F491724
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1210 | 836 | 651 | 195 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2599185156|2599335741 |
| Length | 204 |
| Sequence | LVLASASPFRRMLLQNAGIAFTWQVAEIDERALEAPLAAEGASPERVATVLAQAKAEAVAAALREAQGEAGGTGPVVIGSDQTMSLGDRVFHKPASMEEAHEHLRALSGRTHRLNSAIALHQDSRTLWSHVSTARLKMRSLGDAFIARHLERVGEKALTSVGAYQLEGEGIQLFEAIEGDYFTILGLPLLPLLSELRRLSVIDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 4 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 5 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 6 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 7 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 8 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 9 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 10 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 11 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 12 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 13 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 14 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 15 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 16 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 17 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 18 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 19 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 20 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 21 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 22 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 23 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 24 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 25 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 26 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 27 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 28 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 29 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 30 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 31 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 32 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 33 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 34 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 35 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 36 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 37 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 38 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 39 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 40 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 41 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 42 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 43 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 44 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 45 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 46 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 47 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 48 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 49 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 50 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 51 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 52 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 53 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 54 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 55 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 56 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 57 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 58 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 59 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 60 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 61 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 62 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 63 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 64 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 65 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 66 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 67 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 68 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 69 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 70 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 71 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 72 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 73 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 74 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 75 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 76 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 77 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 78 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 79 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 80 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 81 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 82 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 83 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 84 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 85 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 86 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 87 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 88 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 89 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 90 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 91 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 92 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 93 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 94 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 95 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 96 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 97 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 98 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 99 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 100 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 101 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 102 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 103 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 104 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 105 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 106 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 107 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 108 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 109 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 110 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 111 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 112 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 113 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 114 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 115 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 116 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 117 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 118 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 119 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 120 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 121 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 122 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 123 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 124 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 125 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 126 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 127 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 128 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 129 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 130 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 131 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 132 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 133 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 134 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 135 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 136 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 137 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 138 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 139 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 140 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 141 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 142 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 143 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 144 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 145 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 146 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 147 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 148 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 149 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 150 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 151 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 152 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 153 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 154 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 155 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 156 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 157 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 158 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 159 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 160 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 161 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 162 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 163 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 164 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 165 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 166 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 167 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 168 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 169 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 170 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 171 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 172 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 173 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 174 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 175 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 176 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 177 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 178 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 179 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 180 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 181 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 182 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 183 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 184 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 185 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 186 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 187 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 188 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 189 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 190 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 191 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 192 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 193 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 194 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 195 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 196 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 197 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 198 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 199 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 200 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 201 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 202 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 203 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 204 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 205 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 206 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 207 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 208 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 209 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 210 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 211 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 212 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 213 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 214 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 215 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 216 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 217 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 218 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 219 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 220 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 221 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 222 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 223 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 224 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 225 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 226 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 227 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 228 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 229 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 230 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 231 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 232 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 233 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 234 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 235 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 236 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 237 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 238 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 239 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 240 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 241 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 242 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 243 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 244 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 245 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 246 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 247 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 248 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 249 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 250 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 251 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 252 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 253 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 254 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 255 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 256 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 257 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 258 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 259 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 260 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 261 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 262 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 263 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 264 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 265 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 266 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 267 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 268 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 269 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 270 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 271 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 272 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 273 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 274 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 275 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 276 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 277 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 278 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 279 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 280 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 281 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 282 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 283 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 284 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 285 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 286 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 287 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 288 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 289 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 290 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 291 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 292 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 293 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 294 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 295 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 296 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 297 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 298 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 299 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 300 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 301 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 302 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 303 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 304 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 305 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 306 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 307 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 308 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 309 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 310 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 311 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 312 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 313 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 314 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 315 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 316 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 317 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 318 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 319 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 320 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 321 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 322 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 323 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 324 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 325 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 326 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 327 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 328 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 329 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 330 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 331 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 332 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 333 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 334 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 335 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 336 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 337 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 338 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 339 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 340 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 341 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 342 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 343 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 344 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 345 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 346 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 347 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 348 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 349 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 350 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 351 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 352 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 353 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 354 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 355 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 356 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 357 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 358 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 359 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 360 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 361 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 362 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 363 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 364 