Quality
91.45 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map