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 365 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 366 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 367 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 368 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 369 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 370 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 371 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 372 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 373 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 374 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 375 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 376 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 377 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 378 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 379 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 380 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 381 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 382 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 383 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 384 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 385 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 386 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 387 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 388 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 389 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 390 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 391 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 392 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 393 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 394 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 395 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 396 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 397 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 398 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 399 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 400 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 401 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 402 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 403 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 404 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 405 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 406 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 407 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 408 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 409 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 410 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 411 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 412 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 413 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 414 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 415 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 416 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 417 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 418 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 419 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 420 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 421 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 422 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 423 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 424 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 425 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 426 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 427 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 428 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 429 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 430 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 431 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 432 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 433 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 434 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 435 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 436 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 437 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 438 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 439 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 440 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 441 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 442 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 443 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 444 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 445 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 446 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 447 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 448 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 449 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 450 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 451 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 452 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 453 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 454 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 455 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 456 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 457 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 458 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 459 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 460 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 461 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 462 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 463 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 464 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 465 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 466 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 467 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 468 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 469 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 470 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 471 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 472 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 473 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 474 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 475 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 476 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 477 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 478 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 479 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 480 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 481 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 482 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 483 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 484 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 485 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 486 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 487 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 488 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 489 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 490 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 491 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 492 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 493 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 494 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 495 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 496 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 497 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 498 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 499 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 500 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 501 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 502 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 503 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 504 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 505 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 506 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 507 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 508 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 509 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 510 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 511 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 512 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 513 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 514 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 515 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 516 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 517 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 518 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 519 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 520 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 521 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 522 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 523 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 524 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 525 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 526 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 527 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 528 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 529 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 530 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 531 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 532 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 533 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 534 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 535 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 536 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 537 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 538 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 539 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 540 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 541 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 542 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 543 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 544 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 545 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 546 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 547 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 548 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 549 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 550 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 551 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 552 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 553 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 554 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 555 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 556 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 557 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 558 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 559 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 560 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 561 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 562 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 563 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 564 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 565 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 566 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 567 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 568 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 569 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 570 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 571 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 572 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 573 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 574 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 575 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 576 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 577 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 578 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 579 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 580 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 581 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 582 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 583 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 584 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 585 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 586 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 587 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 588 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 589 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 590 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 591 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 592 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 593 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 594 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 595 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 596 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 597 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 598 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 599 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 600 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 601 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 602 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 603 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 604 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 605 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 606 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 607 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 608 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 609 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 610 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 611 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 612 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 613 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 614 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 615 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 616 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 617 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 618 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 619 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 620 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 621 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 622 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 623 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 624 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 625 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 626 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 627 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 628 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 629 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 630 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 631 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 632 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 633 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 634 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 635 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 636 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 637 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 638 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 639 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 640 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 641 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 642 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 643 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 644 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 645 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 646 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 647 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 648 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 649 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 650 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 651 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 652 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 653 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 654 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 655 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 656 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 657 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 658 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 659 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 660 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 661 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 662 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 663 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 664 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 665 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 666 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 667 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 668 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 669 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 670 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 671 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 672 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 673 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 674 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 675 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 676 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 677 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 678 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 679 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 680 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 681 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 682 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 683 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 684 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 685 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 686 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 687 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 688 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 689 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 690 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 691 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 692 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 693 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 694 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 695 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 696 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 697 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 698 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 699 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 700 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 701 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 702 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 703 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 704 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 705 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 706 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 707 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 708 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 709 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 710 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 711 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 712 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 713 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 714 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 715 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 716 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 717 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 718 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 719 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 720 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 721 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 722 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 723 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 724 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 725 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 726 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 727 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 728 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 729 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 730 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 731 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 732 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 733 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 734 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 735 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 736 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 737 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 738 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 739 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 740 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 741 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 742 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 743 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 744 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 745 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 746 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 747 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 748 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 749 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 750 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 751 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 752 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 753 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 754 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 755 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 756 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 757 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 758 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 759 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 760 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 761 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 762 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 763 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 764 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 765 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 766 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 767 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 768 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 769 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 770 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 771 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 772 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 773 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 774 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 775 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 776 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 777 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 778 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 779 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 780 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 781 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 782 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 783 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 784 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 785 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 786 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 787 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 788 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 789 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 790 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 791 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 792 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 793 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 794 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 795 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 796 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 797 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 798 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 799 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 800 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 801 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 802 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 803 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 804 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 805 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 806 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 807 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 808 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 809 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 810 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 811 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 812 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 813 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 814 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 815 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 816 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 817 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 818 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 819 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 820 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 821 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 822 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 823 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 824 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 825 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 826 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 827 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 828 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 829 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 830 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 831 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 832 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 833 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 834 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 835 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 836 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 53.72 |
| Metatranscriptomes | 0.08 |
| Isolates | 46.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.41 |
| Bulb | 0 |
| Endosphere | 19.59 |
| Nodule | 36.45 |
| Rhizoplane | 2.48 |
| Rhizosphere | 21.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 19.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_FSXC55064_g1 | 2010549000 | Bacteria | 833 |
| 2 | JGI24740J21852_10026035 | 3300001979 | Bacteria | 1964 |
| 3 | JGI24739J22299_10081966 | 3300001989 | Bacteria | 990 |
| 4 | JGI25156J39149_1000055 | 3300002705 | Bacteria | 87733 |
| 5 | JGI25162J39368_1000601 | 3300002737 | Bacteria | 25918 |
| 6 | JGI25162J39368_1000903 | 3300002737 | Bacteria | 19226 |
| 7 | JGI25154J39366_1000069 | 3300002738 | Bacteria | 96438 |
| 8 | JGI25157J39369_1000076 | 3300002741 | Bacteria | 87678 |
| 9 | JGI25152J39213_1000820 | 3300002773 | Bacteria | 15512 |
| 10 | JGI25152J39213_1004374 | 3300002773 | Bacteria | 4468 |
| 11 | JGI25152J39213_1005150 | 3300002773 | Bacteria | 3913 |
| 12 | JGI25152J39213_1005217 | 3300002773 | Bacteria | 3867 |
| 13 | JGI25152J39213_1007563 | 3300002773 | Bacteria | 2797 |
| 14 | JGI25150J39212_1002566 | 3300002774 | Bacteria | 4466 |
| 15 | JGI25159J45721_1000022 | 3300002987 | Bacteria | 119463 |
| 16 | JGI25151J46595_10015738 | 3300003187 | Bacteria | 3322 |
| 17 | JGI25151J46595_10018505 | 3300003187 | Bacteria | 2988 |
| 18 | JGI25151J46595_10027614 | 3300003187 | Bacteria | 2272 |
| 19 | JGI25165J46597_1000974 | 3300003214 | Bacteria | 19236 |
| 20 | JGI25165J46597_1001602 | 3300003214 | Bacteria | 10851 |
| 21 | JGI25153J46596_10005551 | 3300003215 | Bacteria | 6594 |
| 22 | JGI25153J46596_10007489 | 3300003215 | Bacteria | 5357 |
| 23 | JGI25153J46596_10008231 | 3300003215 | Bacteria | 5011 |
| 24 | JGI25153J46596_10008269 | 3300003215 | Bacteria | 4994 |
| 25 | JGI25153J46596_10018949 | 3300003215 | Bacteria | 2652 |
| 26 | JGI25153J46596_10025293 | 3300003215 | Bacteria | 2124 |
| 27 | rootH2_10005284 | 3300003320 | Bacteria | 7444 |
| 28 | rootH2_10042438 | 3300003320 | Bacteria | 1017 |
| 29 | rootL2_10134841 | 3300003322 | Bacteria | 1052 |
| 30 | rootL2_10149035 | 3300003322 | Bacteria | 3339 |
| 31 | rootH1_10039093 | 3300003323 | Bacteria | 3732 |
| 32 | rootH1_10089746 | 3300003323 | Bacteria | 4427 |
| 33 | JGI25160J50197_1000051 | 3300003354 | Bacteria | 132923 |
| 34 | JGI25160J50197_1000056 | 3300003354 | Bacteria | 119463 |
| 35 | JGI25160J50197_1018375 | 3300003354 | Bacteria | 2182 |
| 36 | JGI25160J50197_1023427 | 3300003354 | Bacteria | 1780 |
| 37 | JGI25161J50226_1000011 | 3300003374 | Bacteria | 210140 |
| 38 | JGI25161J50226_1000214 | 3300003374 | Bacteria | 36702 |
| 39 | JGI25161J50226_1000451 | 3300003374 | Bacteria | 19047 |
| 40 | Ga0055526_1001114 | 3300003771 | Bacteria | 19551 |
| 41 | Ga0055526_1005687 | 3300003771 | Bacteria | 7076 |
| 42 | Ga0055526_1008790 | 3300003771 | Bacteria | 4974 |
| 43 | Ga0055526_1017791 | 3300003771 | Bacteria | 2693 |
| 44 | Ga0055526_1022906 | 3300003771 | Bacteria | 2104 |
| 45 | Ga0055524_1000962 | 3300003775 | Bacteria | 18149 |
| 46 | Ga0055524_1001562 | 3300003775 | Bacteria | 12886 |
| 47 | Ga0055524_1005939 | 3300003775 | Bacteria | 5374 |
| 48 | Ga0055524_1020707 | 3300003775 | Bacteria | 2205 |
| 49 | Ga0055524_1025496 | 3300003775 | Bacteria | 1850 |
| 50 | Ga0055524_1030108 | 3300003775 | Bacteria | 1588 |
| 51 | Ga0055524_1037300 | 3300003775 | Bacteria | 1291 |
| 52 | Ga0055524_1054140 | 3300003775 | Bacteria | 882 |
| 53 | Ga0055524_1066820 | 3300003775 | Bacteria | 712 |
| 54 | Ga0055536_1004552 | 3300003781 | Bacteria | 7046 |
| 55 | Ga0055528_1000452 | 3300003790 | Bacteria | 32857 |
| 56 | Ga0055528_1001012 | 3300003790 | Bacteria | 18669 |
| 57 | Ga0055528_1006339 | 3300003790 | Bacteria | 5376 |
| 58 | Ga0055528_1007110 | 3300003790 | Bacteria | 4997 |
| 59 | Ga0055528_1026231 | 3300003790 | Bacteria | 1682 |
| 60 | Ga0055528_1039685 | 3300003790 | Bacteria | 1072 |
| 61 | Ga0055530_10039913 | 3300003791 | Bacteria | 1156 |
| 62 | Ga0055540_1000597 | 3300003792 | Bacteria | 26126 |
| 63 | Ga0055540_1006130 | 3300003792 | Bacteria | 4844 |
| 64 | Ga0055540_1018940 | 3300003792 | Bacteria | 1870 |
| 65 | Ga0055531_10001167 | 3300003794 | Bacteria | 20222 |
| 66 | Ga0058692_1001407 | 3300003856 | Bacteria | 8879 |
| 67 | Ga0058692_1004294 | 3300003856 | Bacteria | 4243 |
| 68 | Ga0055543_1000041 | 3300004625 | Bacteria | 118501 |
| 69 | Ga0055543_1000330 | 3300004625 | Bacteria | 32518 |
| 70 | Ga0055543_1000383 | 3300004625 | Bacteria | 28950 |
| 71 | Ga0055543_1003469 | 3300004625 | Bacteria | 4636 |
| 72 | Ga0065165_1000155 | 3300005262 | Bacteria | 119501 |
| 73 | Ga0065165_1000303 | 3300005262 | Bacteria | 82513 |
| 74 | Ga0065165_1015648 | 3300005262 | Bacteria | 2884 |
| 75 | Ga0065165_1021843 | 3300005262 | Bacteria | 2211 |
| 76 | Ga0065165_1025941 | 3300005262 | Bacteria | 1936 |
| 77 | Ga0065165_1036529 | 3300005262 | Bacteria | 1498 |
| 78 | Ga0070666_10007959 | 3300005335 | Bacteria | 6554 |
| 79 | Ga0070668_100101196 | 3300005347 | Bacteria | 2283 |
| 80 | Ga0070669_100071717 | 3300005353 | Bacteria | 2563 |
| 81 | Ga0070671_100161837 | 3300005355 | Bacteria | 1892 |
| 82 | Ga0070667_100219060 | 3300005367 | Bacteria | 1694 |
| 83 | Ga0070663_100025431 | 3300005455 | Bacteria | 3997 |
| 84 | Ga0070662_100314094 | 3300005457 | Bacteria | 1276 |
| 85 | Ga0070665_100005296 | 3300005548 | Bacteria | 13322 |
| 86 | Ga0070665_100179520 | 3300005548 | Bacteria | 2118 |
| 87 | Ga0070665_100842109 | 3300005548 | Bacteria | 930 |
| 88 | Ga0070665_101617168 | 3300005548 | Bacteria | 656 |
| 89 | Ga0068863_101282359 | 3300005841 | Bacteria | 739 |
| 90 | Ga0081455_10139034 | 3300005937 | Bacteria | 1889 |
| 91 | Ga0075365_10001383 | 3300006038 | Bacteria | 10915 |
| 92 | Ga0075365_10006283 | 3300006038 | Bacteria | 6519 |
| 93 | Ga0075368_10028925 | 3300006042 | Bacteria | 2142 |
| 94 | Ga0075363_100091936 | 3300006048 | Bacteria | 1671 |
| 95 | Ga0075364_10138669 | 3300006051 | Bacteria | 1635 |
| 96 | Ga0075362_10054231 | 3300006177 | Bacteria | 1801 |
| 97 | Ga0075362_10058519 | 3300006177 | Bacteria | 1738 |
| 98 | Ga0075367_10000616 | 3300006178 | Bacteria | 13639 |
| 99 | Ga0075367_10463416 | 3300006178 | Bacteria | 803 |
| 100 | Ga0075369_10000392 | 3300006186 | Bacteria | 13230 |
| 101 | Ga0075369_10016630 | 3300006186 | Bacteria | 2971 |
| 102 | Ga0075369_10023970 | 3300006186 | Bacteria | 2526 |
| 103 | Ga0075369_10085775 | 3300006186 | Bacteria | 1401 |
| 104 | Ga0075366_10007979 | 3300006195 | Bacteria | 5862 |
| 105 | Ga0075366_10203489 | 3300006195 | Bacteria | 1204 |
| 106 | Ga0075370_10002288 | 3300006353 | Bacteria | 8836 |
| 107 | Ga0075370_10033253 | 3300006353 | Bacteria | 2886 |
| 108 | Ga0079104_1000310 | 3300006946 | Bacteria | 61815 |
| 109 | Ga0079104_1001973 | 3300006946 | Bacteria | 12061 |
| 110 | Ga0079104_1005380 | 3300006946 | Bacteria | 5133 |
| 111 | Ga0099826_10000813 | 3300006948 | Bacteria | 16761 |
| 112 | Ga0105251_10004120 | 3300009011 | Bacteria | 10148 |
| 113 | Ga0105250_10014478 | 3300009092 | Bacteria | 3240 |
| 114 | Ga0105240_10000142 | 3300009093 | Bacteria | 146932 |
| 115 | Ga0105243_10129773 | 3300009148 | Bacteria | 2137 |
| 116 | Ga0105243_10344871 | 3300009148 | Bacteria | 1366 |
| 117 | Ga0105248_10156684 | 3300009177 | Bacteria | 2570 |
| 118 | Ga0105249_10038514 | 3300009553 | Bacteria | 4338 |
| 119 | Ga0123341_1000071 | 3300009765 | Bacteria | 43545 |
| 120 | Ga0123342_1017422 | 3300009766 | Bacteria | 5975 |
| 121 | Ga0123342_1031713 | 3300009766 | Bacteria | 2535 |
| 122 | Ga0105246_10100765 | 3300011119 | Bacteria | 2102 |
| 123 | Ga0157314_1005142 | 3300012500 | Bacteria | 985 |
| 124 | Ga0157314_1011624 | 3300012500 | Bacteria | 779 |
| 125 | Ga0157373_10013927 | 3300013100 | Bacteria | 5899 |
| 126 | Ga0157371_10000071 | 3300013102 | Bacteria | 164088 |
| 127 | Ga0157370_10000079 | 3300013104 | Bacteria | 107305 |
| 128 | Ga0157370_10002835 | 3300013104 | Bacteria | 20731 |
| 129 | Ga0157369_10092694 | 3300013105 | Bacteria | 3224 |
| 130 | Ga0157369_10105276 | 3300013105 | Bacteria | 3004 |
| 131 | Ga0157369_10411989 | 3300013105 | Bacteria | 1401 |
| 132 | Ga0171463_1004 | 3300013249 | Bacteria | 437207 |
| 133 | Ga0163162_10395178 | 3300013306 | Bacteria | 1515 |
| 134 | Ga0183363_1217 | 3300015690 | Bacteria | 11179 |
| 135 | Ga0214544_1000079 | 3300021320 | Bacteria | 121742 |
| 136 | Ga0214542_1000064 | 3300021321 | Bacteria | 127681 |
| 137 | Ga0214542_1012059 | 3300021321 | Bacteria | 11445 |
| 138 | Ga0214543_1000015 | 3300021327 | Bacteria | 305679 |
| 139 | Ga0214543_1000063 | 3300021327 | Bacteria | 127694 |
| 140 | Ga0228711_1000030 | 3300022739 | Bacteria | 94546 |
| 141 | Ga0228710_1000002 | 3300022740 | Bacteria | 287279 |
| 142 | Ga0209435_100031 | 3300025206 | Bacteria | 164115 |
| 143 | Ga0209436_100013 | 3300025208 | Bacteria | 131492 |
| 144 | Ga0209436_100428 | 3300025208 | Bacteria | 18888 |
| 145 | Ga0209437_100179 | 3300025233 | Bacteria | 134210 |
| 146 | Ga0209437_100181 | 3300025233 | Bacteria | 132953 |
| 147 | Ga0209437_105251 | 3300025233 | Bacteria | 2214 |
| 148 | Ga0207425_1001412 | 3300025245 | Bacteria | 10094 |
| 149 | Ga0207425_1005147 | 3300025245 | Bacteria | 3776 |
| 150 | Ga0207425_1030719 | 3300025245 | Bacteria | 1074 |
| 151 | Ga0209646_1000102 | 3300025246 | Bacteria | 164115 |
| 152 | Ga0209646_1004291 | 3300025246 | Bacteria | 2618 |
| 153 | Ga0209026_1000096 | 3300025250 | Bacteria | 164115 |
| 154 | Ga0209677_100353 | 3300025253 | Bacteria | 28643 |
| 155 | Ga0209759_1000090 | 3300025256 | Bacteria | 164115 |
| 156 | Ga0209129_1000029 | 3300025258 | Bacteria | 401149 |
| 157 | Ga0209129_1000050 | 3300025258 | Bacteria | 267408 |
| 158 | Ga0209129_1000289 | 3300025258 | Bacteria | 48018 |
| 159 | Ga0209129_1000826 | 3300025258 | Bacteria | 19503 |
| 160 | Ga0209129_1001114 | 3300025258 | Bacteria | 15657 |
| 161 | Ga0209129_1001662 | 3300025258 | Bacteria | 12035 |
| 162 | Ga0209129_1002660 | 3300025258 | Bacteria | 8461 |
| 163 | Ga0209129_1036815 | 3300025258 | Bacteria | 790 |
| 164 | Ga0209233_1000185 | 3300025261 | Bacteria | 133788 |
| 165 | Ga0209233_1000212 | 3300025261 | Bacteria | 110364 |
| 166 | Ga0209233_1000263 | 3300025261 | Bacteria | 79293 |
| 167 | Ga0209673_1000033 | 3300025273 | Bacteria | 335369 |
| 168 | Ga0209673_1000050 | 3300025273 | Bacteria | 285287 |
| 169 | Ga0209673_1000370 | 3300025273 | Bacteria | 81047 |
| 170 | Ga0209673_1001321 | 3300025273 | Bacteria | 24961 |
| 171 | Ga0209673_1001329 | 3300025273 | Bacteria | 24789 |
| 172 | Ga0209673_1003533 | 3300025273 | Bacteria | 9145 |
| 173 | Ga0209673_1004386 | 3300025273 | Bacteria | 7591 |
| 174 | Ga0209673_1006760 | 3300025273 | Bacteria | 5455 |
| 175 | Ga0209673_1021110 | 3300025273 | Bacteria | 2287 |
| 176 | Ga0209130_1000009 | 3300025284 | Bacteria | 498952 |
| 177 | Ga0209130_1000058 | 3300025284 | Bacteria | 210250 |
| 178 | Ga0209130_1000133 | 3300025284 | Bacteria | 119561 |
| 179 | Ga0209130_1007568 | 3300025284 | Bacteria | 3331 |
| 180 | Ga0209130_1010493 | 3300025284 | Bacteria | 2546 |
| 181 | Ga0209130_1021620 | 3300025284 | Bacteria | 1448 |
| 182 | Ga0209676_1012503 | 3300025292 | Bacteria | 3329 |
| 183 | Ga0209025_1000042 | 3300025294 | Bacteria | 370577 |
| 184 | Ga0209025_1000132 | 3300025294 | Bacteria | 197432 |
| 185 | Ga0209025_1000536 | 3300025294 | Bacteria | 71932 |
| 186 | Ga0209025_1000815 | 3300025294 | Bacteria | 50019 |
| 187 | Ga0209025_1001644 | 3300025294 | Bacteria | 27573 |
| 188 | Ga0209025_1006663 | 3300025294 | Bacteria | 8873 |
| 189 | Ga0209025_1011082 | 3300025294 | Bacteria | 6006 |
| 190 | Ga0209025_1014000 | 3300025294 | Bacteria | 4987 |
| 191 | Ga0209025_1016811 | 3300025294 | Bacteria | 4279 |
| 192 | Ga0209564_1000193 | 3300025295 | Bacteria | 141731 |
| 193 | Ga0209564_1000227 | 3300025295 | Bacteria | 125497 |
| 194 | Ga0209564_1000700 | 3300025295 | Bacteria | 49128 |
| 195 | Ga0209564_1001108 | 3300025295 | Bacteria | 31835 |
| 196 | Ga0209564_1004168 | 3300025295 | Bacteria | 9034 |
| 197 | Ga0209564_1007892 | 3300025295 | Bacteria | 5383 |
| 198 | Ga0209564_1022414 | 3300025295 | Bacteria | 2233 |
| 199 | Ga0209564_1024268 | 3300025295 | Bacteria | 2076 |
| 200 | Ga0209564_1027004 | 3300025295 | Bacteria | 1877 |
| 201 | Ga0209758_1000299 | 3300025297 | Bacteria | 97367 |
| 202 | Ga0209758_1000406 | 3300025297 | Bacteria | 73962 |
| 203 | Ga0209758_1000864 | 3300025297 | Bacteria | 41937 |
| 204 | Ga0209758_1001221 | 3300025297 | Bacteria | 32261 |
| 205 | Ga0209758_1001412 | 3300025297 | Bacteria | 28454 |
| 206 | Ga0209758_1001462 | 3300025297 | Bacteria | 27731 |
| 207 | Ga0209758_1003168 | 3300025297 | Bacteria | 15434 |
| 208 | Ga0209758_1029807 | 3300025297 | Bacteria | 2272 |
| 209 | Ga0209758_1031603 | 3300025297 | Bacteria | 2168 |
| 210 | Ga0209758_1032174 | 3300025297 | Bacteria | 2135 |
| 211 | Ga0209758_1032301 | 3300025297 | Bacteria | 2128 |
| 212 | Ga0209758_1072209 | 3300025297 | Bacteria | 1081 |
| 213 | Ga0209050_1011077 | 3300025298 | Bacteria | 4332 |
| 214 | Ga0209050_1011173 | 3300025298 | Bacteria | 4299 |
| 215 | Ga0209050_1020388 | 3300025298 | Bacteria | 2469 |
| 216 | Ga0209256_1000286 | 3300025299 | Bacteria | 88880 |
| 217 | Ga0209256_1000459 | 3300025299 | Bacteria | 61577 |
| 218 | Ga0209256_1001479 | 3300025299 | Bacteria | 24043 |
| 219 | Ga0209256_1001610 | 3300025299 | Bacteria | 22074 |
| 220 | Ga0209256_1001820 | 3300025299 | Bacteria | 19999 |
| 221 | Ga0209256_1005684 | 3300025299 | Bacteria | 7012 |
| 222 | Ga0209256_1008143 | 3300025299 | Bacteria | 4933 |
| 223 | Ga0209256_1016485 | 3300025299 | Bacteria | 2515 |
| 224 | Ga0209256_1019324 | 3300025299 | Bacteria | 2173 |
| 225 | Ga0209256_1029148 | 3300025299 | Bacteria | 1543 |
| 226 | Ga0209256_1043607 | 3300025299 | Bacteria | 1125 |
| 227 | Ga0207426_1000131 | 3300025302 | Bacteria | 210250 |
| 228 | Ga0207426_1000214 | 3300025302 | Bacteria | 137296 |
| 229 | Ga0207426_1000248 | 3300025302 | Bacteria | 119561 |
| 230 | Ga0207426_1000450 | 3300025302 | Bacteria | 65777 |
| 231 | Ga0207426_1000682 | 3300025302 | Bacteria | 40955 |
| 232 | Ga0209051_1000118 | 3300025303 | Bacteria | 149426 |
| 233 | Ga0209051_1000547 | 3300025303 | Bacteria | 45743 |
| 234 | Ga0209051_1001039 | 3300025303 | Bacteria | 26259 |
| 235 | Ga0209051_1004006 | 3300025303 | Bacteria | 9339 |
| 236 | Ga0209051_1013083 | 3300025303 | Bacteria | 3969 |
| 237 | Ga0209051_1020276 | 3300025303 | Bacteria | 2869 |
| 238 | Ga0209051_1035925 | 3300025303 | Bacteria | 1837 |
| 239 | Ga0209051_1038917 | 3300025303 | Bacteria | 1725 |
| 240 | Ga0209051_1068194 | 3300025303 | Bacteria | 1084 |
| 241 | Ga0209051_1097889 | 3300025303 | Bacteria | 797 |
| 242 | Ga0209257_1002918 | 3300025304 | Bacteria | 15767 |
| 243 | Ga0209257_1006107 | 3300025304 | Bacteria | 7995 |
| 244 | Ga0209257_1015028 | 3300025304 | Bacteria | 3262 |
| 245 | Ga0207696_1064860 | 3300025711 | Bacteria | 1022 |
| 246 | Ga0207680_10288585 | 3300025903 | Bacteria | 1141 |
| 247 | Ga0207695_10000234 | 3300025913 | Bacteria | 146987 |
| 248 | Ga0207671_10000234 | 3300025914 | Bacteria | 83448 |
| 249 | Ga0207681_10185646 | 3300025923 | Bacteria | 1587 |
| 250 | Ga0207681_10203140 | 3300025923 | Bacteria | 1523 |
| 251 | Ga0207644_10234101 | 3300025931 | Bacteria | 1460 |
| 252 | Ga0207709_10104110 | 3300025935 | Bacteria | 1883 |
| 253 | Ga0207711_10113940 | 3300025941 | Bacteria | 2408 |
| 254 | Ga0207712_10124029 | 3300025961 | Bacteria | 1959 |
| 255 | Ga0207668_10188689 | 3300025972 | Bacteria | 1632 |
| 256 | Ga0207668_10336706 | 3300025972 | Bacteria | 1257 |
| 257 | Ga0207658_10104730 | 3300025986 | Bacteria | 2224 |
| 258 | Ga0207678_10066768 | 3300026067 | Bacteria | 3088 |
| 259 | Ga0207641_10799612 | 3300026088 | Bacteria | 933 |
| 260 | Ga0209281_1000028 | 3300027111 | Bacteria | 440027 |
| 261 | Ga0209281_1000030 | 3300027111 | Bacteria | 425931 |
| 262 | Ga0209281_1000144 | 3300027111 | Bacteria | 172471 |
| 263 | Ga0209371_1000037 | 3300027312 | Bacteria | 367074 |
| 264 | Ga0209371_1001411 | 3300027312 | Bacteria | 16466 |
| 265 | Ga0209371_1010567 | 3300027312 | Bacteria | 2822 |
| 266 | Ga0209282_1000004 | 3300027666 | Bacteria | 425931 |
| 267 | Ga0209282_1000695 | 3300027666 | Bacteria | 16757 |
| 268 | Ga0209282_1047735 | 3300027666 | Bacteria | 2484 |
| 269 | Ga0209813_10010477 | 3300027866 | Bacteria | 2399 |
| 270 | Ga0268266_10007709 | 3300028379 | Bacteria | 9663 |
| 271 | Ga0268266_10017319 | 3300028379 | Bacteria | 6150 |
| 272 | Ga0268266_10019818 | 3300028379 | Bacteria | 5732 |
| 273 | Ga0268266_10156974 | 3300028379 | Bacteria | 2056 |
| 274 | Ga0268266_11277225 | 3300028379 | Bacteria | 709 |
| 275 | Ga0307515_10001099 | 3300028794 | Bacteria | 61933 |
| 276 | Ga0307515_10012908 | 3300028794 | Bacteria | 15667 |
| 277 | Ga0268256_1000039 | 3300030500 | Bacteria | 354969 |
| 278 | Ga0268256_1001490 | 3300030500 | Bacteria | 13902 |
| 279 | Ga0268256_1007557 | 3300030500 | Bacteria | 3851 |
| 280 | Ga0316181_1259233 | 3300030744 | Bacteria | 2240 |
| 281 | Ga0307513_10000998 | 3300031456 | Bacteria | 40880 |
| 282 | Ga0307513_10019403 | 3300031456 | Bacteria | 8094 |
| 283 | Ga0307408_100136476 | 3300031548 | Bacteria | 1920 |
| 284 | Ga0307408_100807009 | 3300031548 | Bacteria | 852 |
| 285 | Ga0307405_10040495 | 3300031731 | Bacteria | 2822 |
| 286 | Ga0307413_10581902 | 3300031824 | Bacteria | 913 |
| 287 | Ga0307410_10218673 | 3300031852 | Bacteria | 1464 |
| 288 | Ga0307406_10004352 | 3300031901 | Bacteria | 7707 |
| 289 | Ga0307406_10224162 | 3300031901 | Bacteria | 1399 |
| 290 | Ga0307412_10000412 | 3300031911 | Bacteria | 26116 |
| 291 | Ga0307412_10070358 | 3300031911 | Bacteria | 2385 |
| 292 | Ga0307412_10079765 | 3300031911 | Bacteria | 2259 |
| 293 | Ga0315914_1000001 | 3300031967 | Bacteria | 416633 |
| 294 | Ga0307409_100016139 | 3300031995 | Bacteria | 4932 |
| 295 | Ga0307409_100091099 | 3300031995 | Bacteria | 2498 |
| 296 | Ga0307416_100240160 | 3300032002 | Bacteria | 1755 |
| 297 | Ga0315913_1000022 | 3300033430 | Bacteria | 94546 |
| 298 | Ga0315915_1000002 | 3300033464 | Bacteria | 425854 |
| 299 | Ga0436365_0373990 | 3300039437 | Bacteria | 2163 |
| 300 | Ga0439436_0002644 | 3300041404 | Bacteria | 5400 |
| 301 | Ga0439436_0021616 | 3300041404 | Bacteria | 1910 |
| 302 | Ga0439438_016026 | 3300041405 | Bacteria | 2188 |
| 303 | Ga0439439_0057980 | 3300041406 | Bacteria | 1025 |
| 304 | Ga0439461_0013902 | 3300041410 | Bacteria | 1524 |
| 305 | Ga0439465_0008572 | 3300041413 | Bacteria | 3226 |
| 306 | Ga0439465_0019020 | 3300041413 | Bacteria | 2147 |
| 307 | Ga0439465_0019581 | 3300041413 | Bacteria | 2116 |
| 308 | Ga0439465_0028834 | 3300041413 | Bacteria | 1762 |
| 309 | Ga0439465_0058711 | 3300041413 | Bacteria | 1272 |
| 310 | Ga0439465_0090118 | 3300041413 | Bacteria | 1048 |
| 311 | Ga0451791_1030467 | 3300041451 | Bacteria | 1562 |
| 312 | Ga0451798_0608749 | 3300041458 | Bacteria | 2646 |
| 313 | Ga0451833_0105464 | 3300041491 | Bacteria | 2560 |
| 314 | Ga0451833_0360030 | 3300041491 | Bacteria | 2094 |
| 315 | Ga0451833_1403877 | 3300041491 | Bacteria | 609 |
| 316 | Ga0451835_0417831 | 3300041492 | Bacteria | 1308 |
| 317 | Ga0451835_0867006 | 3300041492 | Bacteria | 2852 |
| 318 | Ga0451835_1096416 | 3300041492 | Bacteria | 1288 |
| 319 | Ga0451837_0030893 | 3300041494 | Bacteria | 2240 |
| 320 | Ga0451837_0864410 | 3300041494 | Bacteria | 2088 |
| 321 | Ga0451839_0137856 | 3300041496 | Bacteria | 2699 |
| 322 | Ga0451841_0492521 | 3300041498 | Bacteria | 837 |
| 323 | Ga0451841_0908703 | 3300041498 | Bacteria | 2132 |
| 324 | Ga0451845_0191239 | 3300041501 | Bacteria | 987 |
| 325 | Ga0451845_0378247 | 3300041501 | Bacteria | 2596 |
| 326 | Ga0451847_0566208 | 3300041503 | Bacteria | 4555 |
| 327 | Ga0451847_0712631 | 3300041503 | Bacteria | 1936 |
| 328 | Ga0451849_0107853 | 3300041505 | Bacteria | 914 |
| 329 | Ga0451849_0371279 | 3300041505 | Bacteria | 2007 |
| 330 | Ga0451851_0266839 | 3300041507 | Bacteria | 1908 |
| 331 | Ga0451851_0801872 | 3300041507 | Bacteria | 901 |
| 332 | Ga0451843_0016801 | 3300041509 | Bacteria | 3598 |
| 333 | Ga0451843_1111865 | 3300041509 | Bacteria | 1716 |
| 334 | Ga0451855_0116657 | 3300041511 | Bacteria | 4353 |
| 335 | Ga0451855_1140302 | 3300041511 | Bacteria | 642 |
| 336 | Ga0451853_0435427 | 3300041512 | Bacteria | 1956 |
| 337 | Ga0451853_1706919 | 3300041512 | Bacteria | 1094 |
| 338 | Ga0451853_2867064 | 3300041512 | Bacteria | 908 |
| 339 | Ga0439431_0050052 | 3300041997 | Bacteria | 1082 |
| 340 | Ga0439445_0015504 | 3300042004 | Bacteria | 1867 |
| 341 | Ga0439432_067265 | 3300042006 | Bacteria | 1097 |
| 342 | Ga0439449_0014225 | 3300042007 | Bacteria | 2991 |
| 343 | Ga0439449_0044100 | 3300042007 | Bacteria | 1654 |
| 344 | Ga0439462_0031766 | 3300042015 | Bacteria | 1399 |
| 345 | Ga0439462_0046742 | 3300042015 | Bacteria | 1160 |
| 346 | Ga0450906_010148 | 3300042145 | Bacteria | 1786 |
| 347 | Ga0450906_058020 | 3300042145 | Bacteria | 687 |
| 348 | Ga0466966_0125012 | 3300044684 | Bacteria | 1578 |
| 349 | Ga0466970_0001843 | 3300044765 | Bacteria | 10241 |
| 350 | Ga0466957_0101388 | 3300044842 | Bacteria | 1815 |
| 351 | Ga0466959_0114997 | 3300045049 | Bacteria | 1917 |
| 352 | Ga0466958_0124339 | 3300045836 | Bacteria | 1617 |
| 353 | Ga0466967_0579323 | 3300045976 | Bacteria | 1106 |
| 354 | Ga0495627_120005 | 3300046453 | Bacteria | 743 |
| 355 | Ga0495590_0033564 | 3300046457 | Bacteria | 1794 |
| 356 | Ga0495638_0000110 | 3300046460 | Bacteria | 131410 |
| 357 | Ga0495638_0099595 | 3300046460 | Bacteria | 1739 |
| 358 | Ga0495650_0022871 | 3300046471 | Bacteria | 2989 |
| 359 | Ga0495650_0097893 | 3300046471 | Bacteria | 1105 |
| 360 | Ga0495650_0128404 | 3300046471 | Bacteria | 927 |
| 361 | Ga0495605_0020885 | 3300046474 | Bacteria | 3475 |
| 362 | Ga0495605_0021385 | 3300046474 | Bacteria | 3426 |
| 363 | Ga0495662_0002722 | 3300046476 | Bacteria | 8931 |
| 364 | Ga0495585_0017628 | 3300046492 | Bacteria | 4124 |
| 365 | Ga0495585_0018413 | 3300046492 | Bacteria | 4028 |
| 366 | Ga0495585_0020896 | 3300046492 | Bacteria | 3761 |
| 367 | Ga0495596_0033622 | 3300046500 | Bacteria | 2040 |
| 368 | Ga0495607_0009351 | 3300046501 | Bacteria | 6637 |
| 369 | Ga0495607_0098099 | 3300046501 | Bacteria | 1574 |
| 370 | Ga0495583_0009155 | 3300046506 | Bacteria | 5951 |
| 371 | Ga0495583_0162869 | 3300046506 | Bacteria | 919 |
| 372 | Ga0495606_0001343 | 3300046507 | Bacteria | 33471 |
| 373 | Ga0495606_0018735 | 3300046507 | Bacteria | 5179 |
| 374 | Ga0495606_0049333 | 3300046507 | Bacteria | 2762 |
| 375 | Ga0495606_0087634 | 3300046507 | Bacteria | 1921 |
| 376 | Ga0495606_0428377 | 3300046507 | Bacteria | 682 |
| 377 | Ga0495610_0000363 | 3300046512 | Bacteria | 47378 |
| 378 | Ga0495610_0023670 | 3300046512 | Bacteria | 3331 |
| 379 | Ga0495610_0057323 | 3300046512 | Bacteria | 1868 |
| 380 | Ga0495620_0021545 | 3300046515 | Bacteria | 3128 |
| 381 | Ga0495620_0034097 | 3300046515 | Bacteria | 2304 |
| 382 | Ga0495620_0035577 | 3300046515 | Bacteria | 2237 |
| 383 | Ga0495620_0080771 | 3300046515 | Bacteria | 1315 |
| 384 | Ga0495620_0134376 | 3300046515 | Bacteria | 969 |
| 385 | Ga0495631_0036130 | 3300046518 | Bacteria | 2207 |
| 386 | Ga0495632_0010305 | 3300046519 | Bacteria | 5548 |
| 387 | Ga0495632_0012878 | 3300046519 | Bacteria | 4798 |
| 388 | Ga0495643_0216381 | 3300046522 | Bacteria | 911 |
| 389 | Ga0495643_0326937 | 3300046522 | Bacteria | 692 |
| 390 | Ga0495643_0373454 | 3300046522 | Bacteria | 634 |
| 391 | Ga0495644_0075191 | 3300046523 | Bacteria | 1272 |
| 392 | Ga0495648_0095240 | 3300046524 | Bacteria | 1657 |
| 393 | Ga0495648_0122881 | 3300046524 | Bacteria | 1392 |
| 394 | Ga0495648_0172108 | 3300046524 | Bacteria | 1109 |
| 395 | Ga0495652_0244882 | 3300046529 | Bacteria | 1332 |
| 396 | Ga0495654_0042120 | 3300046530 | Bacteria | 2268 |
| 397 | Ga0495609_0108052 | 3300046538 | Bacteria | 1202 |
| 398 | Ga0495597_0043959 | 3300046542 | Bacteria | 1987 |
| 399 | Ga0495622_0032703 | 3300046557 | Bacteria | 2428 |
| 400 | Ga0495633_0023680 | 3300046558 | Bacteria | 3040 |
| 401 | Ga0495633_0030340 | 3300046558 | Bacteria | 2626 |
| 402 | Ga0495633_0129766 | 3300046558 | Bacteria | 1166 |
| 403 | Ga0495656_0010068 | 3300046615 | Bacteria | 3424 |
| 404 | Ga0495668_0019859 | 3300046616 | Bacteria | 3867 |
| 405 | Ga0495668_0055795 | 3300046616 | Bacteria | 2181 |
| 406 | Ga0495668_0190496 | 3300046616 | Bacteria | 1123 |
| 407 | Ga0495668_0230887 | 3300046616 | Bacteria | 1013 |
| 408 | Ga0495611_0021610 | 3300046648 | Bacteria | 2780 |
| 409 | Ga0495625_0110161 | 3300046660 | Bacteria | 1882 |
| 410 | Ga0495625_0124910 | 3300046660 | Bacteria | 1748 |
| 411 | Ga0495625_0157467 | 3300046660 | Bacteria | 1523 |
| 412 | Ga0495625_0301237 | 3300046660 | Bacteria | 1026 |
| 413 | Ga0495661_0075172 | 3300046665 | Bacteria | 1964 |
| 414 | Ga0495661_0120628 | 3300046665 | Bacteria | 1449 |
| 415 | Ga0495588_0022965 | 3300046674 | Bacteria | 3084 |
| 416 | Ga0495588_0132452 | 3300046674 | Bacteria | 1315 |
| 417 | Ga0495588_0143506 | 3300046674 | Bacteria | 1261 |
| 418 | Ga0495657_0056595 | 3300046675 | Bacteria | 2610 |
| 419 | Ga0495658_0298967 | 3300046683 | Bacteria | 1018 |
| 420 | Ga0495671_0044759 | 3300046692 | Bacteria | 2218 |
| 421 | Ga0495649_0019639 | 3300046694 | Bacteria | 3796 |
| 422 | Ga0495649_0226185 | 3300046694 | Bacteria | 967 |
| 423 | Ga0495600_0330416 | 3300046809 | Bacteria | 957 |
| 424 | Ga0495660_0181491 | 3300046810 | Bacteria | 1018 |
| 425 | Ga0495604_0026659 | 3300047317 | Bacteria | 4599 |
| 426 | Ga0495672_0021992 | 3300047320 | Bacteria | 4153 |
| 427 | Ga0495676_0436259 | 3300047321 | Bacteria | 865 |
| 428 | Ga0495683_0085475 | 3300047323 | Bacteria | 1534 |
| 429 | Ga0495687_021278 | 3300047443 | Bacteria | 3142 |
| 430 | Ga0495681_0035361 | 3300047470 | Bacteria | 2481 |
| 431 | Ga0495681_0040126 | 3300047470 | Bacteria | 2281 |
| 432 | Ga0495681_0185116 | 3300047470 | Bacteria | 853 |
| 433 | Ga0495686_0001162 | 3300047472 | Bacteria | 30927 |
| 434 | Ga0495686_0002138 | 3300047472 | Bacteria | 19314 |
| 435 | Ga0495686_0019477 | 3300047472 | Bacteria | 4533 |
| 436 | Ga0495686_0022887 | 3300047472 | Bacteria | 4128 |
| 437 | Ga0495686_0070372 | 3300047472 | Bacteria | 2156 |
| 438 | Ga0495686_0412445 | 3300047472 | Bacteria | 723 |
| 439 | Ga0495686_0489337 | 3300047472 | Bacteria | 649 |
| 440 | Ga0495615_0013503 | 3300048090 | Bacteria | 1708 |
| 441 | Ga0495626_0054217 | 3300048091 | Bacteria | 1842 |
| 442 | Ga0496100_0104274 | 3300048903 | Bacteria | 1959 |
| 443 | Ga0496101_0126148 | 3300048904 | Bacteria | 1939 |
| 444 | Ga0496101_0724997 | 3300048904 | Bacteria | 785 |
| 445 | Ga0496102_0006022 | 3300048905 | Bacteria | 10327 |
| 446 | Ga0496102_0051109 | 3300048905 | Bacteria | 3765 |
| 447 | Ga0496103_0005771 | 3300048906 | Bacteria | 7389 |
| 448 | Ga0496103_0032901 | 3300048906 | Bacteria | 3166 |
| 449 | Ga0496104_0047950 | 3300048907 | Bacteria | 4027 |
| 450 | Ga0496105_0022420 | 3300048908 | Bacteria | 5114 |
| 451 | Ga0496106_0001205 | 3300048909 | Bacteria | 19322 |
| 452 | Ga0496106_0140366 | 3300048909 | Bacteria | 1900 |
| 453 | Ga0496107_0036741 | 3300048910 | Bacteria | 3514 |
| 454 | Ga0496107_0051360 | 3300048910 | Bacteria | 2974 |
| 455 | Ga0496108_0177714 | 3300048911 | Bacteria | 1843 |
| 456 | Ga0496110_0026155 | 3300048913 | Bacteria | 4991 |
| 457 | Ga0496111_0000529 | 3300048914 | Bacteria | 19781 |
| 458 | Ga0496111_0077063 | 3300048914 | Bacteria | 2430 |
| 459 | Ga0496113_0024324 | 3300048916 | Bacteria | 4303 |
| 460 | Ga0496113_0062902 | 3300048916 | Bacteria | 2804 |
| 461 | Ga0496113_0102738 | 3300048916 | Bacteria | 2217 |
| 462 | Ga0496116_0000057 | 3300048919 | Bacteria | 281652 |
| 463 | Ga0496116_0002951 | 3300048919 | Bacteria | 17324 |
| 464 | Ga0496116_0010500 | 3300048919 | Bacteria | 7750 |
| 465 | Ga0496116_0026331 | 3300048919 | Bacteria | 4257 |
| 466 | Ga0496116_0052697 | 3300048919 | Bacteria | 2693 |
| 467 | Ga0496116_0067419 | 3300048919 | Bacteria | 2285 |
| 468 | Ga0496116_0125717 | 3300048919 | Bacteria | 1473 |
| 469 | Ga0496116_0163627 | 3300048919 | Bacteria | 1217 |
| 470 | Ga0496116_0199445 | 3300048919 | Bacteria | 1049 |
| 471 | Ga0496116_0265186 | 3300048919 | Bacteria | 844 |
| 472 | Ga0496117_0000031 | 3300048920 | Bacteria | 381048 |
| 473 | Ga0496117_0006996 | 3300048920 | Bacteria | 11181 |
| 474 | Ga0496117_0010245 | 3300048920 | Bacteria | 8588 |
| 475 | Ga0496117_0011322 | 3300048920 | Bacteria | 7995 |
| 476 | Ga0496117_0013741 | 3300048920 | Bacteria | 7033 |
| 477 | Ga0496117_0115128 | 3300048920 | Bacteria | 1665 |
| 478 | Ga0496117_0211283 | 3300048920 | Bacteria | 1088 |
| 479 | Ga0496117_0229932 | 3300048920 | Bacteria | 1026 |
| 480 | Ga0496118_0000208 | 3300048921 | Bacteria | 102645 |
| 481 | Ga0496118_0008792 | 3300048921 | Bacteria | 10353 |
| 482 | Ga0496118_0026767 | 3300048921 | Bacteria | 4903 |
| 483 | Ga0496118_0082495 | 3300048921 | Bacteria | 2252 |
| 484 | Ga0496118_0090333 | 3300048921 | Bacteria | 2111 |
| 485 | Ga0496119_0015539 | 3300048922 | Bacteria | 5850 |
| 486 | Ga0496119_0018993 | 3300048922 | Bacteria | 5086 |
| 487 | Ga0496119_0023565 | 3300048922 | Bacteria | 4358 |
| 488 | Ga0496119_0028959 | 3300048922 | Bacteria | 3767 |
| 489 | Ga0496119_0069940 | 3300048922 | Bacteria | 2060 |
| 490 | Ga0496119_0193071 | 3300048922 | Bacteria | 1059 |
| 491 | Ga0496119_0247845 | 3300048922 | Bacteria | 899 |
| 492 | Ga0496119_0304751 | 3300048922 | Bacteria | 784 |
| 493 | Ga0496119_0305993 | 3300048922 | Bacteria | 782 |
| 494 | Ga0496120_0000387 | 3300048923 | Bacteria | 71224 |
| 495 | Ga0496120_0008826 | 3300048923 | Bacteria | 7237 |
| 496 | Ga0496121_0000034 | 3300048924 | Bacteria | 377095 |
| 497 | Ga0496121_0006665 | 3300048924 | Bacteria | 14205 |
| 498 | Ga0496121_0013662 | 3300048924 | Bacteria | 8704 |
| 499 | Ga0496121_0038317 | 3300048924 | Bacteria | 4248 |
| 500 | Ga0496121_0064662 | 3300048924 | Bacteria | 2981 |
| 501 | Ga0496121_0065145 | 3300048924 | Bacteria | 2966 |
| 502 | Ga0496121_0081120 | 3300048924 | Bacteria | 2569 |
| 503 | Ga0496121_0100435 | 3300048924 | Bacteria | 2233 |
| 504 | Ga0496121_0172915 | 3300048924 | Bacteria | 1567 |
| 505 | Ga0496121_0185395 | 3300048924 | Bacteria | 1497 |
| 506 | Ga0496121_0221169 | 3300048924 | Bacteria | 1333 |
| 507 | Ga0496121_0623855 | 3300048924 | Bacteria | 661 |
| 508 | Ga0496122_0000023 | 3300048925 | Bacteria | 381035 |
| 509 | Ga0496122_0000308 | 3300048925 | Bacteria | 107960 |
| 510 | Ga0496122_0015251 | 3300048925 | Bacteria | 7354 |
| 511 | Ga0496122_0015282 | 3300048925 | Bacteria | 7344 |
| 512 | Ga0496122_0019377 | 3300048925 | Bacteria | 6218 |
| 513 | Ga0496122_0020473 | 3300048925 | Bacteria | 5975 |
| 514 | Ga0496122_0054737 | 3300048925 | Bacteria | 2993 |
| 515 | Ga0496122_0058019 | 3300048925 | Bacteria | 2870 |
| 516 | Ga0496122_0067660 | 3300048925 | Bacteria | 2570 |
| 517 | Ga0496122_0084421 | 3300048925 | Bacteria | 2196 |
| 518 | Ga0496122_0103079 | 3300048925 | Bacteria | 1900 |
| 519 | Ga0496122_0272400 | 3300048925 | Bacteria | 931 |
| 520 | Ga0496123_0000027 | 3300048926 | Bacteria | 306773 |
| 521 | Ga0496123_0000066 | 3300048926 | Bacteria | 210327 |
| 522 | Ga0496123_0005944 | 3300048926 | Bacteria | 12020 |
| 523 | Ga0496123_0031587 | 3300048926 | Bacteria | 3850 |
| 524 | Ga0496123_0033226 | 3300048926 | Bacteria | 3715 |
| 525 | Ga0496123_0038852 | 3300048926 | Bacteria | 3339 |
| 526 | Ga0496123_0039627 | 3300048926 | Bacteria | 3293 |
| 527 | Ga0496123_0051313 | 3300048926 | Bacteria | 2747 |
| 528 | Ga0496123_0069926 | 3300048926 | Bacteria | 2200 |
| 529 | Ga0496123_0077281 | 3300048926 | Bacteria | 2045 |
| 530 | Ga0496123_0095838 | 3300048926 | Bacteria | 1744 |
| 531 | Ga0496123_0135265 | 3300048926 | Bacteria | 1357 |
| 532 | Ga0496124_0001215 | 3300048927 | Bacteria | 39879 |
| 533 | Ga0496124_0018926 | 3300048927 | Bacteria | 6429 |
| 534 | Ga0496124_0019169 | 3300048927 | Bacteria | 6381 |
| 535 | Ga0496124_0055661 | 3300048927 | Bacteria | 3341 |
| 536 | Ga0496124_0072398 | 3300048927 | Bacteria | 2854 |
| 537 | Ga0496124_0079902 | 3300048927 | Bacteria | 2692 |
| 538 | Ga0496124_0093369 | 3300048927 | Bacteria | 2449 |
| 539 | Ga0496124_0105892 | 3300048927 | Bacteria | 2271 |
| 540 | Ga0496124_0134174 | 3300048927 | Bacteria | 1962 |
| 541 | Ga0496124_0275512 | 3300048927 | Bacteria | 1229 |
| 542 | Ga0496124_0299037 | 3300048927 | Bacteria | 1163 |
| 543 | Ga0496124_0302055 | 3300048927 | Bacteria | 1155 |
| 544 | Ga0496124_0530945 | 3300048927 | Bacteria | 781 |
| 545 | Ga0496124_0583804 | 3300048927 | Bacteria | 730 |
| 546 | Ga0496124_0731918 | 3300048927 | Bacteria | 622 |
| 547 | Ga0496125_0000030 | 3300048928 | Bacteria | 375023 |
| 548 | Ga0496125_0000288 | 3300048928 | Bacteria | 99681 |
| 549 | Ga0496125_0005090 | 3300048928 | Bacteria | 14802 |
| 550 | Ga0496125_0028379 | 3300048928 | Bacteria | 5056 |
| 551 | Ga0496125_0064201 | 3300048928 | Bacteria | 2920 |
| 552 | Ga0496125_0077580 | 3300048928 | Bacteria | 2560 |
| 553 | Ga0496125_0089748 | 3300048928 | Bacteria | 2310 |
| 554 | Ga0496125_0146081 | 3300048928 | Bacteria | 1634 |
| 555 | Ga0496125_0192797 | 3300048928 | Bacteria | 1344 |
| 556 | Ga0496125_0212927 | 3300048928 | Bacteria | 1253 |
| 557 | Ga0496125_0257381 | 3300048928 | Bacteria | 1096 |
| 558 | Ga0496126_0000115 | 3300048929 | Bacteria | 188546 |
| 559 | Ga0496126_0000258 | 3300048929 | Bacteria | 113843 |
| 560 | Ga0496126_0024648 | 3300048929 | Bacteria | 5804 |
| 561 | Ga0496126_0027664 | 3300048929 | Bacteria | 5413 |
| 562 | Ga0496126_0070762 | 3300048929 | Bacteria | 3107 |
| 563 | Ga0496126_0099049 | 3300048929 | Bacteria | 2553 |
| 564 | Ga0496126_0391213 | 3300048929 | Bacteria | 1129 |
| 565 | Ga0496126_0586851 | 3300048929 | Bacteria | 879 |
| 566 | Ga0495678_006828 | 3300049459 | Bacteria | 6004 |
| 567 | Ga0495678_040938 | 3300049459 | Bacteria | 1858 |
| 568 | Ga0495682_0151204 | 3300049460 | Bacteria | 828 |
| 569 | Ga0501031_0087362 | 3300049568 | Bacteria | 2033 |
| 570 | Ga0501032_0038403 | 3300049569 | Bacteria | 3261 |
| 571 | Ga0501033_0207310 | 3300049570 | Bacteria | 1399 |
| 572 | Ga0501034_0026220 | 3300049571 | Bacteria | 5936 |
| 573 | Ga0501034_0573887 | 3300049571 | Bacteria | 1035 |
| 574 | Ga0501037_0034368 | 3300049573 | Bacteria | 3741 |
| 575 | Ga0501038_0108219 | 3300049574 | Bacteria | 2305 |
| 576 | Ga0501038_0111837 | 3300049574 | Bacteria | 2262 |
| 577 | Ga0501043_0072981 | 3300049579 | Bacteria | 2695 |
| 578 | Ga0501047_0524800 | 3300049581 | Bacteria | 1010 |
| 579 | Ga0501047_0571384 | 3300049581 | Bacteria | 954 |
| 580 | Ga0501068_0322095 | 3300049584 | Bacteria | 991 |
| 581 | Ga0501068_0352923 | 3300049584 | Bacteria | 945 |
| 582 | Ga0501073_0103824 | 3300049589 | Bacteria | 1973 |
| 583 | Ga0501073_0132213 | 3300049589 | Bacteria | 1730 |
| 584 | Ga0501223_063309 | 3300049663 | Bacteria | 724 |
| 585 | Ga0501238_005148 | 3300049671 | Bacteria | 1650 |
| 586 | Ga0501080_0049490 | 3300049742 | Bacteria | 3912 |
| 587 | Ga0501083_0034342 | 3300049744 | Bacteria | 3468 |
| 588 | Ga0501083_0201936 | 3300049744 | Bacteria | 1296 |
| 589 | Ga0501280_000684 | 3300049776 | Bacteria | 7483 |
| 590 | Ga0501035_0166702 | 3300049822 | Bacteria | 1905 |
| 591 | Ga0501044_0185061 | 3300049823 | Bacteria | 2048 |
| 592 | nmdc:mga03683_64094_c1 | 3300050489 | Bacteria | 1559 |
| 593 | nmdc:mga03n38_366798_c1 | 3300050490 | Bacteria | 787 |
| 594 | nmdc:mga00v17_141160_c1 | 3300050491 | Bacteria | 1545 |
| 595 | nmdc:mga00v17_15_c1 | 3300050491 | Bacteria | 126234 |
| 596 | nmdc:mga00v17_55968_c1 | 3300050491 | Bacteria | 2410 |
| 597 | nmdc:mga0yw44_27717_c1 | 3300050492 | Bacteria | 3250 |
| 598 | nmdc:mga0yw44_61109_c1 | 3300050492 | Bacteria | 2310 |
| 599 | nmdc:mga0k408_110158_c1 | 3300050493 | Bacteria | 1628 |
| 600 | nmdc:mga0k408_6544_c1 | 3300050493 | Bacteria | 6205 |
| 601 | nmdc:mga06z11_104594_c1 | 3300050494 | Bacteria | 1559 |
| 602 | nmdc:mga06z11_11797_c1 | 3300050494 | Bacteria | 3780 |
| 603 | nmdc:mga06z11_305929_c1 | 3300050494 | Bacteria | 946 |
| 604 | nmdc:mga06z11_79268_c1 | 3300050494 | Bacteria | 1758 |
| 605 | nmdc:mga04h51_101109_c1 | 3300050495 | Bacteria | 1051 |
| 606 | nmdc:mga04h51_5669_c1 | 3300050495 | Bacteria | 3192 |
| 607 | nmdc:mga07m45_107257_c2 | 3300050496 | Bacteria | 1123 |
| 608 | nmdc:mga07m45_53477_c1 | 3300050496 | Bacteria | 2282 |
| 609 | nmdc:mga0sz30_155606_c1 | 3300050516 | Bacteria | 1012 |
| 610 | nmdc:mga0sz30_2785_c1 | 3300050516 | Bacteria | 6238 |
| 611 | nmdc:mga0sz30_37813_c1 | 3300050516 | Bacteria | 2021 |
| 612 | nmdc:mga0sz30_735_c1 | 3300050516 | Bacteria | 11987 |
| 613 | Ga0495601_0031472 | 3300053077 | Bacteria | 3298 |
| 614 | Ga0495619_0087376 | 3300053085 | Bacteria | 2108 |
| 615 | Ga0500647_0187058 | 3300053091 | Bacteria | 947 |
| 616 | Ga0500651_0026274 | 3300053093 | Bacteria | 3658 |
| 617 | Ga0500650_0170058 | 3300053098 | Unclassified | 1002 |
| 618 | Ga0500560_025638 | 3300053107 | Bacteria | 1733 |
| 619 | Ga0500562_006715 | 3300053108 | Bacteria | 2901 |
| 620 | Ga0500562_050458 | 3300053108 | Bacteria | 1112 |
| 621 | Ga0500569_001882 | 3300053109 | Bacteria | 4047 |
| 622 | Ga0500594_0053542 | 3300053118 | Bacteria | 1143 |
| 623 | Ga0500618_000513 | 3300053125 | Bacteria | 24523 |
| 624 | Ga0500618_010829 | 3300053125 | Bacteria | 2435 |
| 625 | Ga0500618_057121 | 3300053125 | Bacteria | 879 |
| 626 | Ga0500628_053207 | 3300053129 | Bacteria | 967 |
| 627 | Ga0500655_000659 | 3300053133 | Bacteria | 6845 |
| 628 | Ga0500658_0001061 | 3300053134 | Bacteria | 11260 |
| 629 | Ga0500658_0008567 | 3300053134 | Bacteria | 3778 |
| 630 | Ga0500658_0010054 | 3300053134 | Bacteria | 3492 |
| 631 | Ga0500658_0149475 | 3300053134 | Bacteria | 1052 |
| 632 | Ga0500659_0069908 | 3300053135 | Bacteria | 1862 |
| 633 | Ga0500561_0000223 | 3300053137 | Bacteria | 10314 |
| 634 | Ga0500568_0000247 | 3300053139 | Bacteria | 45994 |
| 635 | Ga0500568_0005405 | 3300053139 | Bacteria | 6604 |
| 636 | Ga0500568_0037466 | 3300053139 | Bacteria | 1967 |
| 637 | Ga0500577_0310032 | 3300053142 | Bacteria | 689 |
| 638 | Ga0500588_0041375 | 3300053146 | Bacteria | 1390 |
| 639 | Ga0500590_000271 | 3300053148 | Bacteria | 16202 |
| 640 | Ga0500604_0001019 | 3300053151 | Bacteria | 7827 |
| 641 | Ga0500604_0009464 | 3300053151 | Bacteria | 2596 |
| 642 | Ga0500616_0002118 | 3300053153 | Bacteria | 17230 |
| 643 | Ga0500616_0033586 | 3300053153 | Bacteria | 2798 |
| 644 | Ga0500622_0000169 | 3300053156 | Bacteria | 70224 |
| 645 | Ga0500622_0046522 | 3300053156 | Bacteria | 2243 |
| 646 | Ga0500624_000633 | 3300053157 | Bacteria | 9342 |
| 647 | Ga0500627_0013773 | 3300053158 | Bacteria | 3079 |
| 648 | Ga0500627_0033906 | 3300053158 | Bacteria | 2161 |
| 649 | Ga0500627_0104733 | 3300053158 | Bacteria | 1271 |
| 650 | Ga0500633_0000081 | 3300053160 | Bacteria | 14125 |
| 651 | Ga0587072_007015 | 3300059643 | Bacteria | 1737 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003781 | Ga0055536_1004552 | Ga0055536_10045523 | 139 |
| 2 | 3300046460 | Ga0495638_0000110 | Ga0495638_0000110_72534_73088 | 141 |
| 3 | 3300053098 | Ga0500650_0170058 | Ga0500650_0170058_41_595 | 141 |
| 4 | 3300003792 | Ga0055540_1018940 | Ga0055540_10189401 | 142 |
| 5 | 3300003794 | Ga0055531_10001167 | Ga0055531_100011676 | 142 |
| 6 | 3300025298 | Ga0209050_1011173 | Ga0209050_10111734 | 142 |
| 7 | 3300025303 | Ga0209051_1000547 | Ga0209051_10005475 | 142 |
| 8 | 3300025304 | Ga0209257_1006107 | Ga0209257_10061075 | 142 |
| 9 | 3300003215 | JGI25153J46596_10005551 | JGI25153J46596_100055519 | 143 |
| 10 | 3300025297 | Ga0209758_1000406 | Ga0209758_100040652 | 143 |
| 11 | 3300049663 | Ga0501223_063309 | Ga0501223_063309_27_554 | 148 |
| 12 | iso_pu_bacteria | 2818991461 | 2819688371 | 149 |
| 13 | iso_pu_bacteria | 2842509118 | 2842514681 | 151 |
| 14 | 3300005937 | Ga0081455_10139034 | Ga0081455_101390342 | 152 |
| 15 | 3300005262 | Ga0065165_1015648 | Ga0065165_10156483 | 155 |
| 16 | 3300005548 | Ga0070665_100179520 | Ga0070665_1001795203 | 155 |
| 17 | 3300025284 | Ga0209130_1021620 | Ga0209130_10216202 | 155 |
| 18 | 3300028379 | Ga0268266_10019818 | Ga0268266_100198183 | 155 |
| 19 | 3300044765 | Ga0466970_0001843 | Ga0466970_0001843_2416_3039 | 155 |
| 20 | 3300044842 | Ga0466957_0101388 | Ga0466957_0101388_297_920 | 155 |
| 21 | 3300045049 | Ga0466959_0114997 | Ga0466959_0114997_915_1538 | 155 |
| 22 | 3300045836 | Ga0466958_0124339 | Ga0466958_0124339_420_1043 | 155 |
| 23 | 3300045976 | Ga0466967_0579323 | Ga0466967_0579323_218_841 | 155 |
| 24 | 3300048914 | Ga0496111_0000529 | Ga0496111_0000529_13690_14238 | 155 |
| 25 | 3300048919 | Ga0496116_0265186 | Ga0496116_0265186_276_824 | 155 |
| 26 | 3300048924 | Ga0496121_0185395 | Ga0496121_0185395_251_799 | 155 |
| 27 | 3300048924 | Ga0496121_0221169 | Ga0496121_0221169_439_987 | 155 |
| 28 | 3300048925 | Ga0496122_0015282 | Ga0496122_0015282_4731_5279 | 155 |
| 29 | 3300048926 | Ga0496123_0069926 | Ga0496123_0069926_555_1103 | 155 |
| 30 | 3300048927 | Ga0496124_0001215 | Ga0496124_0001215_36396_36944 | 155 |
| 31 | 3300048927 | Ga0496124_0093369 | Ga0496124_0093369_753_1301 | 155 |
| 32 | 3300048927 | Ga0496124_0530945 | Ga0496124_0530945_46_594 | 155 |
| 33 | 3300048927 | Ga0496124_0731918 | Ga0496124_0731918_41_589 | 155 |
| 34 | 3300049671 | Ga0501238_005148 | Ga0501238_005148_983_1531 | 155 |
| 35 | 3300053125 | Ga0500618_000513 | Ga0500618_000513_9868_10416 | 155 |
| 36 | 3300003771 | Ga0055526_1001114 | Ga0055526_10011142 | 156 |
| 37 | 3300003775 | Ga0055524_1030108 | Ga0055524_10301082 | 156 |
| 38 | 3300003790 | Ga0055528_1001012 | Ga0055528_10010122 | 156 |
| 39 | 3300025273 | Ga0209673_1000050 | Ga0209673_1000050203 | 156 |
| 40 | 3300025295 | Ga0209564_1000227 | Ga0209564_100022769 | 156 |
| 41 | 3300025299 | Ga0209256_1001610 | Ga0209256_100161017 | 156 |
| 42 | 3300001989 | JGI24739J22299_10081966 | JGI24739J22299_100819662 | 157 |
| 43 | 3300041491 | Ga0451833_1403877 | Ga0451833_1403877_16_570 | 157 |
| 44 | 3300041511 | Ga0451855_1140302 | Ga0451855_1140302_34_588 | 157 |
| 45 | 3300044684 | Ga0466966_0125012 | Ga0466966_0125012_272_895 | 157 |
| 46 | 3300046457 | Ga0495590_0033564 | Ga0495590_0033564_1209_1763 | 157 |
| 47 | 3300046471 | Ga0495650_0097893 | Ga0495650_0097893_352_906 | 157 |
| 48 | 3300046476 | Ga0495662_0002722 | Ga0495662_0002722_5476_6030 | 157 |
| 49 | 3300046506 | Ga0495583_0162869 | Ga0495583_0162869_78_632 | 157 |
| 50 | 3300046507 | Ga0495606_0001343 | Ga0495606_0001343_5843_6397 | 157 |
| 51 | 3300046512 | Ga0495610_0000363 | Ga0495610_0000363_12144_12698 | 157 |
| 52 | 3300046515 | Ga0495620_0021545 | Ga0495620_0021545_2440_2994 | 157 |
| 53 | 3300046515 | Ga0495620_0035577 | Ga0495620_0035577_475_1029 | 157 |
| 54 | 3300046519 | Ga0495632_0010305 | Ga0495632_0010305_1025_1579 | 157 |
| 55 | 3300046522 | Ga0495643_0216381 | Ga0495643_0216381_101_655 | 157 |
| 56 | 3300046522 | Ga0495643_0373454 | Ga0495643_0373454_10_564 | 157 |
| 57 | 3300046524 | Ga0495648_0172108 | Ga0495648_0172108_81_635 | 157 |
| 58 | 3300046529 | Ga0495652_0244882 | Ga0495652_0244882_113_667 | 157 |
| 59 | 3300046557 | Ga0495622_0032703 | Ga0495622_0032703_1002_1556 | 157 |
| 60 | 3300046616 | Ga0495668_0019859 | Ga0495668_0019859_1471_2025 | 157 |
| 61 | 3300046648 | Ga0495611_0021610 | Ga0495611_0021610_1107_1661 | 157 |
| 62 | 3300046660 | Ga0495625_0124910 | Ga0495625_0124910_512_1066 | 157 |
| 63 | 3300046674 | Ga0495588_0132452 | Ga0495588_0132452_417_971 | 157 |
| 64 | 3300046675 | Ga0495657_0056595 | Ga0495657_0056595_156_710 | 157 |
| 65 | 3300046683 | Ga0495658_0298967 | Ga0495658_0298967_272_826 | 157 |
| 66 | 3300046809 | Ga0495600_0330416 | Ga0495600_0330416_92_646 | 157 |
| 67 | 3300047317 | Ga0495604_0026659 | Ga0495604_0026659_3485_4039 | 157 |
| 68 | 3300047320 | Ga0495672_0021992 | Ga0495672_0021992_392_946 | 157 |
| 69 | 3300047321 | Ga0495676_0436259 | Ga0495676_0436259_230_784 | 157 |
| 70 | 3300047472 | Ga0495686_0001162 | Ga0495686_0001162_12770_13324 | 157 |
| 71 | 3300047472 | Ga0495686_0002138 | Ga0495686_0002138_16062_16616 | 157 |
| 72 | 3300047472 | Ga0495686_0070372 | Ga0495686_0070372_17_571 | 157 |
| 73 | 3300047472 | Ga0495686_0489337 | Ga0495686_0489337_61_615 | 157 |
| 74 | 3300048904 | Ga0496101_0724997 | Ga0496101_0724997_32_586 | 157 |
| 75 | 3300048919 | Ga0496116_0002951 | Ga0496116_0002951_2692_3246 | 157 |
| 76 | 3300048919 | Ga0496116_0010500 | Ga0496116_0010500_6413_6967 | 157 |
| 77 | 3300048919 | Ga0496116_0026331 | Ga0496116_0026331_2308_2862 | 157 |
| 78 | 3300048919 | Ga0496116_0052697 | Ga0496116_0052697_949_1503 | 157 |
| 79 | 3300048919 | Ga0496116_0067419 | Ga0496116_0067419_1160_1714 | 157 |
| 80 | 3300048919 | Ga0496116_0125717 | Ga0496116_0125717_74_628 | 157 |
| 81 | 3300048920 | Ga0496117_0115128 | Ga0496117_0115128_733_1287 | 157 |
| 82 | 3300048921 | Ga0496118_0008792 | Ga0496118_0008792_6283_6837 | 157 |
| 83 | 3300048921 | Ga0496118_0026767 | Ga0496118_0026767_646_1200 | 157 |
| 84 | 3300048922 | Ga0496119_0028959 | Ga0496119_0028959_2609_3163 | 157 |
| 85 | 3300048922 | Ga0496119_0193071 | Ga0496119_0193071_334_888 | 157 |
| 86 | 3300048922 | Ga0496119_0247845 | Ga0496119_0247845_288_842 | 157 |
| 87 | 3300048922 | Ga0496119_0305993 | Ga0496119_0305993_116_670 | 157 |
| 88 | 3300048924 | Ga0496121_0006665 | Ga0496121_0006665_11177_11731 | 157 |
| 89 | 3300048924 | Ga0496121_0013662 | Ga0496121_0013662_6945_7499 | 157 |
| 90 | 3300048924 | Ga0496121_0064662 | Ga0496121_0064662_429_983 | 157 |
| 91 | 3300048924 | Ga0496121_0081120 | Ga0496121_0081120_948_1502 | 157 |
| 92 | 3300048924 | Ga0496121_0623855 | Ga0496121_0623855_39_593 | 157 |
| 93 | 3300048925 | Ga0496122_0019377 | Ga0496122_0019377_2440_2994 | 157 |
| 94 | 3300048925 | Ga0496122_0020473 | Ga0496122_0020473_5135_5689 | 157 |
| 95 | 3300048925 | Ga0496122_0054737 | Ga0496122_0054737_185_739 | 157 |
| 96 | 3300048925 | Ga0496122_0084421 | Ga0496122_0084421_743_1297 | 157 |
| 97 | 3300048926 | Ga0496123_0031587 | Ga0496123_0031587_2904_3458 | 157 |
| 98 | 3300048926 | Ga0496123_0033226 | Ga0496123_0033226_558_1112 | 157 |
| 99 | 3300048926 | Ga0496123_0039627 | Ga0496123_0039627_1259_1813 | 157 |
| 100 | 3300048927 | Ga0496124_0019169 | Ga0496124_0019169_2672_3226 | 157 |
| 101 | 3300048927 | Ga0496124_0055661 | Ga0496124_0055661_1884_2438 | 157 |
| 102 | 3300048927 | Ga0496124_0072398 | Ga0496124_0072398_1520_2074 | 157 |
| 103 | 3300048927 | Ga0496124_0079902 | Ga0496124_0079902_1838_2392 | 157 |
| 104 | 3300048927 | Ga0496124_0105892 | Ga0496124_0105892_1132_1686 | 157 |
| 105 | 3300048927 | Ga0496124_0302055 | Ga0496124_0302055_586_1140 | 157 |
| 106 | 3300048928 | Ga0496125_0077580 | Ga0496125_0077580_1889_2443 | 157 |
| 107 | 3300048928 | Ga0496125_0257381 | Ga0496125_0257381_527_1081 | 157 |
| 108 | 3300049459 | Ga0495678_006828 | Ga0495678_006828_1137_1691 | 157 |
| 109 | 3300049569 | Ga0501032_0038403 | Ga0501032_0038403_2438_2992 | 157 |
| 110 | 3300049570 | Ga0501033_0207310 | Ga0501033_0207310_366_920 | 157 |
| 111 | 3300049573 | Ga0501037_0034368 | Ga0501037_0034368_1086_1640 | 157 |
| 112 | 3300049574 | Ga0501038_0108219 | Ga0501038_0108219_975_1529 | 157 |
| 113 | 3300049581 | Ga0501047_0524800 | Ga0501047_0524800_131_685 | 157 |
| 114 | 3300049581 | Ga0501047_0571384 | Ga0501047_0571384_326_880 | 157 |
| 115 | 3300049584 | Ga0501068_0322095 | Ga0501068_0322095_391_945 | 157 |
| 116 | 3300049589 | Ga0501073_0103824 | Ga0501073_0103824_787_1341 | 157 |
| 117 | 3300049742 | Ga0501080_0049490 | Ga0501080_0049490_1013_1567 | 157 |
| 118 | 3300049744 | Ga0501083_0201936 | Ga0501083_0201936_63_617 | 157 |
| 119 | 3300049822 | Ga0501035_0166702 | Ga0501035_0166702_1057_1611 | 157 |
| 120 | 3300049823 | Ga0501044_0185061 | Ga0501044_0185061_935_1489 | 157 |
| 121 | 3300050494 | nmdc:mga06z11_305929_c1 | nmdc:mga06z11_305929_c1_19_573 | 157 |
| 122 | 3300053077 | Ga0495601_0031472 | Ga0495601_0031472_2380_2934 | 157 |
| 123 | 3300053085 | Ga0495619_0087376 | Ga0495619_0087376_1001_1555 | 157 |
| 124 | 3300053091 | Ga0500647_0187058 | Ga0500647_0187058_206_760 | 157 |
| 125 | 3300053108 | Ga0500562_006715 | Ga0500562_006715_860_1414 | 157 |
| 126 | 3300053108 | Ga0500562_050458 | Ga0500562_050458_383_937 | 157 |
| 127 | 3300053118 | Ga0500594_0053542 | Ga0500594_0053542_104_658 | 157 |
| 128 | 3300053134 | Ga0500658_0010054 | Ga0500658_0010054_2409_2963 | 157 |
| 129 | 3300053134 | Ga0500658_0149475 | Ga0500658_0149475_472_1026 | 157 |
| 130 | 3300053139 | Ga0500568_0000247 | Ga0500568_0000247_30438_30992 | 157 |
| 131 | 3300053146 | Ga0500588_0041375 | Ga0500588_0041375_371_925 | 157 |
| 132 | 3300053148 | Ga0500590_000271 | Ga0500590_000271_2043_2597 | 157 |
| 133 | 3300053153 | Ga0500616_0002118 | Ga0500616_0002118_3969_4523 | 157 |
| 134 | 3300053156 | Ga0500622_0000169 | Ga0500622_0000169_37682_38236 | 157 |
| 135 | 3300053156 | Ga0500622_0046522 | Ga0500622_0046522_755_1309 | 157 |
| 136 | 3300053158 | Ga0500627_0104733 | Ga0500627_0104733_544_1098 | 157 |
| 137 | iso_pu_bacteria | 2821123053 | 2821129199 | 164 |
| 138 | iso_pu_bacteria | 2838736955 | 2838742216 | 164 |
| 139 | iso_pu_bacteria | 2841840854 | 2841846072 | 164 |
| 140 | iso_pu_bacteria | 2842140634 | 2842145776 | 164 |
| 141 | iso_pu_bacteria | 2857531043 | 2857536140 | 164 |
| 142 | 3300047472 | Ga0495686_0019477 | Ga0495686_0019477_2525_3124 | 166 |
| 143 | iso_pu_bacteria | 2551306090 | 2551717198 | 166 |
| 144 | iso_pu_bacteria | 2551306090 | 2551718196 | 166 |
| 145 | iso_pu_bacteria | 2551306090 | 2551720993 | 166 |
| 146 | iso_pu_bacteria | 2585427633 | 2585998085 | 166 |
| 147 | iso_pu_bacteria | 2585427634 | 2586002664 | 166 |
| 148 | iso_pu_bacteria | 2854896431 | 2854897782 | 166 |
| 149 | iso_pu_bacteria | 2854916844 | 2854922323 | 166 |
| 150 | iso_pu_bacteria | 2919171160 | 2919176875 | 166 |
| 151 | iso_pu_bacteria | 2558860983 | 2561468559 | 167 |
| 152 | iso_pu_bacteria | 8054558443 | 8054559965 | 167 |
| 153 | iso_pu_bacteria | 8056875544 | 8056878369 | 167 |
| 154 | 3300006946 | Ga0079104_1000310 | Ga0079104_100031023 | 168 |
| 155 | 3300027111 | Ga0209281_1000028 | Ga0209281_1000028242 | 168 |
| 156 | 3300053133 | Ga0500655_000659 | Ga0500655_000659_2363_2950 | 168 |
| 157 | iso_pu_bacteria | 2508501122 | 2509108853 | 168 |
| 158 | iso_pu_bacteria | 2509276019 | 2509377983 | 168 |
| 159 | iso_pu_bacteria | 2509276021 | 2509389226 | 168 |
| 160 | iso_pu_bacteria | 2509276033 | 2509444789 | 168 |
| 161 | iso_pu_bacteria | 2510065019 | 2510135429 | 168 |
| 162 | iso_pu_bacteria | 2510065057 | 2510305830 | 168 |
| 163 | iso_pu_bacteria | 2510461076 | 2510896888 | 168 |
| 164 | iso_pu_bacteria | 2510917022 | 2511135837 | 168 |
| 165 | iso_pu_bacteria | 2510917028 | 2511185219 | 168 |
| 166 | iso_pu_bacteria | 2510917030 | 2511194247 | 168 |
| 167 | iso_pu_bacteria | 2511231052 | 2511498596 | 168 |
| 168 | iso_pu_bacteria | 2512047086 | 2512534745 | 168 |
| 169 | iso_pu_bacteria | 2512875026 | 2512973443 | 168 |
| 170 | iso_pu_bacteria | 2513237084 | 2513572872 | 168 |
| 171 | iso_pu_bacteria | 2513237085 | 2513580405 | 168 |
| 172 | iso_pu_bacteria | 2513237086 | 2513586356 | 168 |
| 173 | iso_pu_bacteria | 2513237088 | 2513597840 | 168 |
| 174 | iso_pu_bacteria | 2513237089 | 2513602040 | 168 |
| 175 | iso_pu_bacteria | 2513237091 | 2513615829 | 168 |
| 176 | iso_pu_bacteria | 2513237093 | 2513634907 | 168 |
| 177 | iso_pu_bacteria | 2513237103 | 2513711532 | 168 |
| 178 | iso_pu_bacteria | 2513237138 | 2513865119 | 168 |
| 179 | iso_pu_bacteria | 2513237140 | 2513885395 | 168 |
| 180 | iso_pu_bacteria | 2513237143 | 2513904664 | 168 |
| 181 | iso_pu_bacteria | 2513237144 | 2513912911 | 168 |
| 182 | iso_pu_bacteria | 2513237146 | 2513929504 | 168 |
| 183 | iso_pu_bacteria | 2513237156 | 2513983494 | 168 |
| 184 | iso_pu_bacteria | 2513237160 | 2514003361 | 168 |
| 185 | iso_pu_bacteria | 2513237162 | 2514023174 | 168 |
| 186 | iso_pu_bacteria | 2515075009 | 2515114601 | 168 |
| 187 | iso_pu_bacteria | 2515154107 | 2515612424 | 168 |
| 188 | iso_pu_bacteria | 2515154113 | 2515634979 | 168 |
| 189 | iso_pu_bacteria | 2515154114 | 2515644457 | 168 |
| 190 | iso_pu_bacteria | 2515154116 | 2515660966 | 168 |
| 191 | iso_pu_bacteria | 2515154134 | 2515741784 | 168 |
| 192 | iso_pu_bacteria | 2516143018 | 2516205704 | 168 |
| 193 | iso_pu_bacteria | 2516653046 | 2516894873 | 168 |
| 194 | iso_pu_bacteria | 2516653077 | 2517038244 | 168 |
| 195 | iso_pu_bacteria | 2516653085 | 2517078522 | 168 |
| 196 | iso_pu_bacteria | 2517093000 | 2517097261 | 168 |
| 197 | iso_pu_bacteria | 2517287029 | 2517408350 | 168 |
| 198 | iso_pu_bacteria | 2517487022 | 2517571554 | 168 |
| 199 | iso_pu_bacteria | 2519899620 | 2520376501 | 168 |
| 200 | iso_pu_bacteria | 2524023207 | 2524450309 | 168 |
| 201 | iso_pu_bacteria | 2524023209 | 2524461193 | 168 |
| 202 | iso_pu_bacteria | 2529292951 | 2530647173 | 168 |
| 203 | iso_pu_bacteria | 2534681796 | 2535519222 | 168 |
| 204 | iso_pu_bacteria | 2537561587 | 2537874468 | 168 |
| 205 | iso_pu_bacteria | 2551306084 | 2551678461 | 168 |
| 206 | iso_pu_bacteria | 2551306085 | 2551685182 | 168 |
| 207 | iso_pu_bacteria | 2551306086 | 2551694010 | 168 |
| 208 | iso_pu_bacteria | 2551306087 | 2551704502 | 168 |
| 209 | iso_pu_bacteria | 2551306089 | 2551710806 | 168 |
| 210 | iso_pu_bacteria | 2551306091 | 2551724604 | 168 |
| 211 | iso_pu_bacteria | 2551306092 | 2551734498 | 168 |
| 212 | iso_pu_bacteria | 2551306093 | 2551740731 | 168 |
| 213 | iso_pu_bacteria | 2554235003 | 2554248998 | 168 |
| 214 | iso_pu_bacteria | 2558860100 | 2558867516 | 168 |
| 215 | iso_pu_bacteria | 2558860242 | 2559296086 | 168 |
| 216 | iso_pu_bacteria | 2582581283 | 2585166496 | 168 |
| 217 | iso_pu_bacteria | 2582581294 | 2585201542 | 168 |
| 218 | iso_pu_bacteria | 2582581298 | 2585224117 | 168 |
| 219 | iso_pu_bacteria | 2582581299 | 2585231863 | 168 |
| 220 | iso_pu_bacteria | 2582581304 | 2585257165 | 168 |
| 221 | iso_pu_bacteria | 2582581306 | 2585267183 | 168 |
| 222 | iso_pu_bacteria | 2582581307 | 2585272073 | 168 |
| 223 | iso_pu_bacteria | 2582581308 | 2585279622 | 168 |
| 224 | iso_pu_bacteria | 2582581315 | 2585327459 | 168 |
| 225 | iso_pu_bacteria | 2582581316 | 2585334002 | 168 |
| 226 | iso_pu_bacteria | 2582581866 | 2585396169 | 168 |
| 227 | iso_pu_bacteria | 2582581867 | 2585399949 | 168 |
| 228 | iso_pu_bacteria | 2585427526 | 2585529179 | 168 |
| 229 | iso_pu_bacteria | 2585427527 | 2585535701 | 168 |
| 230 | iso_pu_bacteria | 2585427528 | 2585542996 | 168 |
| 231 | iso_pu_bacteria | 2585427529 | 2585549817 | 168 |
| 232 | iso_pu_bacteria | 2585427530 | 2585551079 | 168 |
| 233 | iso_pu_bacteria | 2585427531 | 2585563382 | 168 |
| 234 | iso_pu_bacteria | 2585427590 | 2585821038 | 168 |
| 235 | iso_pu_bacteria | 2585427593 | 2585839235 | 168 |
| 236 | iso_pu_bacteria | 2585427594 | 2585845071 | 168 |
| 237 | iso_pu_bacteria | 2585427608 | 2585897197 | 168 |
| 238 | iso_pu_bacteria | 2585427609 | 2585909111 | 168 |
| 239 | iso_pu_bacteria | 2585428125 | 2587984525 | 168 |
| 240 | iso_pu_bacteria | 2599185156 | 2599335741 | 168 |
| 241 | iso_pu_bacteria | 2599185170 | 2599419954 | 168 |
| 242 | iso_pu_bacteria | 2599185210 | 2599603121 | 168 |
| 243 | iso_pu_bacteria | 2600254933 | 2600377450 | 168 |
| 244 | iso_pu_bacteria | 2600255279 | 2601610974 | 168 |
| 245 | iso_pu_bacteria | 2600255308 | 2601747748 | 168 |
| 246 | iso_pu_bacteria | 2615840624 | 2616297539 | 168 |
| 247 | iso_pu_bacteria | 2615840626 | 2616306409 | 168 |
| 248 | iso_pu_bacteria | 2615840698 | 2616551103 | 168 |
| 249 | iso_pu_bacteria | 2617270742 | 2617382334 | 168 |
| 250 | iso_pu_bacteria | 2643221558 | 2643814895 | 168 |
| 251 | iso_pu_bacteria | 2643221568 | 2643854814 | 168 |
| 252 | iso_pu_bacteria | 2643221582 | 2643921610 | 168 |
| 253 | iso_pu_bacteria | 2643221599 | 2644002653 | 168 |
| 254 | iso_pu_bacteria | 2643221607 | 2644052450 | 168 |
| 255 | iso_pu_bacteria | 2643221634 | 2644194640 | 168 |
| 256 | iso_pu_bacteria | 2643221636 | 2644201167 | 168 |
| 257 | iso_pu_bacteria | 2643221637 | 2644209674 | 168 |
| 258 | iso_pu_bacteria | 2643221643 | 2644240305 | 168 |
| 259 | iso_pu_bacteria | 2643221686 | 2644484728 | 168 |
| 260 | iso_pu_bacteria | 2643221688 | 2644492549 | 168 |
| 261 | iso_pu_bacteria | 2643221689 | 2644501248 | 168 |
| 262 | iso_pu_bacteria | 2643221693 | 2644521664 | 168 |
| 263 | iso_pu_bacteria | 2643221718 | 2644653202 | 168 |
| 264 | iso_pu_bacteria | 2657244999 | 2657682301 | 168 |
| 265 | iso_pu_bacteria | 2667528174 | 2671116018 | 168 |
| 266 | iso_pu_bacteria | 2690316117 | 2692319829 | 168 |
| 267 | iso_pu_bacteria | 2718217882 | 2719183140 | 168 |
| 268 | iso_pu_bacteria | 2718217927 | 2719387860 | 168 |
| 269 | iso_pu_bacteria | 2718217997 | 2719667480 | 168 |
| 270 | iso_pu_bacteria | 2718218009 | 2719733857 | 168 |
| 271 | iso_pu_bacteria | 2718218199 | 2720493900 | 168 |
| 272 | iso_pu_bacteria | 2718218232 | 2720615361 | 168 |
| 273 | iso_pu_bacteria | 2718218233 | 2720622149 | 168 |
| 274 | iso_pu_bacteria | 2718218235 | 2720633503 | 168 |
| 275 | iso_pu_bacteria | 2718218269 | 2720777201 | 168 |
| 276 | iso_pu_bacteria | 2718218363 | 2721149252 | 168 |
| 277 | iso_pu_bacteria | 2718218365 | 2721160654 | 168 |
| 278 | iso_pu_bacteria | 2718218366 | 2721166065 | 168 |
| 279 | iso_pu_bacteria | 2718218423 | 2721401493 | 168 |
| 280 | iso_pu_bacteria | 2721755514 | 2722842235 | 168 |
| 281 | iso_pu_bacteria | 2721755556 | 2723028799 | 168 |
| 282 | iso_pu_bacteria | 2721755684 | 2723562412 | 168 |
| 283 | iso_pu_bacteria | 2721755685 | 2723569108 | 168 |
| 284 | iso_pu_bacteria | 2721755809 | 2724040307 | 168 |
| 285 | iso_pu_bacteria | 2721755810 | 2724046613 | 168 |
| 286 | iso_pu_bacteria | 2721755819 | 2724091808 | 168 |
| 287 | iso_pu_bacteria | 2721755822 | 2724106373 | 168 |
| 288 | iso_pu_bacteria | 2721755823 | 2724112180 | 168 |
| 289 | iso_pu_bacteria | 2724679232 | 2725945791 | 168 |
| 290 | iso_pu_bacteria | 2728369352 | 2730109735 | 168 |
| 291 | iso_pu_bacteria | 2728369365 | 2730166375 | 168 |
| 292 | iso_pu_bacteria | 2728369397 | 2730300286 | 168 |
| 293 | iso_pu_bacteria | 2738541293 | 2738801014 | 168 |
| 294 | iso_pu_bacteria | 2738541333 | 2739037691 | 168 |
| 295 | iso_pu_bacteria | 2751185821 | 2753458470 | 168 |
| 296 | iso_pu_bacteria | 2765235942 | 2766064074 | 168 |
| 297 | iso_pu_bacteria | 2775507266 | 2778179227 | 168 |
| 298 | iso_pu_bacteria | 2791355082 | 2792582348 | 168 |
| 299 | iso_pu_bacteria | 2791355091 | 2792621798 | 168 |
| 300 | iso_pu_bacteria | 2791355092 | 2792628945 | 168 |
| 301 | iso_pu_bacteria | 2791355094 | 2792640085 | 168 |
| 302 | iso_pu_bacteria | 2791355253 | 2793281841 | 168 |
| 303 | iso_pu_bacteria | 2791355256 | 2793295453 | 168 |
| 304 | iso_pu_bacteria | 2791355259 | 2793317951 | 168 |
| 305 | iso_pu_bacteria | 2791355260 | 2793324573 | 168 |
| 306 | iso_pu_bacteria | 2791355261 | 2793329616 | 168 |
| 307 | iso_pu_bacteria | 2791355262 | 2793332412 | 168 |
| 308 | iso_pu_bacteria | 2791355263 | 2793339006 | 168 |
| 309 | iso_pu_bacteria | 2791355264 | 2793346776 | 168 |
| 310 | iso_pu_bacteria | 2791355265 | 2793356792 | 168 |
| 311 | iso_pu_bacteria | 2791355266 | 2793359196 | 168 |
| 312 | iso_pu_bacteria | 2791355267 | 2793366080 | 168 |
| 313 | iso_pu_bacteria | 2802428858 | 2802717080 | 168 |
| 314 | iso_pu_bacteria | 2802428859 | 2802724932 | 168 |
| 315 | iso_pu_bacteria | 2802428860 | 2802729682 | 168 |
| 316 | iso_pu_bacteria | 2802428861 | 2802737028 | 168 |
| 317 | iso_pu_bacteria | 2802428862 | 2802743433 | 168 |
| 318 | iso_pu_bacteria | 2802428863 | 2802749441 | 168 |
| 319 | iso_pu_bacteria | 2802429268 | 2804753805 | 168 |
| 320 | iso_pu_bacteria | 2802429605 | 2805930919 | 168 |
| 321 | iso_pu_bacteria | 2802429606 | 2805936768 | 168 |
| 322 | iso_pu_bacteria | 2802429633 | 2806047764 | 168 |
| 323 | iso_pu_bacteria | 2802429634 | 2806055340 | 168 |
| 324 | iso_pu_bacteria | 2802429635 | 2806062221 | 168 |
| 325 | iso_pu_bacteria | 2802429636 | 2806070020 | 168 |
| 326 | iso_pu_bacteria | 2802429637 | 2806076680 | 168 |
| 327 | iso_pu_bacteria | 2808606387 | 2808988088 | 168 |
| 328 | iso_pu_bacteria | 2818991439 | 2819561096 | 168 |
| 329 | iso_pu_bacteria | 2818991448 | 2819611983 | 168 |
| 330 | iso_pu_bacteria | 2818991453 | 2819638477 | 168 |
| 331 | iso_pu_bacteria | 2838016132 | 2838018146 | 168 |
| 332 | iso_pu_bacteria | 2838022645 | 2838023826 | 168 |
| 333 | iso_pu_bacteria | 2838029111 | 2838034130 | 168 |
| 334 | iso_pu_bacteria | 2838035591 | 2838042004 | 168 |
| 335 | iso_pu_bacteria | 2838042994 | 2838046766 | 168 |
| 336 | iso_pu_bacteria | 2838048938 | 2838050995 | 168 |
| 337 | iso_pu_bacteria | 2838061910 | 2838062761 | 168 |
| 338 | iso_pu_bacteria | 2838068647 | 2838072306 | 168 |
| 339 | iso_pu_bacteria | 2838074704 | 2838078053 | 168 |
| 340 | iso_pu_bacteria | 2838661181 | 2838668145 | 168 |
| 341 | iso_pu_bacteria | 2838668709 | 2838674239 | 168 |
| 342 | iso_pu_bacteria | 2838675328 | 2838678533 | 168 |
| 343 | iso_pu_bacteria | 2838680041 | 2838683698 | 168 |
| 344 | iso_pu_bacteria | 2838686498 | 2838693355 | 168 |
| 345 | iso_pu_bacteria | 2838694306 | 2838698226 | 168 |
| 346 | iso_pu_bacteria | 2838701080 | 2838706642 | 168 |
| 347 | iso_pu_bacteria | 2838707686 | 2838711341 | 168 |
| 348 | iso_pu_bacteria | 2838714209 | 2838718379 | 168 |
| 349 | iso_pu_bacteria | 2838719591 | 2838722829 | 168 |
| 350 | iso_pu_bacteria | 2838724970 | 2838728445 | 168 |
| 351 | iso_pu_bacteria | 2838729681 | 2838735349 | 168 |
| 352 | iso_pu_bacteria | 2838742623 | 2838748102 | 168 |
| 353 | iso_pu_bacteria | 2841846520 | 2841850385 | 168 |
| 354 | iso_pu_bacteria | 2841851746 | 2841857421 | 168 |
| 355 | iso_pu_bacteria | 2841859092 | 2841863362 | 168 |
| 356 | iso_pu_bacteria | 2841864319 | 2841867575 | 168 |
| 357 | iso_pu_bacteria | 2842077413 | 2842081142 | 168 |
| 358 | iso_pu_bacteria | 2842110456 | 2842116606 | 168 |
| 359 | iso_pu_bacteria | 2842118031 | 2842122081 | 168 |
| 360 | iso_pu_bacteria | 2842124991 | 2842129105 | 168 |
| 361 | iso_pu_bacteria | 2842130223 | 2842133426 | 168 |
| 362 | iso_pu_bacteria | 2842146304 | 2842148971 | 168 |
| 363 | iso_pu_bacteria | 2842152218 | 2842155663 | 168 |
| 364 | iso_pu_bacteria | 2842156927 | 2842162404 | 168 |
| 365 | iso_pu_bacteria | 2842163707 | 2842166895 | 168 |
| 366 | iso_pu_bacteria | 2842170452 | 2842174379 | 168 |
| 367 | iso_pu_bacteria | 2842175837 | 2842179040 | 168 |
| 368 | iso_pu_bacteria | 2842180545 | 2842186044 | 168 |
| 369 | iso_pu_bacteria | 2842187318 | 2842190803 | 168 |
| 370 | iso_pu_bacteria | 2842192696 | 2842194708 | 168 |
| 371 | iso_pu_bacteria | 2842198810 | 2842201181 | 168 |
| 372 | iso_pu_bacteria | 2842205361 | 2842207593 | 168 |
| 373 | iso_pu_bacteria | 2842211629 | 2842214873 | 168 |
| 374 | iso_pu_bacteria | 2842217011 | 2842221967 | 168 |
| 375 | iso_pu_bacteria | 2842224351 | 2842227594 | 168 |
| 376 | iso_pu_bacteria | 2842229732 | 2842235503 | 168 |
| 377 | iso_pu_bacteria | 2842237096 | 2842241095 | 168 |
| 378 | iso_pu_bacteria | 2842243621 | 2842249214 | 168 |
| 379 | iso_pu_bacteria | 2842250916 | 2842256433 | 168 |
| 380 | iso_pu_bacteria | 2842257432 | 2842263169 | 168 |
| 381 | iso_pu_bacteria | 2842264693 | 2842269266 | 168 |
| 382 | iso_pu_bacteria | 2842271015 | 2842277823 | 168 |
| 383 | iso_pu_bacteria | 2842278818 | 2842280696 | 168 |
| 384 | iso_pu_bacteria | 2842285085 | 2842290358 | 168 |
| 385 | iso_pu_bacteria | 2842291075 | 2842294799 | 168 |
| 386 | iso_pu_bacteria | 2842298080 | 2842302637 | 168 |
| 387 | iso_pu_bacteria | 2842304105 | 2842305634 | 168 |
| 388 | iso_pu_bacteria | 2842311132 | 2842311598 | 168 |
| 389 | iso_pu_bacteria | 2842317721 | 2842323658 | 168 |
| 390 | iso_pu_bacteria | 2842341865 | 2842346880 | 168 |
| 391 | iso_pu_bacteria | 2842357229 | 2842358861 | 168 |
| 392 | iso_pu_bacteria | 2842363717 | 2842366089 | 168 |
| 393 | iso_pu_bacteria | 2842370503 | 2842375183 | 168 |
| 394 | iso_pu_bacteria | 2842377471 | 2842381197 | 168 |
| 395 | iso_pu_bacteria | 2842384541 | 2842388268 | 168 |
| 396 | iso_pu_bacteria | 2842395702 | 2842395758 | 168 |
| 397 | iso_pu_bacteria | 2842402390 | 2842408192 | 168 |
| 398 | iso_pu_bacteria | 2842409023 | 2842414954 | 168 |
| 399 | iso_pu_bacteria | 2842415677 | 2842421537 | 168 |
| 400 | iso_pu_bacteria | 2842422224 | 2842425938 | 168 |
| 401 | iso_pu_bacteria | 2842428310 | 2842433450 | 168 |
| 402 | iso_pu_bacteria | 2842434925 | 2842439495 | 168 |
| 403 | iso_pu_bacteria | 2842441272 | 2842446197 | 168 |
| 404 | iso_pu_bacteria | 2842447887 | 2842448564 | 168 |
| 405 | iso_pu_bacteria | 2842462802 | 2842467699 | 168 |
| 406 | iso_pu_bacteria | 2842469257 | 2842474337 | 168 |
| 407 | iso_pu_bacteria | 2842475841 | 2842480902 | 168 |
| 408 | iso_pu_bacteria | 2842482326 | 2842485291 | 168 |
| 409 | iso_pu_bacteria | 2842489311 | 2842491350 | 168 |
| 410 | iso_pu_bacteria | 2842495871 | 2842501915 | 168 |
| 411 | iso_pu_bacteria | 2842502639 | 2842507487 | 168 |
| 412 | iso_pu_bacteria | 2842515876 | 2842519901 | 168 |
| 413 | iso_pu_bacteria | 2842521101 | 2842527066 | 168 |
| 414 | iso_pu_bacteria | 2842922631 | 2842926471 | 168 |
| 415 | iso_pu_bacteria | 2844163670 | 2844168163 | 168 |
| 416 | iso_pu_bacteria | 2844454524 | 2844456796 | 168 |
| 417 | iso_pu_bacteria | 2847417321 | 2847420947 | 168 |
| 418 | iso_pu_bacteria | 2848992105 | 2848995778 | 168 |
| 419 | iso_pu_bacteria | 2850079185 | 2850082761 | 168 |
| 420 | iso_pu_bacteria | 2852387548 | 2852387550 | 168 |
| 421 | iso_pu_bacteria | 2855825444 | 2855827507 | 168 |
| 422 | iso_pu_bacteria | 2855839649 | 2855842882 | 168 |
| 423 | iso_pu_bacteria | 2855872281 | 2855873642 | 168 |
| 424 | iso_pu_bacteria | 2857516855 | 2857519770 | 168 |
| 425 | iso_pu_bacteria | 2858800743 | 2858803560 | 168 |
| 426 | iso_pu_bacteria | 2891373044 | 2891377783 | 168 |
| 427 | iso_pu_bacteria | 2896384573 | 2896390077 | 168 |
| 428 | iso_pu_bacteria | 2899792073 | 2899794810 | 168 |
| 429 | iso_pu_bacteria | 2899845264 | 2899849437 | 168 |
| 430 | iso_pu_bacteria | 2913295892 | 2913300294 | 168 |
| 431 | iso_pu_bacteria | 2915980308 | 2915981705 | 168 |
| 432 | iso_pu_bacteria | 2915986958 | 2915991912 | 168 |
| 433 | iso_pu_bacteria | 2915993759 | 2915999558 | 168 |
| 434 | iso_pu_bacteria | 2916000859 | 2916004467 | 168 |
| 435 | iso_pu_bacteria | 2916007675 | 2916013449 | 168 |
| 436 | iso_pu_bacteria | 2916014648 | 2916019873 | 168 |
| 437 | iso_pu_bacteria | 2916021584 | 2916023939 | 168 |
| 438 | iso_pu_bacteria | 2916028427 | 2916031864 | 168 |
| 439 | iso_pu_bacteria | 2916035215 | 2916040505 | 168 |
| 440 | iso_pu_bacteria | 2916041962 | 2916043438 | 168 |
| 441 | iso_pu_bacteria | 2916048683 | 2916050637 | 168 |
| 442 | iso_pu_bacteria | 2916055098 | 2916058699 | 168 |
| 443 | iso_pu_bacteria | 2916061851 | 2916066476 | 168 |
| 444 | iso_pu_bacteria | 2916068649 | 2916074696 | 168 |
| 445 | iso_pu_bacteria | 2916076590 | 2916077660 | 168 |
| 446 | iso_pu_bacteria | 2919100787 | 2919107953 | 168 |
| 447 | iso_pu_bacteria | 2919114240 | 2919118364 | 168 |
| 448 | iso_pu_bacteria | 2919408235 | 2919411464 | 168 |
| 449 | iso_pu_bacteria | 2920760137 | 2920760207 | 168 |
| 450 | iso_pu_bacteria | 2920822456 | 2920826066 | 168 |
| 451 | iso_pu_bacteria | 2921201388 | 2921205060 | 168 |
| 452 | iso_pu_bacteria | 2921208531 | 2921212022 | 168 |
| 453 | iso_pu_bacteria | 2921237296 | 2921240348 | 168 |
| 454 | iso_pu_bacteria | 2921244191 | 2921245623 | 168 |
| 455 | iso_pu_bacteria | 2921250672 | 2921252794 | 168 |
| 456 | iso_pu_bacteria | 2921257292 | 2921260433 | 168 |
| 457 | iso_pu_bacteria | 2921263974 | 2921267517 | 168 |
| 458 | iso_pu_bacteria | 2921282425 | 2921287324 | 168 |
| 459 | iso_pu_bacteria | 2921289301 | 2921293988 | 168 |
| 460 | iso_pu_bacteria | 2921296804 | 2921302530 | 168 |
| 461 | iso_pu_bacteria | 2923556063 | 2923559960 | 168 |
| 462 | iso_pu_bacteria | 2924144063 | 2924144817 | 168 |
| 463 | iso_pu_bacteria | 2924150972 | 2924157668 | 168 |
| 464 | iso_pu_bacteria | 2924158325 | 2924158774 | 168 |
| 465 | iso_pu_bacteria | 2924165586 | 2924168518 | 168 |
| 466 | iso_pu_bacteria | 2924172951 | 2924175806 | 168 |
| 467 | iso_pu_bacteria | 2924179722 | 2924183459 | 168 |
| 468 | iso_pu_bacteria | 2924186466 | 2924190206 | 168 |
| 469 | iso_pu_bacteria | 2924193448 | 2924193477 | 168 |
| 470 | iso_pu_bacteria | 2924200457 | 2924201454 | 168 |
| 471 | iso_pu_bacteria | 2924207177 | 2924207798 | 168 |
| 472 | iso_pu_bacteria | 2924214083 | 2924214882 | 168 |
| 473 | iso_pu_bacteria | 2924221636 | 2924227141 | 168 |
| 474 | iso_pu_bacteria | 2924228884 | 2924234028 | 168 |
| 475 | iso_pu_bacteria | 2926754445 | 2926754893 | 168 |
| 476 | iso_pu_bacteria | 2926760298 | 2926762058 | 168 |
| 477 | iso_pu_bacteria | 2929138655 | 2929142010 | 168 |
| 478 | iso_pu_bacteria | 2933006813 | 2933010491 | 168 |
| 479 | iso_pu_bacteria | 2933011516 | 2933015837 | 168 |
| 480 | iso_pu_bacteria | 2933016740 | 2933017806 | 168 |
| 481 | iso_pu_bacteria | 2933570622 | 2933572141 | 168 |
| 482 | iso_pu_bacteria | 2933586486 | 2933592788 | 168 |
| 483 | iso_pu_bacteria | 2933594066 | 2933597425 | 168 |
| 484 | iso_pu_bacteria | 2933599457 | 2933602842 | 168 |
| 485 | iso_pu_bacteria | 2935894831 | 2935898120 | 168 |
| 486 | iso_pu_bacteria | 2935901341 | 2935903438 | 168 |
| 487 | iso_pu_bacteria | 2936367885 | 2936370088 | 168 |
| 488 | iso_pu_bacteria | 2936375103 | 2936379264 | 168 |
| 489 | iso_pu_bacteria | 2936381700 | 2936381758 | 168 |
| 490 | iso_pu_bacteria | 2936996657 | 2936997444 | 168 |
| 491 | iso_pu_bacteria | 2937002841 | 2937004092 | 168 |
| 492 | iso_pu_bacteria | 2937009748 | 2937010371 | 168 |
| 493 | iso_pu_bacteria | 2937016420 | 2937020637 | 168 |
| 494 | iso_pu_bacteria | 2937023124 | 2937023168 | 168 |
| 495 | iso_pu_bacteria | 2937029754 | 2937031717 | 168 |
| 496 | iso_pu_bacteria | 2937036028 | 2937037784 | 168 |
| 497 | iso_pu_bacteria | 2937042894 | 2937043164 | 168 |
| 498 | iso_pu_bacteria | 2937049772 | 2937053547 | 168 |
| 499 | iso_pu_bacteria | 2937056579 | 2937059365 | 168 |
| 500 | iso_pu_bacteria | 2937063883 | 2937070507 | 168 |
| 501 | iso_pu_bacteria | 2937071275 | 2937076109 | 168 |
| 502 | iso_pu_bacteria | 2937078374 | 2937081498 | 168 |
| 503 | iso_pu_bacteria | 2937084907 | 2937090870 | 168 |
| 504 | iso_pu_bacteria | 2937091812 | 2937093354 | 168 |
| 505 | iso_pu_bacteria | 2937098957 | 2937104319 | 168 |
| 506 | iso_pu_bacteria | 2937106411 | 2937113252 | 168 |
| 507 | iso_pu_bacteria | 2937113482 | 2937114252 | 168 |
| 508 | iso_pu_bacteria | 2937119839 | 2937120250 | 168 |
| 509 | iso_pu_bacteria | 2937126314 | 2937129769 | 168 |
| 510 | iso_pu_bacteria | 2937843397 | 2937843738 | 168 |
| 511 | iso_pu_bacteria | 2957375807 | 2957376784 | 168 |
| 512 | iso_pu_bacteria | 2957382221 | 2957384913 | 168 |
| 513 | iso_pu_bacteria | 2957388812 | 2957395188 | 168 |
| 514 | iso_pu_bacteria | 2957395598 | 2957399717 | 168 |
| 515 | iso_pu_bacteria | 2957402308 | 2957405539 | 168 |
| 516 | iso_pu_bacteria | 2957408893 | 2957411704 | 168 |
| 517 | iso_pu_bacteria | 2957415311 | 2957417461 | 168 |
| 518 | iso_pu_bacteria | 2957422303 | 2957422374 | 168 |
| 519 | iso_pu_bacteria | 2957430029 | 2957430088 | 168 |
| 520 | iso_pu_bacteria | 2957437181 | 2957441678 | 168 |
| 521 | iso_pu_bacteria | 2957443900 | 2957447647 | 168 |
| 522 | iso_pu_bacteria | 2957450854 | 2957454669 | 168 |
| 523 | iso_pu_bacteria | 2957457609 | 2957461008 | 168 |
| 524 | iso_pu_bacteria | 2957464669 | 2957466499 | 168 |
| 525 | iso_pu_bacteria | 2957471148 | 2957475385 | 168 |
| 526 | iso_pu_bacteria | 2957478035 | 2957481443 | 168 |
| 527 | iso_pu_bacteria | 2957484790 | 2957489075 | 168 |
| 528 | iso_pu_bacteria | 2957491536 | 2957494425 | 168 |
| 529 | iso_pu_bacteria | 2957498199 | 2957505164 | 168 |
| 530 | iso_pu_bacteria | 2957505466 | 2957508276 | 168 |
| 531 | iso_pu_bacteria | 2960584000 | 2960589437 | 168 |
| 532 | iso_pu_bacteria | 2960591022 | 2960592808 | 168 |
| 533 | iso_pu_bacteria | 2960597568 | 2960597889 | 168 |
| 534 | iso_pu_bacteria | 2960603979 | 2960607481 | 168 |
| 535 | iso_pu_bacteria | 2960610863 | 2960613669 | 168 |
| 536 | iso_pu_bacteria | 2960617483 | 2960619083 | 168 |
| 537 | iso_pu_bacteria | 2960624210 | 2960629070 | 168 |
| 538 | iso_pu_bacteria | 2960631154 | 2960634205 | 168 |
| 539 | iso_pu_bacteria | 2960637947 | 2960643575 | 168 |
| 540 | iso_pu_bacteria | 2960645483 | 2960650714 | 168 |
| 541 | iso_pu_bacteria | 2960652885 | 2960655916 | 168 |
| 542 | iso_pu_bacteria | 2960660292 | 2960663971 | 168 |
| 543 | iso_pu_bacteria | 2960667422 | 2960673297 | 168 |
| 544 | iso_pu_bacteria | 2960674078 | 2960674874 | 168 |
| 545 | iso_pu_bacteria | 2960680706 | 2960681733 | 168 |
| 546 | iso_pu_bacteria | 2960687367 | 2960689327 | 168 |
| 547 | iso_pu_bacteria | 2960693952 | 2960700659 | 168 |
| 548 | iso_pu_bacteria | 2964607997 | 2964608217 | 168 |
| 549 | iso_pu_bacteria | 2964615318 | 2964621661 | 168 |
| 550 | iso_pu_bacteria | 2964621998 | 2964625839 | 168 |
| 551 | iso_pu_bacteria | 2964628898 | 2964629542 | 168 |
| 552 | iso_pu_bacteria | 2964636051 | 2964639231 | 168 |
| 553 | iso_pu_bacteria | 2964643177 | 2964643600 | 168 |
| 554 | iso_pu_bacteria | 2964649959 | 2964655204 | 168 |
| 555 | iso_pu_bacteria | 2964656573 | 2964659987 | 168 |
| 556 | iso_pu_bacteria | 2964663802 | 2964669408 | 168 |
| 557 | iso_pu_bacteria | 2964670856 | 2964676858 | 168 |
| 558 | iso_pu_bacteria | 2964678106 | 2964681671 | 168 |
| 559 | iso_pu_bacteria | 2964685014 | 2964687461 | 168 |
| 560 | iso_pu_bacteria | 2964691889 | 2964695150 | 168 |
| 561 | iso_pu_bacteria | 2964698721 | 2964699168 | 168 |
| 562 | iso_pu_bacteria | 2964705432 | 2964711195 | 168 |
| 563 | iso_pu_bacteria | 2964712639 | 2964712651 | 168 |
| 564 | iso_pu_bacteria | 2964719344 | 2964719772 | 168 |
| 565 | iso_pu_bacteria | 2967664464 | 2967668266 | 168 |
| 566 | iso_pu_bacteria | 2967671571 | 2967675615 | 168 |
| 567 | iso_pu_bacteria | 2967678726 | 2967681256 | 168 |
| 568 | iso_pu_bacteria | 2967686174 | 2967692419 | 168 |
| 569 | iso_pu_bacteria | 2967693043 | 2967699407 | 168 |
| 570 | iso_pu_bacteria | 2967699805 | 2967704821 | 168 |
| 571 | iso_pu_bacteria | 2967706974 | 2967713017 | 168 |
| 572 | iso_pu_bacteria | 2967714385 | 2967721204 | 168 |
| 573 | iso_pu_bacteria | 2967721400 | 2967724954 | 168 |
| 574 | iso_pu_bacteria | 2967728569 | 2967731840 | 168 |
| 575 | iso_pu_bacteria | 2967735183 | 2967738471 | 168 |
| 576 | iso_pu_bacteria | 2967742019 | 2967745468 | 168 |
| 577 | iso_pu_bacteria | 2967748971 | 2967752608 | 168 |
| 578 | iso_pu_bacteria | 2967755722 | 2967757755 | 168 |
| 579 | iso_pu_bacteria | 2967762386 | 2967765788 | 168 |
| 580 | iso_pu_bacteria | 2967769361 | 2967770338 | 168 |
| 581 | iso_pu_bacteria | 2967775926 | 2967780507 | 168 |
| 582 | iso_pu_bacteria | 2970019648 | 2970021997 | 168 |
| 583 | iso_pu_bacteria | 2970026789 | 2970028670 | 168 |
| 584 | iso_pu_bacteria | 2970033650 | 2970038975 | 168 |
| 585 | iso_pu_bacteria | 2970040964 | 2970046607 | 168 |
| 586 | iso_pu_bacteria | 2970047711 | 2970049616 | 168 |
| 587 | iso_pu_bacteria | 2970054988 | 2970058828 | 168 |
| 588 | iso_pu_bacteria | 2970061556 | 2970066752 | 168 |
| 589 | iso_pu_bacteria | 2970068827 | 2970071182 | 168 |
| 590 | iso_pu_bacteria | 2970076120 | 2970076710 | 168 |
| 591 | iso_pu_bacteria | 2970082768 | 2970086757 | 168 |
| 592 | iso_pu_bacteria | 2970088815 | 2970092735 | 168 |
| 593 | iso_pu_bacteria | 2970095765 | 2970101179 | 168 |
| 594 | iso_pu_bacteria | 2970102677 | 2970104603 | 168 |
| 595 | iso_pu_bacteria | 2970109326 | 2970113935 | 168 |
| 596 | iso_pu_bacteria | 2970116247 | 2970118382 | 168 |
| 597 | iso_pu_bacteria | 2970122695 | 2970124498 | 168 |
| 598 | iso_pu_bacteria | 2970129317 | 2970133514 | 168 |
| 599 | iso_pu_bacteria | 2970136068 | 2970140885 | 168 |
| 600 | iso_pu_bacteria | 2970143518 | 2970147343 | 168 |
| 601 | iso_pu_bacteria | 2970149975 | 2970155849 | 168 |
| 602 | iso_pu_bacteria | 2970156795 | 2970161192 | 168 |
| 603 | iso_pu_bacteria | 2970164137 | 2970170747 | 168 |
| 604 | iso_pu_bacteria | 2970170962 | 2970174080 | 168 |
| 605 | iso_pu_bacteria | 2970177841 | 2970182110 | 168 |
| 606 | iso_pu_bacteria | 2970184632 | 2970189131 | 168 |
| 607 | iso_pu_bacteria | 2970191845 | 2970197905 | 168 |
| 608 | iso_pu_bacteria | 2977516862 | 2977520216 | 168 |
| 609 | iso_pu_bacteria | 2977523885 | 2977527405 | 168 |
| 610 | iso_pu_bacteria | 2977530762 | 2977531208 | 168 |
| 611 | iso_pu_bacteria | 2977537788 | 2977544462 | 168 |
| 612 | iso_pu_bacteria | 2977544691 | 2977547484 | 168 |
| 613 | iso_pu_bacteria | 2977551784 | 2977558004 | 168 |
| 614 | iso_pu_bacteria | 2977558990 | 2977564715 | 168 |
| 615 | iso_pu_bacteria | 2977565890 | 2977571320 | 168 |
| 616 | iso_pu_bacteria | 2977572785 | 2977577254 | 168 |
| 617 | iso_pu_bacteria | 2977579622 | 2977583335 | 168 |
| 618 | iso_pu_bacteria | 2978969890 | 2978972754 | 168 |
| 619 | iso_pu_bacteria | 2979089926 | 2979092673 | 168 |
| 620 | iso_pu_bacteria | 2979095461 | 2979099936 | 168 |
| 621 | iso_pu_bacteria | 2979100975 | 2979104645 | 168 |
| 622 | iso_pu_bacteria | 2984509177 | 2984513558 | 168 |
| 623 | iso_pu_bacteria | 2984518228 | 2984522862 | 168 |
| 624 | iso_pu_bacteria | 2984537506 | 2984542170 | 168 |
| 625 | iso_pu_bacteria | 2984587000 | 2984591006 | 168 |
| 626 | iso_pu_bacteria | 2984601300 | 2984601598 | 168 |
| 627 | iso_pu_bacteria | 2989349275 | 2989355082 | 168 |
| 628 | iso_pu_bacteria | 2996887358 | 2996890467 | 168 |
| 629 | iso_pu_bacteria | 2996893221 | 2996896200 | 168 |
| 630 | iso_pu_bacteria | 3003930520 | 3003931150 | 168 |
| 631 | iso_pu_bacteria | 3005416602 | 3005416878 | 168 |
| 632 | iso_pu_bacteria | 3005445848 | 3005449854 | 168 |
| 633 | iso_pu_bacteria | 3005452660 | 3005456145 | 168 |
| 634 | iso_pu_bacteria | 639633055 | 639645860 | 168 |
| 635 | iso_pu_bacteria | 643692032 | 643827535 | 168 |
| 636 | iso_pu_bacteria | 648276728 | 648737316 | 168 |
| 637 | iso_pu_bacteria | 650716007 | 650738503 | 168 |
| 638 | iso_pu_bacteria | 8003570095 | 8003573636 | 168 |
| 639 | iso_pu_bacteria | 8003992118 | 8003995463 | 168 |
| 640 | iso_pu_bacteria | 8003999396 | 8004003222 | 168 |
| 641 | iso_pu_bacteria | 8005258706 | 8005262654 | 168 |
| 642 | iso_pu_bacteria | 8005275841 | 8005282618 | 168 |
| 643 | iso_pu_bacteria | 8005282627 | 8005286567 | 168 |
| 644 | iso_pu_bacteria | 8005289223 | 8005291995 | 168 |
| 645 | iso_pu_bacteria | 8005301065 | 8005306134 | 168 |
| 646 | iso_pu_bacteria | 8005307578 | 8005309708 | 168 |
| 647 | iso_pu_bacteria | 8005314921 | 8005315918 | 168 |
| 648 | iso_pu_bacteria | 8005321885 | 8005324994 | 168 |
| 649 | iso_pu_bacteria | 8005376324 | 8005381382 | 168 |
| 650 | iso_pu_bacteria | 8005382845 | 8005387592 | 168 |
| 651 | iso_pu_bacteria | 8005395548 | 8005398428 | 168 |
| 652 | iso_pu_bacteria | 8005430974 | 8005431971 | 168 |
| 653 | iso_pu_bacteria | 8005460587 | 8005465296 | 168 |
| 654 | iso_pu_bacteria | 8005484373 | 8005487005 | 168 |
| 655 | iso_pu_bacteria | 8005497431 | 8005497874 | 168 |
| 656 | iso_pu_bacteria | 8005542996 | 8005546879 | 168 |
| 657 | iso_pu_bacteria | 8005556819 | 8005561361 | 168 |
| 658 | iso_pu_bacteria | 8005563573 | 8005565983 | 168 |
| 659 | iso_pu_bacteria | 8005570704 | 8005572033 | 168 |
| 660 | iso_pu_bacteria | 8005619151 | 8005623608 | 168 |
| 661 | iso_pu_bacteria | 8005626139 | 8005630831 | 168 |
| 662 | iso_pu_bacteria | 8005645114 | 8005645202 | 168 |
| 663 | iso_pu_bacteria | 8005658619 | 8005660972 | 168 |
| 664 | iso_pu_bacteria | 8005668836 | 8005669280 | 168 |
| 665 | iso_pu_bacteria | 8005682033 | 8005687352 | 168 |
| 666 | iso_pu_bacteria | 8005688590 | 8005694169 | 168 |
| 667 | iso_pu_bacteria | 8005695170 | 8005695815 | 168 |
| 668 | iso_pu_bacteria | 8018127388 | 8018128660 | 168 |
| 669 | iso_pu_bacteria | 8018163183 | 8018164902 | 168 |
| 670 | iso_pu_bacteria | 8018176218 | 8018177658 | 168 |
| 671 | iso_pu_bacteria | 8023680758 | 8023686739 | 168 |
| 672 | iso_pu_bacteria | 8024479707 | 8024484559 | 168 |
| 673 | iso_pu_bacteria | 8024486573 | 8024491022 | 168 |
| 674 | iso_pu_bacteria | 8024501048 | 8024504031 | 168 |
| 675 | iso_pu_bacteria | 8046767195 | 8046768362 | 168 |
| 676 | iso_pu_bacteria | 8049293176 | 8049296405 | 168 |
| 677 | iso_pu_bacteria | 8055431914 | 8055432965 | 168 |
| 678 | iso_pu_bacteria | 8056375014 | 8056380592 | 168 |
| 679 | iso_pu_bacteria | 8056382006 | 8056383348 | 168 |
| 680 | iso_pu_bacteria | 8057575449 | 8057581969 | 168 |
| 681 | iso_pu_bacteria | 8057874678 | 8057879477 | 168 |
| 682 | iso_pu_bacteria | 2599185352 | 2600193983 | 169 |
| 683 | iso_pu_bacteria | 2643221557 | 2643807931 | 169 |
| 684 | iso_pu_bacteria | 2643221610 | 2644068878 | 169 |
| 685 | iso_pu_bacteria | 2643221618 | 2644105753 | 169 |
| 686 | iso_pu_bacteria | 2643221626 | 2644146363 | 169 |
| 687 | iso_pu_bacteria | 2643221655 | 2644310366 | 169 |
| 688 | iso_pu_bacteria | 2643221659 | 2644334849 | 169 |
| 689 | iso_pu_bacteria | 2643221668 | 2644378396 | 169 |
| 690 | iso_pu_bacteria | 2643221675 | 2644419949 | 169 |
| 691 | iso_pu_bacteria | 2643221680 | 2644453305 | 169 |
| 692 | iso_pu_bacteria | 2643221698 | 2644544957 | 169 |
| 693 | iso_pu_bacteria | 2643221712 | 2644615393 | 169 |
| 694 | iso_pu_bacteria | 2643221723 | 2644675104 | 169 |
| 695 | iso_pu_bacteria | 2643221726 | 2644688668 | 169 |
| 696 | iso_pu_bacteria | 2941499720 | 2941501490 | 169 |
| 697 | 3300005548 | Ga0070665_100842109 | Ga0070665_1008421091 | 170 |
| 698 | 3300028379 | Ga0268266_11277225 | Ga0268266_112772251 | 170 |
| 699 | 3300039437 | Ga0436365_0373990 | Ga0436365_0373990_58_648 | 170 |
| 700 | 3300053158 | Ga0500627_0033906 | Ga0500627_0033906_1296_1895 | 170 |
| 701 | 3300048928 | Ga0496125_0146081 | Ga0496125_0146081_43_639 | 171 |
| 702 | 2010549000 | RicEn_FSXC55064_g1 | RicEn_475320 | 172 |
| 703 | 3300001979 | JGI24740J21852_10026035 | JGI24740J21852_100260353 | 172 |
| 704 | 3300002705 | JGI25156J39149_1000055 | JGI25156J39149_100005555 | 172 |
| 705 | 3300002737 | JGI25162J39368_1000601 | JGI25162J39368_100060127 | 172 |
| 706 | 3300002737 | JGI25162J39368_1000903 | JGI25162J39368_10009034 | 172 |
| 707 | 3300002738 | JGI25154J39366_1000069 | JGI25154J39366_100006939 | 172 |
| 708 | 3300002741 | JGI25157J39369_1000076 | JGI25157J39369_100007655 | 172 |
| 709 | 3300002773 | JGI25152J39213_1000820 | JGI25152J39213_10008209 | 172 |
| 710 | 3300002773 | JGI25152J39213_1004374 | JGI25152J39213_10043745 | 172 |
| 711 | 3300002773 | JGI25152J39213_1005150 | JGI25152J39213_10051505 | 172 |
| 712 | 3300002773 | JGI25152J39213_1005217 | JGI25152J39213_10052175 | 172 |
| 713 | 3300002773 | JGI25152J39213_1007563 | JGI25152J39213_10075632 | 172 |
| 714 | 3300002774 | JGI25150J39212_1002566 | JGI25150J39212_10025663 | 172 |
| 715 | 3300002987 | JGI25159J45721_1000022 | JGI25159J45721_100002232 | 172 |
| 716 | 3300003187 | JGI25151J46595_10015738 | JGI25151J46595_100157384 | 172 |
| 717 | 3300003187 | JGI25151J46595_10018505 | JGI25151J46595_100185053 | 172 |
| 718 | 3300003187 | JGI25151J46595_10027614 | JGI25151J46595_100276144 | 172 |
| 719 | 3300003214 | JGI25165J46597_1000974 | JGI25165J46597_10009744 | 172 |
| 720 | 3300003214 | JGI25165J46597_1001602 | JGI25165J46597_10016024 | 172 |
| 721 | 3300003215 | JGI25153J46596_10007489 | JGI25153J46596_100074892 | 172 |
| 722 | 3300003215 | JGI25153J46596_10008231 | JGI25153J46596_100082312 | 172 |
| 723 | 3300003215 | JGI25153J46596_10008269 | JGI25153J46596_100082696 | 172 |
| 724 | 3300003215 | JGI25153J46596_10018949 | JGI25153J46596_100189493 | 172 |
| 725 | 3300003215 | JGI25153J46596_10025293 | JGI25153J46596_100252932 | 172 |
| 726 | 3300003320 | rootH2_10005284 | rootH2_100052842 | 172 |
| 727 | 3300003320 | rootH2_10042438 | rootH2_100424382 | 172 |
| 728 | 3300003322 | rootL2_10134841 | rootL2_101348412 | 172 |
| 729 | 3300003322 | rootL2_10149035 | rootL2_101490354 | 172 |
| 730 | 3300003323 | rootH1_10039093 | rootH1_100390932 | 172 |
| 731 | 3300003323 | rootH1_10089746 | rootH1_100897463 | 172 |
| 732 | 3300003354 | JGI25160J50197_1000051 | JGI25160J50197_100005158 | 172 |
| 733 | 3300003354 | JGI25160J50197_1000056 | JGI25160J50197_100005669 | 172 |
| 734 | 3300003354 | JGI25160J50197_1018375 | JGI25160J50197_10183752 | 172 |
| 735 | 3300003354 | JGI25160J50197_1023427 | JGI25160J50197_10234272 | 172 |
| 736 | 3300003374 | JGI25161J50226_1000011 | JGI25161J50226_1000011136 | 172 |
| 737 | 3300003374 | JGI25161J50226_1000214 | JGI25161J50226_100021414 | 172 |
| 738 | 3300003374 | JGI25161J50226_1000451 | JGI25161J50226_100045111 | 172 |
| 739 | 3300003771 | Ga0055526_1005687 | Ga0055526_10056877 | 172 |
| 740 | 3300003771 | Ga0055526_1008790 | Ga0055526_10087902 | 172 |
| 741 | 3300003771 | Ga0055526_1017791 | Ga0055526_10177911 | 172 |
| 742 | 3300003771 | Ga0055526_1022906 | Ga0055526_10229062 | 172 |
| 743 | 3300003775 | Ga0055524_1000962 | Ga0055524_10009628 | 172 |
| 744 | 3300003775 | Ga0055524_1001562 | Ga0055524_10015622 | 172 |
| 745 | 3300003775 | Ga0055524_1005939 | Ga0055524_10059394 | 172 |
| 746 | 3300003775 | Ga0055524_1020707 | Ga0055524_10207072 | 172 |
| 747 | 3300003775 | Ga0055524_1025496 | Ga0055524_10254962 | 172 |
| 748 | 3300003775 | Ga0055524_1037300 | Ga0055524_10373002 | 172 |
| 749 | 3300003775 | Ga0055524_1054140 | Ga0055524_10541401 | 172 |
| 750 | 3300003775 | Ga0055524_1066820 | Ga0055524_10668201 | 172 |
| 751 | 3300003790 | Ga0055528_1000452 | Ga0055528_100045215 | 172 |
| 752 | 3300003790 | Ga0055528_1006339 | Ga0055528_10063392 | 172 |
| 753 | 3300003790 | Ga0055528_1007110 | Ga0055528_10071102 | 172 |
| 754 | 3300003790 | Ga0055528_1026231 | Ga0055528_10262313 | 172 |
| 755 | 3300003790 | Ga0055528_1039685 | Ga0055528_10396852 | 172 |
| 756 | 3300003791 | Ga0055530_10039913 | Ga0055530_100399132 | 172 |
| 757 | 3300003792 | Ga0055540_1000597 | Ga0055540_100059710 | 172 |
| 758 | 3300003792 | Ga0055540_1006130 | Ga0055540_10061306 | 172 |
| 759 | 3300003856 | Ga0058692_1001407 | Ga0058692_10014073 | 172 |
| 760 | 3300003856 | Ga0058692_1004294 | Ga0058692_10042944 | 172 |
| 761 | 3300004625 | Ga0055543_1000041 | Ga0055543_100004147 | 172 |
| 762 | 3300004625 | Ga0055543_1000330 | Ga0055543_100033021 | 172 |
| 763 | 3300004625 | Ga0055543_1000383 | Ga0055543_100038322 | 172 |
| 764 | 3300004625 | Ga0055543_1003469 | Ga0055543_10034695 | 172 |
| 765 | 3300005262 | Ga0065165_1000155 | Ga0065165_100015570 | 172 |
| 766 | 3300005262 | Ga0065165_1000303 | Ga0065165_100030316 | 172 |
| 767 | 3300005262 | Ga0065165_1021843 | Ga0065165_10218432 | 172 |
| 768 | 3300005262 | Ga0065165_1025941 | Ga0065165_10259412 | 172 |
| 769 | 3300005262 | Ga0065165_1036529 | Ga0065165_10365292 | 172 |
| 770 | 3300005335 | Ga0070666_10007959 | Ga0070666_100079594 | 172 |
| 771 | 3300005347 | Ga0070668_100101196 | Ga0070668_1001011963 | 172 |
| 772 | 3300005353 | Ga0070669_100071717 | Ga0070669_1000717172 | 172 |
| 773 | 3300005355 | Ga0070671_100161837 | Ga0070671_1001618372 | 172 |
| 774 | 3300005367 | Ga0070667_100219060 | Ga0070667_1002190602 | 172 |
| 775 | 3300005455 | Ga0070663_100025431 | Ga0070663_1000254314 | 172 |
| 776 | 3300005457 | Ga0070662_100314094 | Ga0070662_1003140942 | 172 |
| 777 | 3300005548 | Ga0070665_100005296 | Ga0070665_10000529611 | 172 |
| 778 | 3300005548 | Ga0070665_101617168 | Ga0070665_1016171681 | 172 |
| 779 | 3300005841 | Ga0068863_101282359 | Ga0068863_1012823591 | 172 |
| 780 | 3300006038 | Ga0075365_10001383 | Ga0075365_100013835 | 172 |
| 781 | 3300006038 | Ga0075365_10006283 | Ga0075365_100062838 | 172 |
| 782 | 3300006042 | Ga0075368_10028925 | Ga0075368_100289253 | 172 |
| 783 | 3300006048 | Ga0075363_100091936 | Ga0075363_1000919362 | 172 |
| 784 | 3300006051 | Ga0075364_10138669 | Ga0075364_101386692 | 172 |
| 785 | 3300006177 | Ga0075362_10054231 | Ga0075362_100542313 | 172 |
| 786 | 3300006177 | Ga0075362_10058519 | Ga0075362_100585192 | 172 |
| 787 | 3300006178 | Ga0075367_10000616 | Ga0075367_1000061612 | 172 |
| 788 | 3300006178 | Ga0075367_10463416 | Ga0075367_104634161 | 172 |
| 789 | 3300006186 | Ga0075369_10000392 | Ga0075369_100003924 | 172 |
| 790 | 3300006186 | Ga0075369_10016630 | Ga0075369_100166304 | 172 |
| 791 | 3300006186 | Ga0075369_10023970 | Ga0075369_100239702 | 172 |
| 792 | 3300006186 | Ga0075369_10085775 | Ga0075369_100857752 | 172 |
| 793 | 3300006195 | Ga0075366_10007979 | Ga0075366_100079792 | 172 |
| 794 | 3300006195 | Ga0075366_10203489 | Ga0075366_102034892 | 172 |
| 795 | 3300006353 | Ga0075370_10002288 | Ga0075370_100022887 | 172 |
| 796 | 3300006353 | Ga0075370_10033253 | Ga0075370_100332534 | 172 |
| 797 | 3300006946 | Ga0079104_1001973 | Ga0079104_10019738 | 172 |
| 798 | 3300006946 | Ga0079104_1005380 | Ga0079104_10053805 | 172 |
| 799 | 3300006948 | Ga0099826_10000813 | Ga0099826_1000081313 | 172 |
| 800 | 3300009011 | Ga0105251_10004120 | Ga0105251_100041207 | 172 |
| 801 | 3300009092 | Ga0105250_10014478 | Ga0105250_100144784 | 172 |
| 802 | 3300009093 | Ga0105240_10000142 | Ga0105240_1000014279 | 172 |
| 803 | 3300009148 | Ga0105243_10129773 | Ga0105243_101297732 | 172 |
| 804 | 3300009148 | Ga0105243_10344871 | Ga0105243_103448712 | 172 |
| 805 | 3300009177 | Ga0105248_10156684 | Ga0105248_101566843 | 172 |
| 806 | 3300009553 | Ga0105249_10038514 | Ga0105249_100385143 | 172 |
| 807 | 3300009765 | Ga0123341_1000071 | Ga0123341_100007134 | 172 |
| 808 | 3300009766 | Ga0123342_1017422 | Ga0123342_10174222 | 172 |
| 809 | 3300009766 | Ga0123342_1031713 | Ga0123342_10317132 | 172 |
| 810 | 3300011119 | Ga0105246_10100765 | Ga0105246_101007652 | 172 |
| 811 | 3300012500 | Ga0157314_1005142 | Ga0157314_10051422 | 172 |
| 812 | 3300012500 | Ga0157314_1011624 | Ga0157314_10116241 | 172 |
| 813 | 3300013100 | Ga0157373_10013927 | Ga0157373_100139276 | 172 |
| 814 | 3300013102 | Ga0157371_10000071 | Ga0157371_10000071100 | 172 |
| 815 | 3300013104 | Ga0157370_10000079 | Ga0157370_1000007948 | 172 |
| 816 | 3300013104 | Ga0157370_10002835 | Ga0157370_1000283516 | 172 |
| 817 | 3300013105 | Ga0157369_10092694 | Ga0157369_100926944 | 172 |
| 818 | 3300013105 | Ga0157369_10105276 | Ga0157369_101052763 | 172 |
| 819 | 3300013105 | Ga0157369_10411989 | Ga0157369_104119892 | 172 |
| 820 | 3300013249 | Ga0171463_1004 | Ga0171463_1004324 | 172 |
| 821 | 3300013306 | Ga0163162_10395178 | Ga0163162_103951782 | 172 |
| 822 | 3300015690 | Ga0183363_1217 | Ga0183363_12172 | 172 |
| 823 | 3300021320 | Ga0214544_1000079 | Ga0214544_100007961 | 172 |
| 824 | 3300021321 | Ga0214542_1000064 | Ga0214542_100006466 | 172 |
| 825 | 3300021321 | Ga0214542_1012059 | Ga0214542_101205910 | 172 |
| 826 | 3300021327 | Ga0214543_1000015 | Ga0214543_1000015197 | 172 |
| 827 | 3300021327 | Ga0214543_1000063 | Ga0214543_100006346 | 172 |
| 828 | 3300022739 | Ga0228711_1000030 | Ga0228711_100003015 | 172 |
| 829 | 3300022740 | Ga0228710_1000002 | Ga0228710_1000002189 | 172 |
| 830 | 3300025206 | Ga0209435_100031 | Ga0209435_10003188 | 172 |
| 831 | 3300025208 | Ga0209436_100013 | Ga0209436_10001364 | 172 |
| 832 | 3300025208 | Ga0209436_100428 | Ga0209436_1004289 | 172 |
| 833 | 3300025233 | Ga0209437_100179 | Ga0209437_10017961 | 172 |
| 834 | 3300025233 | Ga0209437_100181 | Ga0209437_10018159 | 172 |
| 835 | 3300025233 | Ga0209437_105251 | Ga0209437_1052512 | 172 |
| 836 | 3300025245 | Ga0207425_1001412 | Ga0207425_100141211 | 172 |
| 837 | 3300025245 | Ga0207425_1005147 | Ga0207425_10051475 | 172 |
| 838 | 3300025245 | Ga0207425_1030719 | Ga0207425_10307192 | 172 |
| 839 | 3300025246 | Ga0209646_1000102 | Ga0209646_100010288 | 172 |
| 840 | 3300025246 | Ga0209646_1004291 | Ga0209646_10042913 | 172 |
| 841 | 3300025250 | Ga0209026_1000096 | Ga0209026_100009688 | 172 |
| 842 | 3300025253 | Ga0209677_100353 | Ga0209677_10035323 | 172 |
| 843 | 3300025256 | Ga0209759_1000090 | Ga0209759_100009088 | 172 |
| 844 | 3300025258 | Ga0209129_1000029 | Ga0209129_1000029151 | 172 |
| 845 | 3300025258 | Ga0209129_1000050 | Ga0209129_100005058 | 172 |
| 846 | 3300025258 | Ga0209129_1000289 | Ga0209129_100028937 | 172 |
| 847 | 3300025258 | Ga0209129_1000826 | Ga0209129_100082615 | 172 |
| 848 | 3300025258 | Ga0209129_1001114 | Ga0209129_10011146 | 172 |
| 849 | 3300025258 | Ga0209129_1001662 | Ga0209129_10016625 | 172 |
| 850 | 3300025258 | Ga0209129_1002660 | Ga0209129_10026604 | 172 |
| 851 | 3300025258 | Ga0209129_1036815 | Ga0209129_10368151 | 172 |
| 852 | 3300025261 | Ga0209233_1000185 | Ga0209233_100018560 | 172 |
| 853 | 3300025261 | Ga0209233_1000212 | Ga0209233_100021265 | 172 |
| 854 | 3300025261 | Ga0209233_1000263 | Ga0209233_100026329 | 172 |
| 855 | 3300025273 | Ga0209673_1000033 | Ga0209673_100003356 | 172 |
| 856 | 3300025273 | Ga0209673_1000370 | Ga0209673_100037019 | 172 |
| 857 | 3300025273 | Ga0209673_1001321 | Ga0209673_10013217 | 172 |
| 858 | 3300025273 | Ga0209673_1001329 | Ga0209673_100132926 | 172 |
| 859 | 3300025273 | Ga0209673_1003533 | Ga0209673_100353311 | 172 |
| 860 | 3300025273 | Ga0209673_1004386 | Ga0209673_10043863 | 172 |
| 861 | 3300025273 | Ga0209673_1006760 | Ga0209673_10067604 | 172 |
| 862 | 3300025273 | Ga0209673_1021110 | Ga0209673_10211103 | 172 |
| 863 | 3300025284 | Ga0209130_1000009 | Ga0209130_100000959 | 172 |
| 864 | 3300025284 | Ga0209130_1000058 | Ga0209130_100005858 | 172 |
| 865 | 3300025284 | Ga0209130_1000133 | Ga0209130_100013369 | 172 |
| 866 | 3300025284 | Ga0209130_1007568 | Ga0209130_10075684 | 172 |
| 867 | 3300025284 | Ga0209130_1010493 | Ga0209130_10104933 | 172 |
| 868 | 3300025292 | Ga0209676_1012503 | Ga0209676_10125034 | 172 |
| 869 | 3300025294 | Ga0209025_1000042 | Ga0209025_100004285 | 172 |
| 870 | 3300025294 | Ga0209025_1000132 | Ga0209025_100013255 | 172 |
| 871 | 3300025294 | Ga0209025_1000536 | Ga0209025_100053629 | 172 |
| 872 | 3300025294 | Ga0209025_1000815 | Ga0209025_100081521 | 172 |
| 873 | 3300025294 | Ga0209025_1001644 | Ga0209025_100164425 | 172 |
| 874 | 3300025294 | Ga0209025_1006663 | Ga0209025_100666311 | 172 |
| 875 | 3300025294 | Ga0209025_1011082 | Ga0209025_10110823 | 172 |
| 876 | 3300025294 | Ga0209025_1014000 | Ga0209025_10140002 | 172 |
| 877 | 3300025294 | Ga0209025_1016811 | Ga0209025_10168113 | 172 |
| 878 | 3300025295 | Ga0209564_1000193 | Ga0209564_100019385 | 172 |
| 879 | 3300025295 | Ga0209564_1000700 | Ga0209564_100070047 | 172 |
| 880 | 3300025295 | Ga0209564_1001108 | Ga0209564_10011087 | 172 |
| 881 | 3300025295 | Ga0209564_1004168 | Ga0209564_10041685 | 172 |
| 882 | 3300025295 | Ga0209564_1007892 | Ga0209564_10078924 | 172 |
| 883 | 3300025295 | Ga0209564_1022414 | Ga0209564_10224143 | 172 |
| 884 | 3300025295 | Ga0209564_1024268 | Ga0209564_10242681 | 172 |
| 885 | 3300025295 | Ga0209564_1027004 | Ga0209564_10270042 | 172 |
| 886 | 3300025297 | Ga0209758_1000299 | Ga0209758_100029934 | 172 |
| 887 | 3300025297 | Ga0209758_1000864 | Ga0209758_100086415 | 172 |
| 888 | 3300025297 | Ga0209758_1001221 | Ga0209758_10012217 | 172 |
| 889 | 3300025297 | Ga0209758_1001412 | Ga0209758_100141215 | 172 |
| 890 | 3300025297 | Ga0209758_1001462 | Ga0209758_100146218 | 172 |
| 891 | 3300025297 | Ga0209758_1003168 | Ga0209758_10031682 | 172 |
| 892 | 3300025297 | Ga0209758_1029807 | Ga0209758_10298073 | 172 |
| 893 | 3300025297 | Ga0209758_1031603 | Ga0209758_10316033 | 172 |
| 894 | 3300025297 | Ga0209758_1032174 | Ga0209758_10321742 | 172 |
| 895 | 3300025297 | Ga0209758_1032301 | Ga0209758_10323012 | 172 |
| 896 | 3300025297 | Ga0209758_1072209 | Ga0209758_10722092 | 172 |
| 897 | 3300025298 | Ga0209050_1011077 | Ga0209050_10110773 | 172 |
| 898 | 3300025298 | Ga0209050_1020388 | Ga0209050_10203882 | 172 |
| 899 | 3300025299 | Ga0209256_1000286 | Ga0209256_100028613 | 172 |
| 900 | 3300025299 | Ga0209256_1000459 | Ga0209256_100045958 | 172 |
| 901 | 3300025299 | Ga0209256_1001479 | Ga0209256_100147917 | 172 |
| 902 | 3300025299 | Ga0209256_1001820 | Ga0209256_100182011 | 172 |
| 903 | 3300025299 | Ga0209256_1005684 | Ga0209256_10056847 | 172 |
| 904 | 3300025299 | Ga0209256_1008143 | Ga0209256_10081432 | 172 |
| 905 | 3300025299 | Ga0209256_1016485 | Ga0209256_10164853 | 172 |
| 906 | 3300025299 | Ga0209256_1019324 | Ga0209256_10193242 | 172 |
| 907 | 3300025299 | Ga0209256_1029148 | Ga0209256_10291481 | 172 |
| 908 | 3300025299 | Ga0209256_1043607 | Ga0209256_10436072 | 172 |
| 909 | 3300025302 | Ga0207426_1000131 | Ga0207426_100013158 | 172 |
| 910 | 3300025302 | Ga0207426_1000214 | Ga0207426_100021459 | 172 |
| 911 | 3300025302 | Ga0207426_1000248 | Ga0207426_100024869 | 172 |
| 912 | 3300025302 | Ga0207426_1000450 | Ga0207426_10004505 | 172 |
| 913 | 3300025302 | Ga0207426_1000682 | Ga0207426_100068221 | 172 |
| 914 | 3300025303 | Ga0209051_1000118 | Ga0209051_100011811 | 172 |
| 915 | 3300025303 | Ga0209051_1001039 | Ga0209051_100103915 | 172 |
| 916 | 3300025303 | Ga0209051_1004006 | Ga0209051_10040064 | 172 |
| 917 | 3300025303 | Ga0209051_1013083 | Ga0209051_10130832 | 172 |
| 918 | 3300025303 | Ga0209051_1020276 | Ga0209051_10202762 | 172 |
| 919 | 3300025303 | Ga0209051_1035925 | Ga0209051_10359252 | 172 |
| 920 | 3300025303 | Ga0209051_1038917 | Ga0209051_10389172 | 172 |
| 921 | 3300025303 | Ga0209051_1068194 | Ga0209051_10681942 | 172 |
| 922 | 3300025303 | Ga0209051_1097889 | Ga0209051_10978892 | 172 |
| 923 | 3300025304 | Ga0209257_1002918 | Ga0209257_10029186 | 172 |
| 924 | 3300025304 | Ga0209257_1015028 | Ga0209257_10150284 | 172 |
| 925 | 3300025711 | Ga0207696_1064860 | Ga0207696_10648602 | 172 |
| 926 | 3300025903 | Ga0207680_10288585 | Ga0207680_102885852 | 172 |
| 927 | 3300025913 | Ga0207695_10000234 | Ga0207695_1000023480 | 172 |
| 928 | 3300025914 | Ga0207671_10000234 | Ga0207671_1000023414 | 172 |
| 929 | 3300025923 | Ga0207681_10185646 | Ga0207681_101856462 | 172 |
| 930 | 3300025923 | Ga0207681_10203140 | Ga0207681_102031402 | 172 |
| 931 | 3300025931 | Ga0207644_10234101 | Ga0207644_102341012 | 172 |
| 932 | 3300025935 | Ga0207709_10104110 | Ga0207709_101041101 | 172 |
| 933 | 3300025941 | Ga0207711_10113940 | Ga0207711_101139401 | 172 |
| 934 | 3300025961 | Ga0207712_10124029 | Ga0207712_101240292 | 172 |
| 935 | 3300025972 | Ga0207668_10188689 | Ga0207668_101886892 | 172 |
| 936 | 3300025972 | Ga0207668_10336706 | Ga0207668_103367062 | 172 |
| 937 | 3300025986 | Ga0207658_10104730 | Ga0207658_101047302 | 172 |
| 938 | 3300026067 | Ga0207678_10066768 | Ga0207678_100667682 | 172 |
| 939 | 3300026088 | Ga0207641_10799612 | Ga0207641_107996122 | 172 |
| 940 | 3300027111 | Ga0209281_1000030 | Ga0209281_100003069 | 172 |
| 941 | 3300027111 | Ga0209281_1000144 | Ga0209281_100014429 | 172 |
| 942 | 3300027312 | Ga0209371_1000037 | Ga0209371_1000037277 | 172 |
| 943 | 3300027312 | Ga0209371_1001411 | Ga0209371_100141111 | 172 |
| 944 | 3300027312 | Ga0209371_1010567 | Ga0209371_10105673 | 172 |
| 945 | 3300027666 | Ga0209282_1000004 | Ga0209282_100000469 | 172 |
| 946 | 3300027666 | Ga0209282_1000695 | Ga0209282_10006958 | 172 |
| 947 | 3300027666 | Ga0209282_1047735 | Ga0209282_10477352 | 172 |
| 948 | 3300027866 | Ga0209813_10010477 | Ga0209813_100104773 | 172 |
| 949 | 3300028379 | Ga0268266_10007709 | Ga0268266_1000770911 | 172 |
| 950 | 3300028379 | Ga0268266_10017319 | Ga0268266_100173193 | 172 |
| 951 | 3300028379 | Ga0268266_10156974 | Ga0268266_101569742 | 172 |
| 952 | 3300028794 | Ga0307515_10001099 | Ga0307515_1000109920 | 172 |
| 953 | 3300028794 | Ga0307515_10012908 | Ga0307515_1001290811 | 172 |
| 954 | 3300030500 | Ga0268256_1000039 | Ga0268256_100003931 | 172 |
| 955 | 3300030500 | Ga0268256_1001490 | Ga0268256_100149015 | 172 |
| 956 | 3300030500 | Ga0268256_1007557 | Ga0268256_10075574 | 172 |
| 957 | 3300030744 | Ga0316181_1259233 | Ga0316181_12592332 | 172 |
| 958 | 3300031456 | Ga0307513_10000998 | Ga0307513_1000099842 | 172 |
| 959 | 3300031456 | Ga0307513_10019403 | Ga0307513_100194033 | 172 |
| 960 | 3300031548 | Ga0307408_100136476 | Ga0307408_1001364763 | 172 |
| 961 | 3300031548 | Ga0307408_100807009 | Ga0307408_1008070091 | 172 |
| 962 | 3300031731 | Ga0307405_10040495 | Ga0307405_100404953 | 172 |
| 963 | 3300031824 | Ga0307413_10581902 | Ga0307413_105819022 | 172 |
| 964 | 3300031852 | Ga0307410_10218673 | Ga0307410_102186732 | 172 |
| 965 | 3300031901 | Ga0307406_10004352 | Ga0307406_100043523 | 172 |
| 966 | 3300031901 | Ga0307406_10224162 | Ga0307406_102241622 | 172 |
| 967 | 3300031911 | Ga0307412_10000412 | Ga0307412_1000041216 | 172 |
| 968 | 3300031911 | Ga0307412_10070358 | Ga0307412_100703583 | 172 |
| 969 | 3300031911 | Ga0307412_10079765 | Ga0307412_100797653 | 172 |
| 970 | 3300031967 | Ga0315914_1000001 | Ga0315914_1000001313 | 172 |
| 971 | 3300031995 | Ga0307409_100016139 | Ga0307409_1000161394 | 172 |
| 972 | 3300031995 | Ga0307409_100091099 | Ga0307409_1000910991 | 172 |
| 973 | 3300032002 | Ga0307416_100240160 | Ga0307416_1002401602 | 172 |
| 974 | 3300033430 | Ga0315913_1000022 | Ga0315913_100002215 | 172 |
| 975 | 3300033464 | Ga0315915_1000002 | Ga0315915_100000270 | 172 |
| 976 | 3300041404 | Ga0439436_0002644 | Ga0439436_0002644_1152_1751 | 172 |
| 977 | 3300041404 | Ga0439436_0021616 | Ga0439436_0021616_518_1117 | 172 |
| 978 | 3300041405 | Ga0439438_016026 | Ga0439438_016026_1078_1677 | 172 |
| 979 | 3300041406 | Ga0439439_0057980 | Ga0439439_0057980_16_615 | 172 |
| 980 | 3300041410 | Ga0439461_0013902 | Ga0439461_0013902_286_885 | 172 |
| 981 | 3300041413 | Ga0439465_0008572 | Ga0439465_0008572_2067_2666 | 172 |
| 982 | 3300041413 | Ga0439465_0019020 | Ga0439465_0019020_890_1489 | 172 |
| 983 | 3300041413 | Ga0439465_0019581 | Ga0439465_0019581_1331_1930 | 172 |
| 984 | 3300041413 | Ga0439465_0028834 | Ga0439465_0028834_710_1309 | 172 |
| 985 | 3300041413 | Ga0439465_0058711 | Ga0439465_0058711_559_1158 | 172 |
| 986 | 3300041413 | Ga0439465_0090118 | Ga0439465_0090118_115_714 | 172 |
| 987 | 3300041451 | Ga0451791_1030467 | Ga0451791_1030467_401_1000 | 172 |
| 988 | 3300041458 | Ga0451798_0608749 | Ga0451798_0608749_1841_2440 | 172 |
| 989 | 3300041491 | Ga0451833_0105464 | Ga0451833_0105464_814_1413 | 172 |
| 990 | 3300041491 | Ga0451833_0360030 | Ga0451833_0360030_514_1113 | 172 |
| 991 | 3300041492 | Ga0451835_0417831 | Ga0451835_0417831_541_1140 | 172 |
| 992 | 3300041492 | Ga0451835_0867006 | Ga0451835_0867006_1026_1625 | 172 |
| 993 | 3300041492 | Ga0451835_1096416 | Ga0451835_1096416_301_900 | 172 |
| 994 | 3300041494 | Ga0451837_0030893 | Ga0451837_0030893_406_1005 | 172 |
| 995 | 3300041494 | Ga0451837_0864410 | Ga0451837_0864410_572_1171 | 172 |
| 996 | 3300041496 | Ga0451839_0137856 | Ga0451839_0137856_618_1217 | 172 |
| 997 | 3300041498 | Ga0451841_0492521 | Ga0451841_0492521_184_783 | 172 |
| 998 | 3300041498 | Ga0451841_0908703 | Ga0451841_0908703_652_1251 | 172 |
| 999 | 3300041501 | Ga0451845_0191239 | Ga0451845_0191239_334_933 | 172 |
| 1000 | 3300041501 | Ga0451845_0378247 | Ga0451845_0378247_515_1114 | 172 |
| 1001 | 3300041503 | Ga0451847_0566208 | Ga0451847_0566208_2473_3072 | 172 |
| 1002 | 3300041503 | Ga0451847_0712631 | Ga0451847_0712631_119_718 | 172 |
| 1003 | 3300041505 | Ga0451849_0107853 | Ga0451849_0107853_261_860 | 172 |
| 1004 | 3300041505 | Ga0451849_0371279 | Ga0451849_0371279_981_1580 | 172 |
| 1005 | 3300041507 | Ga0451851_0266839 | Ga0451851_0266839_700_1299 | 172 |
| 1006 | 3300041507 | Ga0451851_0801872 | Ga0451851_0801872_118_717 | 172 |
| 1007 | 3300041509 | Ga0451843_0016801 | Ga0451843_0016801_464_1063 | 172 |
| 1008 | 3300041509 | Ga0451843_1111865 | Ga0451843_1111865_176_775 | 172 |
| 1009 | 3300041511 | Ga0451855_0116657 | Ga0451855_0116657_2348_2947 | 172 |
| 1010 | 3300041512 | Ga0451853_0435427 | Ga0451853_0435427_940_1539 | 172 |
| 1011 | 3300041512 | Ga0451853_1706919 | Ga0451853_1706919_353_952 | 172 |
| 1012 | 3300041512 | Ga0451853_2867064 | Ga0451853_2867064_255_854 | 172 |
| 1013 | 3300041997 | Ga0439431_0050052 | Ga0439431_0050052_124_723 | 172 |
| 1014 | 3300042004 | Ga0439445_0015504 | Ga0439445_0015504_600_1199 | 172 |
| 1015 | 3300042006 | Ga0439432_067265 | Ga0439432_067265_365_964 | 172 |
| 1016 | 3300042007 | Ga0439449_0014225 | Ga0439449_0014225_181_780 | 172 |
| 1017 | 3300042007 | Ga0439449_0044100 | Ga0439449_0044100_367_966 | 172 |
| 1018 | 3300042015 | Ga0439462_0031766 | Ga0439462_0031766_526_1125 | 172 |
| 1019 | 3300042015 | Ga0439462_0046742 | Ga0439462_0046742_192_791 | 172 |
| 1020 | 3300042145 | Ga0450906_010148 | Ga0450906_010148_1089_1688 | 172 |
| 1021 | 3300042145 | Ga0450906_058020 | Ga0450906_058020_55_654 | 172 |
| 1022 | 3300046453 | Ga0495627_120005 | Ga0495627_120005_79_678 | 172 |
| 1023 | 3300046460 | Ga0495638_0099595 | Ga0495638_0099595_999_1598 | 172 |
| 1024 | 3300046471 | Ga0495650_0022871 | Ga0495650_0022871_2282_2881 | 172 |
| 1025 | 3300046471 | Ga0495650_0128404 | Ga0495650_0128404_46_645 | 172 |
| 1026 | 3300046474 | Ga0495605_0020885 | Ga0495605_0020885_621_1220 | 172 |
| 1027 | 3300046474 | Ga0495605_0021385 | Ga0495605_0021385_408_1007 | 172 |
| 1028 | 3300046492 | Ga0495585_0017628 | Ga0495585_0017628_927_1526 | 172 |
| 1029 | 3300046492 | Ga0495585_0018413 | Ga0495585_0018413_2365_2964 | 172 |
| 1030 | 3300046492 | Ga0495585_0020896 | Ga0495585_0020896_2335_2934 | 172 |
| 1031 | 3300046500 | Ga0495596_0033622 | Ga0495596_0033622_730_1329 | 172 |
| 1032 | 3300046501 | Ga0495607_0009351 | Ga0495607_0009351_72_671 | 172 |
| 1033 | 3300046501 | Ga0495607_0098099 | Ga0495607_0098099_878_1477 | 172 |
| 1034 | 3300046506 | Ga0495583_0009155 | Ga0495583_0009155_2369_2968 | 172 |
| 1035 | 3300046507 | Ga0495606_0018735 | Ga0495606_0018735_273_872 | 172 |
| 1036 | 3300046507 | Ga0495606_0049333 | Ga0495606_0049333_694_1293 | 172 |
| 1037 | 3300046507 | Ga0495606_0087634 | Ga0495606_0087634_1030_1629 | 172 |
| 1038 | 3300046507 | Ga0495606_0428377 | Ga0495606_0428377_11_610 | 172 |
| 1039 | 3300046512 | Ga0495610_0023670 | Ga0495610_0023670_1665_2264 | 172 |
| 1040 | 3300046512 | Ga0495610_0057323 | Ga0495610_0057323_930_1529 | 172 |
| 1041 | 3300046515 | Ga0495620_0034097 | Ga0495620_0034097_780_1379 | 172 |
| 1042 | 3300046515 | Ga0495620_0080771 | Ga0495620_0080771_390_989 | 172 |
| 1043 | 3300046515 | Ga0495620_0134376 | Ga0495620_0134376_207_806 | 172 |
| 1044 | 3300046518 | Ga0495631_0036130 | Ga0495631_0036130_1114_1713 | 172 |
| 1045 | 3300046519 | Ga0495632_0012878 | Ga0495632_0012878_2406_3005 | 172 |
| 1046 | 3300046522 | Ga0495643_0326937 | Ga0495643_0326937_57_656 | 172 |
| 1047 | 3300046523 | Ga0495644_0075191 | Ga0495644_0075191_528_1127 | 172 |
| 1048 | 3300046524 | Ga0495648_0095240 | Ga0495648_0095240_957_1556 | 172 |
| 1049 | 3300046524 | Ga0495648_0122881 | Ga0495648_0122881_233_832 | 172 |
| 1050 | 3300046530 | Ga0495654_0042120 | Ga0495654_0042120_211_810 | 172 |
| 1051 | 3300046538 | Ga0495609_0108052 | Ga0495609_0108052_284_883 | 172 |
| 1052 | 3300046542 | Ga0495597_0043959 | Ga0495597_0043959_431_1030 | 172 |
| 1053 | 3300046558 | Ga0495633_0023680 | Ga0495633_0023680_219_818 | 172 |
| 1054 | 3300046558 | Ga0495633_0030340 | Ga0495633_0030340_1942_2541 | 172 |
| 1055 | 3300046558 | Ga0495633_0129766 | Ga0495633_0129766_219_818 | 172 |
| 1056 | 3300046615 | Ga0495656_0010068 | Ga0495656_0010068_1195_1794 | 172 |
| 1057 | 3300046616 | Ga0495668_0055795 | Ga0495668_0055795_716_1315 | 172 |
| 1058 | 3300046616 | Ga0495668_0190496 | Ga0495668_0190496_93_692 | 172 |
| 1059 | 3300046616 | Ga0495668_0230887 | Ga0495668_0230887_320_919 | 172 |
| 1060 | 3300046660 | Ga0495625_0110161 | Ga0495625_0110161_876_1475 | 172 |
| 1061 | 3300046660 | Ga0495625_0157467 | Ga0495625_0157467_535_1134 | 172 |
| 1062 | 3300046660 | Ga0495625_0301237 | Ga0495625_0301237_282_881 | 172 |
| 1063 | 3300046665 | Ga0495661_0075172 | Ga0495661_0075172_904_1503 | 172 |
| 1064 | 3300046665 | Ga0495661_0120628 | Ga0495661_0120628_13_612 | 172 |
| 1065 | 3300046674 | Ga0495588_0022965 | Ga0495588_0022965_1626_2225 | 172 |
| 1066 | 3300046674 | Ga0495588_0143506 | Ga0495588_0143506_390_989 | 172 |
| 1067 | 3300046692 | Ga0495671_0044759 | Ga0495671_0044759_1259_1858 | 172 |
| 1068 | 3300046694 | Ga0495649_0019639 | Ga0495649_0019639_2041_2640 | 172 |
| 1069 | 3300046694 | Ga0495649_0226185 | Ga0495649_0226185_278_877 | 172 |
| 1070 | 3300046810 | Ga0495660_0181491 | Ga0495660_0181491_117_716 | 172 |
| 1071 | 3300047323 | Ga0495683_0085475 | Ga0495683_0085475_547_1146 | 172 |
| 1072 | 3300047443 | Ga0495687_021278 | Ga0495687_021278_451_1050 | 172 |
| 1073 | 3300047470 | Ga0495681_0035361 | Ga0495681_0035361_959_1558 | 172 |
| 1074 | 3300047470 | Ga0495681_0040126 | Ga0495681_0040126_1374_1973 | 172 |
| 1075 | 3300047470 | Ga0495681_0185116 | Ga0495681_0185116_125_724 | 172 |
| 1076 | 3300047472 | Ga0495686_0022887 | Ga0495686_0022887_2856_3455 | 172 |
| 1077 | 3300047472 | Ga0495686_0412445 | Ga0495686_0412445_53_652 | 172 |
| 1078 | 3300048090 | Ga0495615_0013503 | Ga0495615_0013503_183_782 | 172 |
| 1079 | 3300048091 | Ga0495626_0054217 | Ga0495626_0054217_675_1274 | 172 |
| 1080 | 3300048903 | Ga0496100_0104274 | Ga0496100_0104274_596_1195 | 172 |
| 1081 | 3300048904 | Ga0496101_0126148 | Ga0496101_0126148_110_709 | 172 |
| 1082 | 3300048905 | Ga0496102_0006022 | Ga0496102_0006022_4352_4951 | 172 |
| 1083 | 3300048905 | Ga0496102_0051109 | Ga0496102_0051109_1655_2254 | 172 |
| 1084 | 3300048906 | Ga0496103_0005771 | Ga0496103_0005771_5701_6300 | 172 |
| 1085 | 3300048906 | Ga0496103_0032901 | Ga0496103_0032901_1382_1981 | 172 |
| 1086 | 3300048907 | Ga0496104_0047950 | Ga0496104_0047950_2181_2780 | 172 |
| 1087 | 3300048908 | Ga0496105_0022420 | Ga0496105_0022420_1447_2046 | 172 |
| 1088 | 3300048909 | Ga0496106_0001205 | Ga0496106_0001205_2780_3379 | 172 |
| 1089 | 3300048909 | Ga0496106_0140366 | Ga0496106_0140366_48_647 | 172 |
| 1090 | 3300048910 | Ga0496107_0036741 | Ga0496107_0036741_1423_2022 | 172 |
| 1091 | 3300048910 | Ga0496107_0051360 | Ga0496107_0051360_1285_1884 | 172 |
| 1092 | 3300048911 | Ga0496108_0177714 | Ga0496108_0177714_905_1504 | 172 |
| 1093 | 3300048913 | Ga0496110_0026155 | Ga0496110_0026155_1300_1899 | 172 |
| 1094 | 3300048914 | Ga0496111_0077063 | Ga0496111_0077063_1755_2354 | 172 |
| 1095 | 3300048916 | Ga0496113_0024324 | Ga0496113_0024324_3246_3845 | 172 |
| 1096 | 3300048916 | Ga0496113_0062902 | Ga0496113_0062902_2193_2792 | 172 |
| 1097 | 3300048916 | Ga0496113_0102738 | Ga0496113_0102738_29_628 | 172 |
| 1098 | 3300048919 | Ga0496116_0000057 | Ga0496116_0000057_56013_56612 | 172 |
| 1099 | 3300048919 | Ga0496116_0163627 | Ga0496116_0163627_419_1018 | 172 |
| 1100 | 3300048919 | Ga0496116_0199445 | Ga0496116_0199445_143_742 | 172 |
| 1101 | 3300048920 | Ga0496117_0000031 | Ga0496117_0000031_325196_325795 | 172 |
| 1102 | 3300048920 | Ga0496117_0006996 | Ga0496117_0006996_7073_7672 | 172 |
| 1103 | 3300048920 | Ga0496117_0010245 | Ga0496117_0010245_3011_3610 | 172 |
| 1104 | 3300048920 | Ga0496117_0011322 | Ga0496117_0011322_7216_7815 | 172 |
| 1105 | 3300048920 | Ga0496117_0013741 | Ga0496117_0013741_4181_4780 | 172 |
| 1106 | 3300048920 | Ga0496117_0211283 | Ga0496117_0211283_45_644 | 172 |
| 1107 | 3300048920 | Ga0496117_0229932 | Ga0496117_0229932_110_709 | 172 |
| 1108 | 3300048921 | Ga0496118_0000208 | Ga0496118_0000208_69597_70196 | 172 |
| 1109 | 3300048921 | Ga0496118_0082495 | Ga0496118_0082495_375_974 | 172 |
| 1110 | 3300048921 | Ga0496118_0090333 | Ga0496118_0090333_1349_1948 | 172 |
| 1111 | 3300048922 | Ga0496119_0015539 | Ga0496119_0015539_2163_2762 | 172 |
| 1112 | 3300048922 | Ga0496119_0018993 | Ga0496119_0018993_2630_3229 | 172 |
| 1113 | 3300048922 | Ga0496119_0023565 | Ga0496119_0023565_1670_2269 | 172 |
| 1114 | 3300048922 | Ga0496119_0069940 | Ga0496119_0069940_95_694 | 172 |
| 1115 | 3300048922 | Ga0496119_0304751 | Ga0496119_0304751_46_645 | 172 |
| 1116 | 3300048923 | Ga0496120_0000387 | Ga0496120_0000387_48039_48638 | 172 |
| 1117 | 3300048923 | Ga0496120_0008826 | Ga0496120_0008826_2549_3148 | 172 |
| 1118 | 3300048924 | Ga0496121_0000034 | Ga0496121_0000034_57900_58499 | 172 |
| 1119 | 3300048924 | Ga0496121_0038317 | Ga0496121_0038317_94_693 | 172 |
| 1120 | 3300048924 | Ga0496121_0065145 | Ga0496121_0065145_1409_2008 | 172 |
| 1121 | 3300048924 | Ga0496121_0100435 | Ga0496121_0100435_1062_1661 | 172 |
| 1122 | 3300048924 | Ga0496121_0172915 | Ga0496121_0172915_114_713 | 172 |
| 1123 | 3300048925 | Ga0496122_0000023 | Ga0496122_0000023_325184_325783 | 172 |
| 1124 | 3300048925 | Ga0496122_0000308 | Ga0496122_0000308_65391_65990 | 172 |
| 1125 | 3300048925 | Ga0496122_0015251 | Ga0496122_0015251_2404_3003 | 172 |
| 1126 | 3300048925 | Ga0496122_0058019 | Ga0496122_0058019_271_870 | 172 |
| 1127 | 3300048925 | Ga0496122_0067660 | Ga0496122_0067660_526_1125 | 172 |
| 1128 | 3300048925 | Ga0496122_0103079 | Ga0496122_0103079_95_694 | 172 |
| 1129 | 3300048925 | Ga0496122_0272400 | Ga0496122_0272400_194_793 | 172 |
| 1130 | 3300048926 | Ga0496123_0000027 | Ga0496123_0000027_55253_55852 | 172 |
| 1131 | 3300048926 | Ga0496123_0000066 | Ga0496123_0000066_65158_65757 | 172 |
| 1132 | 3300048926 | Ga0496123_0005944 | Ga0496123_0005944_10975_11574 | 172 |
| 1133 | 3300048926 | Ga0496123_0038852 | Ga0496123_0038852_1431_2030 | 172 |
| 1134 | 3300048926 | Ga0496123_0051313 | Ga0496123_0051313_1035_1634 | 172 |
| 1135 | 3300048926 | Ga0496123_0077281 | Ga0496123_0077281_860_1459 | 172 |
| 1136 | 3300048926 | Ga0496123_0095838 | Ga0496123_0095838_794_1393 | 172 |
| 1137 | 3300048926 | Ga0496123_0135265 | Ga0496123_0135265_474_1073 | 172 |
| 1138 | 3300048927 | Ga0496124_0018926 | Ga0496124_0018926_2400_2999 | 172 |
| 1139 | 3300048927 | Ga0496124_0134174 | Ga0496124_0134174_1302_1901 | 172 |
| 1140 | 3300048927 | Ga0496124_0275512 | Ga0496124_0275512_339_938 | 172 |
| 1141 | 3300048927 | Ga0496124_0299037 | Ga0496124_0299037_226_825 | 172 |
| 1142 | 3300048927 | Ga0496124_0583804 | Ga0496124_0583804_66_665 | 172 |
| 1143 | 3300048928 | Ga0496125_0000030 | Ga0496125_0000030_316440_317039 | 172 |
| 1144 | 3300048928 | Ga0496125_0000288 | Ga0496125_0000288_76897_77496 | 172 |
| 1145 | 3300048928 | Ga0496125_0005090 | Ga0496125_0005090_551_1150 | 172 |
| 1146 | 3300048928 | Ga0496125_0028379 | Ga0496125_0028379_2336_2935 | 172 |
| 1147 | 3300048928 | Ga0496125_0064201 | Ga0496125_0064201_136_735 | 172 |
| 1148 | 3300048928 | Ga0496125_0089748 | Ga0496125_0089748_441_1040 | 172 |
| 1149 | 3300048928 | Ga0496125_0192797 | Ga0496125_0192797_133_732 | 172 |
| 1150 | 3300048928 | Ga0496125_0212927 | Ga0496125_0212927_436_1035 | 172 |
| 1151 | 3300048929 | Ga0496126_0000115 | Ga0496126_0000115_56097_56696 | 172 |
| 1152 | 3300048929 | Ga0496126_0000258 | Ga0496126_0000258_64387_64986 | 172 |
| 1153 | 3300048929 | Ga0496126_0024648 | Ga0496126_0024648_3133_3732 | 172 |
| 1154 | 3300048929 | Ga0496126_0027664 | Ga0496126_0027664_184_795 | 172 |
| 1155 | 3300048929 | Ga0496126_0070762 | Ga0496126_0070762_1821_2420 | 172 |
| 1156 | 3300048929 | Ga0496126_0099049 | Ga0496126_0099049_1028_1627 | 172 |
| 1157 | 3300048929 | Ga0496126_0391213 | Ga0496126_0391213_102_701 | 172 |
| 1158 | 3300048929 | Ga0496126_0586851 | Ga0496126_0586851_102_701 | 172 |
| 1159 | 3300049459 | Ga0495678_040938 | Ga0495678_040938_163_762 | 172 |
| 1160 | 3300049460 | Ga0495682_0151204 | Ga0495682_0151204_99_698 | 172 |
| 1161 | 3300049568 | Ga0501031_0087362 | Ga0501031_0087362_737_1348 | 172 |
| 1162 | 3300049571 | Ga0501034_0026220 | Ga0501034_0026220_3710_4309 | 172 |
| 1163 | 3300049571 | Ga0501034_0573887 | Ga0501034_0573887_228_839 | 172 |
| 1164 | 3300049574 | Ga0501038_0111837 | Ga0501038_0111837_559_1170 | 172 |
| 1165 | 3300049579 | Ga0501043_0072981 | Ga0501043_0072981_1771_2382 | 172 |
| 1166 | 3300049584 | Ga0501068_0352923 | Ga0501068_0352923_24_623 | 172 |
| 1167 | 3300049589 | Ga0501073_0132213 | Ga0501073_0132213_854_1453 | 172 |
| 1168 | 3300049744 | Ga0501083_0034342 | Ga0501083_0034342_1196_1795 | 172 |
| 1169 | 3300049776 | Ga0501280_000684 | Ga0501280_000684_6702_7301 | 172 |
| 1170 | 3300050489 | nmdc:mga03683_64094_c1 | nmdc:mga03683_64094_c1_381_980 | 172 |
| 1171 | 3300050490 | nmdc:mga03n38_366798_c1 | nmdc:mga03n38_366798_c1_25_624 | 172 |
| 1172 | 3300050491 | nmdc:mga00v17_141160_c1 | nmdc:mga00v17_141160_c1_284_883 | 172 |
| 1173 | 3300050491 | nmdc:mga00v17_15_c1 | nmdc:mga00v17_15_c1_73267_73866 | 172 |
| 1174 | 3300050491 | nmdc:mga00v17_55968_c1 | nmdc:mga00v17_55968_c1_1768_2367 | 172 |
| 1175 | 3300050492 | nmdc:mga0yw44_27717_c1 | nmdc:mga0yw44_27717_c1_972_1571 | 172 |
| 1176 | 3300050492 | nmdc:mga0yw44_61109_c1 | nmdc:mga0yw44_61109_c1_425_1024 | 172 |
| 1177 | 3300050493 | nmdc:mga0k408_110158_c1 | nmdc:mga0k408_110158_c1_25_624 | 172 |
| 1178 | 3300050493 | nmdc:mga0k408_6544_c1 | nmdc:mga0k408_6544_c1_402_1001 | 172 |
| 1179 | 3300050494 | nmdc:mga06z11_104594_c1 | nmdc:mga06z11_104594_c1_681_1280 | 172 |
| 1180 | 3300050494 | nmdc:mga06z11_11797_c1 | nmdc:mga06z11_11797_c1_2272_2871 | 172 |
| 1181 | 3300050494 | nmdc:mga06z11_79268_c1 | nmdc:mga06z11_79268_c1_838_1437 | 172 |
| 1182 | 3300050495 | nmdc:mga04h51_101109_c1 | nmdc:mga04h51_101109_c1_81_680 | 172 |
| 1183 | 3300050495 | nmdc:mga04h51_5669_c1 | nmdc:mga04h51_5669_c1_2337_2936 | 172 |
| 1184 | 3300050496 | nmdc:mga07m45_107257_c2 | nmdc:mga07m45_107257_c2_118_717 | 172 |
| 1185 | 3300050496 | nmdc:mga07m45_53477_c1 | nmdc:mga07m45_53477_c1_1520_2119 | 172 |
| 1186 | 3300050516 | nmdc:mga0sz30_155606_c1 | nmdc:mga0sz30_155606_c1_268_867 | 172 |
| 1187 | 3300050516 | nmdc:mga0sz30_2785_c1 | nmdc:mga0sz30_2785_c1_4684_5283 | 172 |
| 1188 | 3300050516 | nmdc:mga0sz30_37813_c1 | nmdc:mga0sz30_37813_c1_1240_1839 | 172 |
| 1189 | 3300050516 | nmdc:mga0sz30_735_c1 | nmdc:mga0sz30_735_c1_8356_8955 | 172 |
| 1190 | 3300053093 | Ga0500651_0026274 | Ga0500651_0026274_1787_2386 | 172 |
| 1191 | 3300053107 | Ga0500560_025638 | Ga0500560_025638_476_1075 | 172 |
| 1192 | 3300053109 | Ga0500569_001882 | Ga0500569_001882_1881_2480 | 172 |
| 1193 | 3300053125 | Ga0500618_010829 | Ga0500618_010829_1540_2139 | 172 |
| 1194 | 3300053125 | Ga0500618_057121 | Ga0500618_057121_140_739 | 172 |
| 1195 | 3300053129 | Ga0500628_053207 | Ga0500628_053207_264_863 | 172 |
| 1196 | 3300053134 | Ga0500658_0001061 | Ga0500658_0001061_5377_5976 | 172 |
| 1197 | 3300053134 | Ga0500658_0008567 | Ga0500658_0008567_1195_1794 | 172 |
| 1198 | 3300053135 | Ga0500659_0069908 | Ga0500659_0069908_878_1477 | 172 |
| 1199 | 3300053137 | Ga0500561_0000223 | Ga0500561_0000223_781_1380 | 172 |
| 1200 | 3300053139 | Ga0500568_0005405 | Ga0500568_0005405_3551_4150 | 172 |
| 1201 | 3300053139 | Ga0500568_0037466 | Ga0500568_0037466_992_1591 | 172 |
| 1202 | 3300053142 | Ga0500577_0310032 | Ga0500577_0310032_41_640 | 172 |
| 1203 | 3300053151 | Ga0500604_0001019 | Ga0500604_0001019_1213_1812 | 172 |
| 1204 | 3300053151 | Ga0500604_0009464 | Ga0500604_0009464_1341_1940 | 172 |
| 1205 | 3300053153 | Ga0500616_0033586 | Ga0500616_0033586_951_1550 | 172 |
| 1206 | 3300053157 | Ga0500624_000633 | Ga0500624_000633_6234_6833 | 172 |
| 1207 | 3300053158 | Ga0500627_0013773 | Ga0500627_0013773_1395_1994 | 172 |
| 1208 | 3300053160 | Ga0500633_0000081 | Ga0500633_0000081_13410_14009 | 172 |
| 1209 | 3300059643 | Ga0587072_007015 | Ga0587072_007015_266_865 | 172 |
| 1210 | iso_pu_bacteria | 2989771324 | 2989771767 | 172 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lu1-assembly1.cif.gz_A | crystal structure of the uncharacterized maf protein ycef from e. coli, mutant d69a | 0.8989 | 5 | 170 |
| 4jhc-assembly1.cif.gz_A | crystal structure of the uncharacterized maf protein ycef from e. coli | 0.8975 | 4 | 170 |
| 4heb-assembly1.cif.gz_A | the crystal structure of maf protein of bacillus subtilis | 0.8878 | 4 | 170 |
| 4heb-assembly1.cif.gz_B | the crystal structure of maf protein of bacillus subtilis | 0.8775 | 4 | 170 |
| 1exc-assembly1.cif.gz_A | crystal structure of b. subtilis maf protein complexed with d-(utp) | 0.8744 | 1 | 170 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4p0uA00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9019 | 5 | 170 | 3.90.950.10 |
| 4hebA00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.8878 | 4 | 170 | 3.90.950.10 |
| 3u6gB00 | Mainly Beta;Sandwich;Lipoxygenase-1; | 0.8504 | 107 | 130 | 2.60.60.60 |
| 4lu1B00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.8476 | 5 | 170 | 3.90.950.10 |
| af_O14141_27_232_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.843 | 2 | 171 | 3.90.950.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A528LHS3-F1-model_v4 | Septum formation inhibitor Maf | 0.9664 | 87 | 170 |
GO:0009117
GO:0047429 |
| AF-A0A434SAP5-F1-model_v4 | Septum formation inhibitor Maf | 0.9527 | 1 | 131 |
GO:0009117
GO:0047429 |
| AF-A0A352KCX7-F1-model_v4 | Septum formation protein Maf | 0.9492 | 4 | 116 |
GO:0009117
GO:0047429 |
| AF-A0A2E0BM59-F1-model_v4 | Septum formation inhibitor Maf | 0.9427 | 91 | 170 |
GO:0009117
GO:0047429 |
| AF-A0A434SAP5-F1-model_v4 | Septum formation inhibitor Maf | 0.9388 | 1 | 131 |
GO:0009117
GO:0047429 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar