F491589

General Info

Members Datasets Scaffolds Average Seq Length
1201 974 487 341

Family's Representative Sequence

Representative Sequence 3300003693|Ga0032354_1026823|Ga0032354_10268231
Length 380
Sequence MNAFKLTVAALAASAAFAGAAVARDQVQVSGSSTVLPYAKIVAETFGETFKDFKTPVVESGGTGAGLKEFCKGVGPDTIDVANASRPINAKELEACKAAGVTDIQEVKIGYDGIVFATDSSNPDVAYEPADLYKALAAQVVVDGKLVANPYKKWSEVNSKLPAVDIAAYIPGEKHGTREVFELNVLAAGCKDSGALEVISKEIADKAAQSKACVAVRKDGAAVDIDGDYPETLARIAANKTGVGVFGLSFYENNADKLKVATVKGIVPSPETIADGTYPVSRPLFFYVKKAHLGVIPGLKEYVNFFVSDQMVGPDSPLVEYGLVAAPDAEREATRKSVEDGKAFVRSMGAVKLNYSMIGSRDGRSAVSLLGAEGLGDLNE

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
8 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
9 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
10 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
11 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
12 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
13 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
14 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
15 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
16 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
17 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
18 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
19 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
20 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
21 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
22 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
23 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
24 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
25 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
26 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
27 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
28 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
29 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
30 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
31 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
32 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
33 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
34 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
35 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
36 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
37 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
38 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
39 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
40 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
41 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
42 2516143018 Ensifer sp. BR816 Isolate Nodule
43 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
44 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
45 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
46 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
47 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
48 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
49 2519899620 Rhizobium sp. Pop5 Isolate Nodule
50 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
51 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
52 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
53 2534681786 Brucella suis 92/29 Isolate Unclassified
54 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
55 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
56 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
57 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
58 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
59 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
60 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
61 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
62 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
63 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
64 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
65 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
66 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
67 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
68 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
69 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
70 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
71 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
72 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
73 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
74 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
75 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
76 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
77 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
78 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
79 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
80 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
81 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
82 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
83 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
84 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
85 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
86 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
87 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
88 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
89 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
90 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
91 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
92 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
93 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
94 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
95 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
96 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
97 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
98 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
99 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
100 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
101 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
102 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
103 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
104 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
105 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
106 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
107 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
108 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
109 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
110 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
111 2643221557 Ensifer sp. Root558 Isolate Unclassified
112 2643221558 Rhizobium sp. Root149 Isolate Unclassified
113 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
114 2643221568 Rhizobium sp. Root564 Isolate Unclassified
115 2643221582 Rhizobium sp. Root651 Isolate Unclassified
116 2643221599 Rhizobium sp. Root708 Isolate Unclassified
117 2643221607 Rhizobium sp. Root73 Isolate Unclassified
118 2643221610 Ensifer sp. Root74 Isolate Unclassified
119 2643221618 Ensifer sp. Root231 Isolate Unclassified
120 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
121 2643221626 Ensifer sp. Root31 Isolate Unclassified
122 2643221629 Devosia sp. Root105 Isolate Unclassified
123 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
124 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
125 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
126 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
127 2643221655 Ensifer sp. Root1252 Isolate Unclassified
128 2643221659 Ensifer sp. Root127 Isolate Unclassified
129 2643221662 Devosia sp. Root413D1 Isolate Unclassified
130 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
131 2643221668 Ensifer sp. Root423 Isolate Unclassified
132 2643221675 Ensifer sp. Root1298 Isolate Unclassified
133 2643221680 Ensifer sp. Root1312 Isolate Unclassified
134 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
135 2643221688 Rhizobium sp. Root482 Isolate Unclassified
136 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
137 2643221693 Rhizobium sp. Root491 Isolate Unclassified
138 2643221698 Ensifer sp. Root142 Isolate Unclassified
139 2643221712 Ensifer sp. Root258 Isolate Unclassified
140 2643221718 Rhizobium sp. Root268 Isolate Unclassified
141 2643221723 Ensifer sp. Root278 Isolate Unclassified
142 2643221726 Ensifer sp. Root954 Isolate Unclassified
143 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
144 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
145 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
146 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
147 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
148 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
149 2718217882 Rhizobium sp. N741 Isolate Nodule
150 2718217927 Rhizobium sp. N324 Isolate Nodule
151 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
152 2718218009 Rhizobium sp. N561 Isolate Nodule
153 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
154 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
155 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
156 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
157 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
158 2718218363 Rhizobium sp. N113 Isolate Nodule
159 2718218365 Rhizobium sp. N731 Isolate Nodule
160 2718218366 Rhizobium sp. N621 Isolate Nodule
161 2718218423 Rhizobium sp. N941 Isolate Nodule
162 2721755514 Rhizobium sp. N6212 Isolate Nodule
163 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
164 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
165 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
166 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
167 2721755809 Rhizobium sp. N541 Isolate Nodule
168 2721755810 Rhizobium sp. N871 Isolate Nodule
169 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
170 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
171 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
172 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
173 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
174 2728369365 Rhizobium sp. N1341 Isolate Nodule
175 2728369397 Rhizobium sp. N1314 Isolate Nodule
176 2738541293 Rhizobium sp. GV031 Isolate Unclassified
177 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
178 2738543024 Aminobacter sp. AP02 Isolate Unclassified
179 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
180 2751185800 Brucella pituitosa AA2 Isolate Unclassified
181 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
182 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
183 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
184 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
185 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
186 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
187 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
188 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
189 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
190 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
191 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
192 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
193 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
194 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
195 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
196 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
197 2791355256 Rhizobium sp. M10 Isolate Nodule
198 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
199 2791355260 Rhizobium sp. L9 Isolate Nodule
200 2791355261 Rhizobium sp. J15 Isolate Nodule
201 2791355262 Rhizobium sp. M1 Isolate Nodule
202 2791355263 Rhizobium chutanense C5 Isolate Nodule
203 2791355264 Rhizobium sp. S9 Isolate Nodule
204 2791355265 Rhizobium sp. H4 Isolate Nodule
205 2791355266 Rhizobium sp. L43 Isolate Nodule
206 2791355267 Rhizobium sp. L18 Isolate Nodule
207 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
208 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
209 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
210 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
211 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
212 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
213 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
214 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
215 2802429633 Rhizobium anhuiense J3 Isolate Nodule
216 2802429634 Rhizobium anhuiense S10 Isolate Nodule
217 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
218 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
219 2802429637 Rhizobium anhuiense C15 Isolate Nodule
220 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
221 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
222 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
223 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
224 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
225 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
226 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
227 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
228 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
229 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
230 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
231 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
232 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
233 2838048938 Rhizobium pisi 27/80 Isolate Nodule
234 2838061910 Rhizobium phaseoli L15 Isolate Nodule
235 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
236 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
237 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
238 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
239 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
240 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
241 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
242 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
243 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
244 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
245 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
246 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
247 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
248 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
249 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
250 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
251 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
252 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
253 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
254 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
255 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
256 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
257 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
258 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
259 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
260 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
261 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
262 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
263 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
264 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
265 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
266 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
267 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
268 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
269 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
270 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
271 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
272 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
273 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
274 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
275 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
276 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
277 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
278 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
279 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
280 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
281 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
282 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
283 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
284 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
285 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
286 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
287 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
288 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
289 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
290 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
291 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
292 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
293 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
294 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
295 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
296 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
297 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
298 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
299 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
300 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
301 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
302 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
303 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
304 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
305 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
306 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
307 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
308 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
309 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
310 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
311 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
312 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
313 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
314 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
315 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
316 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
317 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
318 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
319 2844163670 Ensifer sp. 1H6 Isolate Unclassified
320 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
321 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
322 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
323 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
324 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
325 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
326 2854911287 Brucella lupini LUP21 Isolate Unclassified
327 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
328 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
329 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
330 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
331 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
332 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
333 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
334 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
335 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
336 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
337 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
338 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
339 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
340 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
341 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
342 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
343 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
344 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
345 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
346 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
347 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
348 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
349 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
350 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
351 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
352 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
353 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
354 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
355 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
356 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
357 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
358 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
359 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
360 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
361 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
362 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
363 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
364 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
365 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
366 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
367 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
368 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
369 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
370 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
371 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
372 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
373 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
374 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
375 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
376 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
377 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
378 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
379 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
380 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
381 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
382 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
383 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
384 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
385 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
386 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
387 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
388 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
389 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
390 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
391 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
392 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
393 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
394 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
395 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
396 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
397 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
398 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
399 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
400 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
401 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
402 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
403 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
404 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
405 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
406 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
407 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
408 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
409 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
410 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
411 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
412 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
413 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
414 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
415 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
416 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
417 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
418 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
419 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
420 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
421 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
422 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
423 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
424 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
425 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
426 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
427 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
428 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
429 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
430 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
431 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
432 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
433 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
434 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
435 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
436 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
437 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
438 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
439 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
440 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
441 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
442 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
443 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
444 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
445 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
446 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
447 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
448 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
449 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
450 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
451 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
452 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
453 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
454 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
455 2933599457 Rhizobium phaseoli M3 Isolate Nodule
456 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
457 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
458 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
459 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
460 2936381700 Rhizobium chutanense C16 Isolate Unclassified
461 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
462 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
463 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
464 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
465 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
466 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
467 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
468 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
469 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
470 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
471 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
472 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
473 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
474 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
475 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
476 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
477 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
478 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
479 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
480 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
481 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
482 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
483 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
484 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
485 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
486 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
487 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
488 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
489 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
490 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
491 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
492 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
493 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
494 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
495 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
496 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
497 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
498 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
499 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
500 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
501 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
502 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
503 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
504 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
505 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
506 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
507 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
508 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
509 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
510 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
511 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
512 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
513 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
514 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
515 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
516 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
517 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
518 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
519 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
520 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
521 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
522 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
523 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
524 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
525 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
526 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
527 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
528 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
529 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
530 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
531 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
532 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
533 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
534 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
535 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
536 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
537 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
538 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
539 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
540 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
541 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
542 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
543 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
544 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
545 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
546 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
547 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
548 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
549 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
550 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
551 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
552 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
553 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
554 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
555 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
556 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
557 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
558 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
559 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
560 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
561 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
562 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
563 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
564 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
565 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
566 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
567 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
568 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
569 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
570 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
571 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
572 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
573 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
574 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
575 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
576 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
577 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
578 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
579 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
580 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
581 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
582 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
583 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
584 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
585 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
586 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
587 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
588 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
589 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
590 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
591 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
592 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
593 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
594 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
595 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
596 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
597 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
598 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
599 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
600 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
601 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
602 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
603 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
604 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
605 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
606 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
607 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
608 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
609 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
610 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
611 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
612 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
613 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
614 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
615 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
616 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
617 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
618 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
619 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
620 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
621 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
622 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
623 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
624 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
625 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
626 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
627 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
628 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
629 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
630 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
631 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
632 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
633 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
634 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
635 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
636 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
637 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
638 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
639 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
640 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
641 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
642 2996887358 Rhizobium sp. R711 Isolate Nodule
643 2996893221 Rhizobium sp. R635 Isolate Nodule
644 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
645 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
646 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
647 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
648 3004167301 Mesorhizobium loti 582 Isolate Unclassified
649 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
650 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
651 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
652 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
653 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
654 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
655 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
656 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
657 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
658 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
659 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
660 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
661 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
662 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
663 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
664 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
665 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
666 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
667 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
668 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
669 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
670 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
671 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
672 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
673 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
674 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
675 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
676 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
677 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
678 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
679 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
680 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
681 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
682 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
683 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
684 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
685 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
686 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
687 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
688 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
689 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
690 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
691 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
692 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
693 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
694 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
695 3300005473 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v2 (version 2) Metagenome Rhizosphere
696 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
697 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
698 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
699 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
700 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
701 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
702 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
703 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
704 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
705 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
706 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
707 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
708 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
709 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
710 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
711 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
712 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
713 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
714 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
715 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
716 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
717 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
718 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
719 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
720 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
721 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
722 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
723 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
724 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
725 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
726 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
727 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
728 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
729 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
730 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
731 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
732 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
733 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
734 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
735 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
736 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
737 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
738 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
739 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
740 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
741 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
742 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
743 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
744 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
745 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
746 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
747 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
748 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
749 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
750 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
751 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
752 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
753 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
754 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
755 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
756 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
757 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
758 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
759 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
760 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
761 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
762 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
763 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
764 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
765 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
766 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
767 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
768 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
769 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
770 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
771 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
772 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
773 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
774 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
775 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
776 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
777 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
778 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
779 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
780 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
781 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
782 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
783 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
784 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
785 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
786 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
787 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
788 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
789 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
790 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
791 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
792 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
793 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
794 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
795 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
796 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
797 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
798 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
799 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
800 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
801 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
802 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
803 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
804 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
805 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
806 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
807 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
808 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
809 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
810 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
811 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
812 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
813 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
814 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
815 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
816 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
817 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
818 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
819 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
820 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
821 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
822 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
823 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
824 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
825 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
826 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
827 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
828 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
829 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
830 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
831 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
832 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
833 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
834 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
835 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
836 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
837 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
838 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
839 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
840 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
841 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
842 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
843 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
844 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
845 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
846 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
847 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
848 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
849 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
850 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
851 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
852 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
853 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
854 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
855 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
856 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
857 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
858 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
859 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
860 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
861 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
862 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
863 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
864 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
865 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
866 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
867 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
868 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
869 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
870 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
871 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
872 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
873 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
874 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
875 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
876 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
877 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
878 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
879 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
880 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
881 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
882 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
883 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
884 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
885 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
886 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
887 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
888 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
889 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
890 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
891 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
892 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
893 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
894 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
895 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
896 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
897 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
898 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
899 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
900 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
901 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
902 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
903 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
904 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
905 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
906 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
907 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
908 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
909 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
910 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
911 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
912 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
913 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
914 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
915 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
916 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
917 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
918 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
919 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
920 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
921 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
922 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
923 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
924 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
925 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
926 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
927 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
928 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
929 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
930 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
931 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
932 8005258706 Rhizobium sp. R693 Isolate Nodule
933 8005275841 Rhizobium sp. N4311 Isolate Nodule
934 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
935 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
936 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
937 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
938 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
939 8005321885 Rhizobium sp. R72 Isolate Nodule
940 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
941 8005382845 Rhizobium sp. R634 Isolate Nodule
942 8005395548 Rhizobium sp. R339 Isolate Nodule
943 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
944 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
945 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
946 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
947 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
948 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
949 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
950 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
951 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
952 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
953 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
954 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
955 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
956 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
957 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
958 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
959 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
960 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
961 8018176218 Rhizobium sp. N122 Isolate Nodule
962 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
963 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
964 8024501048 Rhizobium sp. H4 Isolate Nodule
965 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
966 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
967 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
968 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
969 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
970 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
971 8056382006 Rhizobium croatiense 13T Isolate Nodule
972 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere
973 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
974 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 38.47
Metatranscriptomes 2.08
Isolates 59.45

Biome Distribution

Category Percentage (%)
Aerial Root 0.5
Bulb 0
Endosphere 14.99
Nodule 44.3
Rhizoplane 1.92
Rhizosphere 21.48
Stem 0
Stem Tuber 0.08
Unclassified 16.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000265 3300001979 Bacteria 21989
2 JGI24738J21930_10024076 3300002075 Bacteria 1253
3 JGI25155J39150_1000013 3300002704 Bacteria 198215
4 JGI25156J39149_1000011 3300002705 Bacteria 198215
5 JGI25162J39368_1000773 3300002737 Bacteria 21561
6 JGI25162J39368_1001043 3300002737 Bacteria 17032
7 JGI25154J39366_1000030 3300002738 Bacteria 191444
8 JGI25157J39369_1000013 3300002741 Bacteria 198211
9 JGI25152J39213_1003141 3300002773 Bacteria 5769
10 JGI25152J39213_1005083 3300002773 Bacteria 3955
11 JGI25152J39213_1008236 3300002773 Bacteria 2606
12 JGI25150J39212_1000276 3300002774 Bacteria 27042
13 JGI25150J39212_1013325 3300002774 Bacteria 1428
14 JGI25159J45721_1000003 3300002987 Bacteria 274069
15 JGI25159J45721_1000320 3300002987 Bacteria 22279
16 JGI25159J45721_1000553 3300002987 Bacteria 16968
17 Ga0006778J45830_1028201 3300003162 Bacteria 1371
18 JGI25151J46595_10000110 3300003187 Bacteria 111972
19 JGI25151J46595_10000425 3300003187 Bacteria 42264
20 JGI25151J46595_10017623 3300003187 Bacteria 3091
21 JGI25151J46595_10024082 3300003187 Bacteria 2496
22 JGI25406J46586_10011996 3300003203 Bacteria 3777
23 JGI25165J46597_1000602 3300003214 Bacteria 30787
24 JGI25165J46597_1001279 3300003214 Bacteria 14641
25 JGI25153J46596_10019417 3300003215 Bacteria 2606
26 JGI25153J46596_10034665 3300003215 Bacteria 1646
27 rootH1_10074705 3300003316 Bacteria 2877
28 JGI25160J50197_1000003 3300003354 Bacteria 482719
29 JGI25160J50197_1000041 3300003354 Bacteria 152843
30 JGI25160J50197_1002266 3300003354 Bacteria 9022
31 JGI25160J50197_1002665 3300003354 Bacteria 8226
32 JGI25160J50197_1003367 3300003354 Bacteria 7166
33 JGI25161J50226_1000002 3300003374 Bacteria 420324
34 JGI25161J50226_1000315 3300003374 Bacteria 26611
35 JGI25161J50226_1000318 3300003374 Bacteria 26473
36 Ga0007427J51700_108555 3300003559 Bacteria 1300
37 Ga0006562J51391_1021039 3300003578 Bacteria 2749
38 Ga0006562J51391_1072973 3300003578 Bacteria 1975
39 Ga0032354_1026823 3300003693 Bacteria 1335
40 Ga0006780_1022426 3300003735 Bacteria 1473
41 Ga0055526_1000550 3300003771 Bacteria 29646
42 Ga0055526_1002545 3300003771 Bacteria 12244
43 Ga0055526_1013939 3300003771 Bacteria 3351
44 Ga0055526_1018148 3300003771 Bacteria 2642
45 Ga0055524_1002964 3300003775 Bacteria 8459
46 Ga0055524_1003575 3300003775 Bacteria 7491
47 Ga0055524_1015989 3300003775 Bacteria 2713
48 Ga0055524_1025467 3300003775 Bacteria 1852
49 Ga0055536_1007402 3300003781 Bacteria 4925
50 Ga0055528_1000095 3300003790 Bacteria 70572
51 Ga0055528_1001482 3300003790 Bacteria 14257
52 Ga0055528_1008657 3300003790 Bacteria 4326
53 Ga0055530_10032093 3300003791 Bacteria 1370
54 Ga0055540_1001140 3300003792 Bacteria 16584
55 Ga0055540_1002617 3300003792 Bacteria 9353
56 Ga0055531_10002234 3300003794 Bacteria 13113
57 Ga0055531_10005165 3300003794 Bacteria 7698
58 Ga0055531_10025343 3300003794 Bacteria 2157
59 Ga0058692_1000001 3300003856 Bacteria 834230
60 Ga0055543_1000037 3300004625 Bacteria 125386
61 Ga0055543_1000203 3300004625 Bacteria 48554
62 Ga0055543_1000466 3300004625 Bacteria 23733
63 Ga0065165_1000031 3300005262 Bacteria 216330
64 Ga0065165_1000084 3300005262 Bacteria 154822
65 Ga0065165_1004130 3300005262 Bacteria 9332
66 Ga0065703_1000122 3300005272 Bacteria 39740
67 Ga0070676_10063006 3300005328 Bacteria 2208
68 Ga0070682_100210418 3300005337 Bacteria 1378
69 Ga0070689_100186898 3300005340 Bacteria 1686
70 Ga0070669_100093928 3300005353 Bacteria 2253
71 Ga0070671_100045810 3300005355 Bacteria 3636
72 Ga0074250_12179 3300005473 Bacteria 1705
73 Ga0070665_100047383 3300005548 Bacteria 4314
74 Ga0070665_100105884 3300005548 Bacteria 2814
75 Ga0070665_100154271 3300005548 Bacteria 2298
76 Ga0068854_100028036 3300005578 Bacteria 3887
77 Ga0068856_100056858 3300005614 Bacteria 3861
78 Ga0068856_100105944 3300005614 Bacteria 2806
79 Ga0068852_100051558 3300005616 Bacteria 3532
80 Ga0081455_10001548 3300005937 Bacteria 28314
81 Ga0081540_1004695 3300005983 Bacteria 10339
82 Ga0081540_1043567 3300005983 Bacteria 2300
83 Ga0081539_10001304 3300005985 Bacteria 43613
84 Ga0075365_10000298 3300006038 Bacteria 17275
85 Ga0075365_10005677 3300006038 Bacteria 6764
86 Ga0075365_10069608 3300006038 Bacteria 2365
87 Ga0075365_10159211 3300006038 Bacteria 1573
88 Ga0075368_10003333 3300006042 Bacteria 5348
89 Ga0075363_100012121 3300006048 Bacteria 4147
90 Ga0075364_10000847 3300006051 Bacteria 16120
91 Ga0075364_10022919 3300006051 Bacteria 3949
92 Ga0075364_10068629 3300006051 Bacteria 2332
93 Ga0075362_10002602 3300006177 Bacteria 6104
94 Ga0075362_10010718 3300006177 Bacteria 3588
95 Ga0075367_10000382 3300006178 Bacteria 16047
96 Ga0075367_10001337 3300006178 Bacteria 10460
97 Ga0075367_10007489 3300006178 Bacteria 5592
98 Ga0075367_10010702 3300006178 Bacteria 4829
99 Ga0075367_10011945 3300006178 Bacteria 4614
100 Ga0075367_10029453 3300006178 Bacteria 3140
101 Ga0075369_10001075 3300006186 Bacteria 9163
102 Ga0075369_10055639 3300006186 Bacteria 1719
103 Ga0075366_10069909 3300006195 Bacteria 2090
104 Ga0075370_10056684 3300006353 Bacteria 2227
105 Ga0075370_10061903 3300006353 Bacteria 2132
106 Ga0075370_10158561 3300006353 Bacteria 1327
107 Ga0075431_100018162 3300006847 Bacteria 7155
108 Ga0075429_100027195 3300006880 Bacteria 4965
109 Ga0079104_1011186 3300006946 Bacteria 2900
110 Ga0079104_1012844 3300006946 Bacteria 2609
111 Ga0099826_10019370 3300006948 Bacteria 5117
112 Ga0105251_10019463 3300009011 Bacteria 3586
113 Ga0105240_10000024 3300009093 Bacteria 375919
114 Ga0105240_10082262 3300009093 Bacteria 3954
115 Ga0105247_10000344 3300009101 Bacteria 40748
116 Ga0105243_10000013 3300009148 Bacteria 275151
117 Ga0105243_10004039 3300009148 Bacteria 11685
118 Ga0105243_10055476 3300009148 Bacteria 3149
119 Ga0105248_10147694 3300009177 Bacteria 2653
120 Ga0105237_10000836 3300009545 Bacteria 42087
121 Ga0105249_10001408 3300009553 Bacteria 21068
122 Ga0123341_1000103 3300009765 Bacteria 37078
123 Ga0123341_1062925 3300009765 Bacteria 1777
124 Ga0123342_1012202 3300009766 Bacteria 9084
125 Ga0105239_10003536 3300010375 Bacteria 19113
126 Ga0105246_10149590 3300011119 Bacteria 1766
127 Ga0157322_1000529 3300012490 Bacteria 1474
128 Ga0157371_10000004 3300013102 Bacteria 512593
129 Ga0157371_10005117 3300013102 Bacteria 11183
130 Ga0157371_10010262 3300013102 Bacteria 7310
131 Ga0157370_10003256 3300013104 Bacteria 19133
132 Ga0157370_10003765 3300013104 Bacteria 17703
133 Ga0157370_10058687 3300013104 Bacteria 3657
134 Ga0157369_10047578 3300013105 Bacteria 4655
135 Ga0157369_10523787 3300013105 Bacteria 1226
136 Ga0171463_1001 3300013249 Bacteria 1406070
137 Ga0157378_10237575 3300013297 Bacteria 1740
138 Ga0157380_10065172 3300014326 Bacteria 2927
139 Ga0182008_10034276 3300014497 Bacteria 2546
140 Ga0182007_10001106 3300015262 Bacteria 14613
141 Ga0183363_1140 3300015690 Bacteria 18543
142 Ga0214542_1004397 3300021321 Bacteria 27975
143 Ga0214543_1000027 3300021327 Bacteria 215065
144 Ga0228711_1001182 3300022739 Bacteria 37363
145 Ga0228710_1000008 3300022740 Bacteria 174306
146 Ga0209435_100026 3300025206 Bacteria 198295
147 Ga0209436_100006 3300025208 Bacteria 150277
148 Ga0209436_102997 3300025208 Bacteria 4689
149 Ga0209437_100050 3300025233 Bacteria 394010
150 Ga0209437_100056 3300025233 Bacteria 363071
151 Ga0207425_1000012 3300025245 Bacteria 528324
152 Ga0207425_1004096 3300025245 Bacteria 4459
153 Ga0207425_1016448 3300025245 Bacteria 1640
154 Ga0207425_1026807 3300025245 Bacteria 1179
155 Ga0209646_1000084 3300025246 Bacteria 198295
156 Ga0209646_1002915 3300025246 Bacteria 3565
157 Ga0209026_1000080 3300025250 Bacteria 198295
158 Ga0209677_101825 3300025253 Bacteria 8706
159 Ga0209148_1006421 3300025254 Bacteria 2550
160 Ga0209759_1000061 3300025256 Bacteria 198295
161 Ga0209129_1000110 3300025258 Bacteria 150918
162 Ga0209129_1000206 3300025258 Bacteria 68903
163 Ga0209129_1000985 3300025258 Bacteria 17076
164 Ga0209129_1001015 3300025258 Bacteria 16716
165 Ga0209129_1001804 3300025258 Bacteria 11369
166 Ga0209233_1000037 3300025261 Bacteria 554620
167 Ga0209233_1000071 3300025261 Bacteria 363290
168 Ga0209233_1000327 3300025261 Bacteria 49691
169 Ga0209673_1000024 3300025273 Bacteria 409632
170 Ga0209673_1000063 3300025273 Bacteria 256709
171 Ga0209673_1002553 3300025273 Bacteria 12420
172 Ga0209673_1002642 3300025273 Bacteria 12012
173 Ga0209673_1004535 3300025273 Bacteria 7387
174 Ga0209673_1027734 3300025273 Bacteria 1837
175 Ga0209130_1000002 3300025284 Bacteria 722648
176 Ga0209130_1000005 3300025284 Bacteria 599620
177 Ga0209130_1000028 3300025284 Bacteria 325668
178 Ga0209130_1024193 3300025284 Bacteria 1330
179 Ga0209130_1027156 3300025284 Bacteria 1219
180 Ga0209676_1005679 3300025292 Bacteria 6418
181 Ga0209676_1022122 3300025292 Bacteria 2114
182 Ga0209025_1000024 3300025294 Bacteria 528324
183 Ga0209025_1000037 3300025294 Bacteria 383429
184 Ga0209025_1000060 3300025294 Bacteria 305017
185 Ga0209025_1000479 3300025294 Bacteria 77489
186 Ga0209025_1001805 3300025294 Bacteria 25363
187 Ga0209025_1001859 3300025294 Bacteria 24728
188 Ga0209025_1007478 3300025294 Bacteria 8126
189 Ga0209025_1007820 3300025294 Bacteria 7857
190 Ga0209564_1000093 3300025295 Bacteria 245793
191 Ga0209564_1000316 3300025295 Bacteria 94849
192 Ga0209564_1000977 3300025295 Bacteria 35999
193 Ga0209564_1001013 3300025295 Bacteria 34890
194 Ga0209564_1011493 3300025295 Bacteria 3961
195 Ga0209758_1000150 3300025297 Bacteria 163494
196 Ga0209758_1000170 3300025297 Bacteria 149476
197 Ga0209758_1001467 3300025297 Bacteria 27671
198 Ga0209758_1001806 3300025297 Bacteria 23637
199 Ga0209758_1007099 3300025297 Bacteria 7754
200 Ga0209758_1029006 3300025297 Bacteria 2326
201 Ga0209050_1004464 3300025298 Bacteria 9430
202 Ga0209050_1018151 3300025298 Bacteria 2750
203 Ga0209050_1018305 3300025298 Bacteria 2730
204 Ga0209256_1000027 3300025299 Bacteria 423283
205 Ga0209256_1000996 3300025299 Bacteria 33661
206 Ga0209256_1001570 3300025299 Bacteria 22473
207 Ga0209256_1002960 3300025299 Bacteria 12725
208 Ga0209256_1004495 3300025299 Bacteria 8711
209 Ga0207426_1000012 3300025302 Bacteria 730942
210 Ga0207426_1000013 3300025302 Bacteria 721897
211 Ga0207426_1000015 3300025302 Bacteria 599316
212 Ga0207426_1000070 3300025302 Bacteria 331559
213 Ga0207426_1000638 3300025302 Bacteria 43881
214 Ga0209051_1000135 3300025303 Bacteria 138142
215 Ga0209051_1004038 3300025303 Bacteria 9273
216 Ga0209051_1009326 3300025303 Bacteria 5070
217 Ga0209257_1009998 3300025304 Bacteria 4921
218 Ga0209257_1016029 3300025304 Bacteria 3062
219 Ga0207696_1008767 3300025711 Bacteria 3831
220 Ga0207655_1000881 3300025728 Bacteria 31790
221 Ga0207655_1000882 3300025728 Bacteria 31789
222 Ga0207713_1001253 3300025735 Bacteria 21040
223 Ga0207710_10000005 3300025900 Bacteria 607066
224 Ga0207695_10000036 3300025913 Bacteria 477897
225 Ga0207695_10093107 3300025913 Bacteria 3023
226 Ga0207671_10000153 3300025914 Bacteria 107114
227 Ga0207681_10009212 3300025923 Bacteria 6033
228 Ga0207659_10273323 3300025926 Bacteria 1379
229 Ga0207644_10216111 3300025931 Bacteria 1517
230 Ga0207709_10000001 3300025935 Bacteria 2228154
231 Ga0207670_10233698 3300025936 Bacteria 1413
232 Ga0207711_10097502 3300025941 Bacteria 2596
233 Ga0207712_10005520 3300025961 Bacteria 7977
234 Ga0207712_10109929 3300025961 Bacteria 2065
235 Ga0207668_10235290 3300025972 Bacteria 1479
236 Ga0207658_10072382 3300025986 Bacteria 2613
237 Ga0207702_10167066 3300026078 Bacteria 2014
238 Ga0207648_10064676 3300026089 Bacteria 3188
239 Ga0207683_10050590 3300026121 Bacteria 3640
240 Ga0207698_10038068 3300026142 Bacteria 3550
241 Ga0207698_10402129 3300026142 Bacteria 1309
242 Ga0209281_1000043 3300027111 Bacteria 341543
243 Ga0209281_1000306 3300027111 Bacteria 87720
244 Ga0209281_1000520 3300027111 Bacteria 49942
245 Ga0209371_1000008 3300027312 Bacteria 1024606
246 Ga0209371_1000009 3300027312 Bacteria 963030
247 Ga0209371_1001826 3300027312 Bacteria 13215
248 Ga0209371_1002409 3300027312 Bacteria 10508
249 Ga0209282_1000121 3300027666 Bacteria 49713
250 Ga0209282_1002108 3300027666 Bacteria 11333
251 Ga0209282_1083474 3300027666 Bacteria 1699
252 Ga0209813_10001913 3300027866 Bacteria 4693
253 Ga0209813_10004409 3300027866 Bacteria 3361
254 Ga0209813_10006494 3300027866 Bacteria 2891
255 Ga0209813_10012143 3300027866 Bacteria 2268
256 Ga0207428_10148329 3300027907 Bacteria 1787
257 Ga0268266_10016408 3300028379 Bacteria 6332
258 Ga0268266_10038736 3300028379 Bacteria 4058
259 Ga0268266_10090135 3300028379 Bacteria 2687
260 Ga0268266_10233325 3300028379 Bacteria 1695
261 Ga0307515_10000198 3300028794 Bacteria 147738
262 Ga0307515_10001776 3300028794 Bacteria 48034
263 Ga0268256_1000009 3300030500 Bacteria 1022625
264 Ga0268256_1000010 3300030500 Bacteria 963034
265 Ga0268256_1002677 3300030500 Bacteria 8781
266 Ga0316181_1260635 3300030744 Bacteria 2643
267 Ga0307513_10006546 3300031456 Bacteria 15215
268 Ga0307513_10243493 3300031456 Bacteria 1601
269 Ga0307408_100020322 3300031548 Bacteria 4480
270 Ga0307508_10302293 3300031616 Bacteria 1193
271 Ga0307405_10001435 3300031731 Bacteria 10031
272 Ga0307413_10017491 3300031824 Bacteria 3735
273 Ga0307406_10033463 3300031901 Bacteria 3147
274 Ga0307406_10209597 3300031901 Bacteria 1441
275 Ga0307406_10300568 3300031901 Bacteria 1233
276 Ga0307412_10072680 3300031911 Bacteria 2351
277 Ga0315914_1000754 3300031967 Bacteria 43901
278 Ga0307416_100234803 3300032002 Bacteria 1771
279 Ga0307414_10040840 3300032004 Bacteria 3136
280 Ga0307414_10219787 3300032004 Bacteria 1559
281 Ga0315913_1000195 3300033430 Bacteria 44144
282 Ga0315915_1000247 3300033464 Bacteria 49711
283 Ga0316596_1033371 3300033541 Bacteria 1341
284 Ga0373935_0020800 3300035692 Bacteria 4013
285 Ga0373927_0000053 3300035695 Bacteria 82381
286 Ga0316584_0064933 3300036712 Bacteria 2734
287 Ga0373925_0012359 3300037068 Bacteria 6182
288 Ga0395899_0000058 3300037312 Bacteria 213049
289 Ga0395900_0000056 3300037418 Bacteria 213077
290 Ga0395898_0000114 3300037466 Bacteria 213068
291 Ga0395898_0425316 3300037466 Bacteria 1266
292 Ga0395905_0000053 3300037471 Bacteria 213077
293 Ga0395905_0003361 3300037471 Bacteria 17152
294 Ga0395901_0000037 3300038443 Bacteria 213059
295 Ga0400483_164349 3300039062 Bacteria 4446
296 Ga0439465_0041163 3300041413 Bacteria 1495
297 Ga0451787_844771 3300041441 Bacteria 1843
298 Ga0451791_0335165 3300041451 Bacteria 2285
299 Ga0451798_0653057 3300041458 Bacteria 1835
300 Ga0451802_1285483 3300041460 Bacteria 1930
301 Ga0451849_0403391 3300041505 Bacteria 1712
302 Ga0439455_0008427 3300042012 Bacteria 2211
303 Ga0466966_0042662 3300044684 Bacteria 2910
304 Ga0466963_0004025 3300044694 Bacteria 8500
305 Ga0466970_0011014 3300044765 Bacteria 4602
306 Ga0466957_0030293 3300044842 Bacteria 3230
307 Ga0466958_0074527 3300045836 Bacteria 2080
308 Ga0466967_0134359 3300045976 Bacteria 2300
309 Ga0495638_0042269 3300046460 Bacteria 2880
310 Ga0495606_0006045 3300046507 Bacteria 11324
311 Ga0495606_0159121 3300046507 Bacteria 1319
312 Ga0495610_0058992 3300046512 Bacteria 1833
313 Ga0495620_0018822 3300046515 Bacteria 3413
314 Ga0495631_0045617 3300046518 Bacteria 1929
315 Ga0495632_0049160 3300046519 Bacteria 2086
316 Ga0495648_0100031 3300046524 Bacteria 1603
317 Ga0495654_0001320 3300046530 Bacteria 17329
318 Ga0495633_0025401 3300046558 Bacteria 2918
319 Ga0495625_0030670 3300046660 Bacteria 4008
320 Ga0495625_0074576 3300046660 Bacteria 2376
321 Ga0495588_0000697 3300046674 Bacteria 15501
322 Ga0495588_0045977 3300046674 Bacteria 2239
323 Ga0495671_0018240 3300046692 Bacteria 3726
324 Ga0495687_032193 3300047443 Bacteria 2397
325 Ga0495681_0022350 3300047470 Bacteria 3387
326 Ga0495686_0002953 3300047472 Bacteria 15200
327 Ga0495686_0054250 3300047472 Bacteria 2510
328 Ga0495686_0059943 3300047472 Bacteria 2367
329 Ga0496100_0042919 3300048903 Bacteria 2890
330 Ga0496101_0084608 3300048904 Bacteria 2349
331 Ga0496102_0016809 3300048905 Bacteria 6399
332 Ga0496103_0013692 3300048906 Bacteria 4812
333 Ga0496106_0079772 3300048909 Bacteria 2513
334 Ga0496110_0145413 3300048913 Bacteria 2144
335 Ga0496111_0003716 3300048914 Bacteria 9493
336 Ga0496113_0023658 3300048916 Bacteria 4358
337 Ga0496116_0000100 3300048919 Bacteria 194740
338 Ga0496116_0008443 3300048919 Bacteria 8931
339 Ga0496116_0011001 3300048919 Bacteria 7530
340 Ga0496116_0081067 3300048919 Bacteria 2013
341 Ga0496117_0000002 3300048920 Bacteria 2483758
342 Ga0496117_0003751 3300048920 Bacteria 17399
343 Ga0496117_0009021 3300048920 Bacteria 9377
344 Ga0496118_0000776 3300048921 Bacteria 51291
345 Ga0496118_0012211 3300048921 Bacteria 8273
346 Ga0496118_0016123 3300048921 Bacteria 6872
347 Ga0496118_0051791 3300048921 Bacteria 3138
348 Ga0496118_0074369 3300048921 Bacteria 2429
349 Ga0496119_0001813 3300048922 Bacteria 24824
350 Ga0496119_0016196 3300048922 Bacteria 5694
351 Ga0496119_0016346 3300048922 Bacteria 5652
352 Ga0496119_0020462 3300048922 Bacteria 4829
353 Ga0496119_0022254 3300048922 Bacteria 4547
354 Ga0496119_0065582 3300048922 Bacteria 2150
355 Ga0496120_0000034 3300048923 Bacteria 215228
356 Ga0496120_0017769 3300048923 Bacteria 4598
357 Ga0496120_0102129 3300048923 Bacteria 1513
358 Ga0496121_0000220 3300048924 Bacteria 123930
359 Ga0496121_0002488 3300048924 Bacteria 28040
360 Ga0496121_0005480 3300048924 Bacteria 16248
361 Ga0496121_0012849 3300048924 Bacteria 9058
362 Ga0496121_0146856 3300048924 Bacteria 1741
363 Ga0496121_0257274 3300048924 Bacteria 1207
364 Ga0496122_0000001 3300048925 Bacteria 1827766
365 Ga0496122_0001480 3300048925 Bacteria 37788
366 Ga0496122_0004948 3300048925 Bacteria 16157
367 Ga0496122_0007958 3300048925 Bacteria 11586
368 Ga0496122_0013812 3300048925 Bacteria 7865
369 Ga0496122_0017248 3300048925 Bacteria 6766
370 Ga0496122_0088715 3300048925 Bacteria 2118
371 Ga0496122_0135007 3300048925 Bacteria 1557
372 Ga0496122_0224450 3300048925 Bacteria 1074
373 Ga0496123_0000001 3300048926 Bacteria 1831497
374 Ga0496123_0000238 3300048926 Bacteria 111297
375 Ga0496123_0009385 3300048926 Bacteria 8818
376 Ga0496123_0012845 3300048926 Bacteria 7093
377 Ga0496123_0027843 3300048926 Bacteria 4199
378 Ga0496123_0043341 3300048926 Bacteria 3092
379 Ga0496124_0000083 3300048927 Bacteria 207798
380 Ga0496124_0001450 3300048927 Bacteria 35027
381 Ga0496124_0004345 3300048927 Bacteria 16605
382 Ga0496124_0007026 3300048927 Bacteria 12059
383 Ga0496124_0023874 3300048927 Bacteria 5571
384 Ga0496124_0079046 3300048927 Bacteria 2709
385 Ga0496124_0092622 3300048927 Bacteria 2462
386 Ga0496124_0150064 3300048927 Bacteria 1829
387 Ga0496125_0000001 3300048928 Bacteria 1766138
388 Ga0496125_0000633 3300048928 Bacteria 58848
389 Ga0496125_0009600 3300048928 Bacteria 9898
390 Ga0496125_0015127 3300048928 Bacteria 7480
391 Ga0496125_0098066 3300048928 Bacteria 2169
392 Ga0496126_0000311 3300048929 Bacteria 103353
393 Ga0496126_0000971 3300048929 Bacteria 49163
394 Ga0496126_0019003 3300048929 Bacteria 6786
395 Ga0496126_0067815 3300048929 Bacteria 3186
396 Ga0496126_0068539 3300048929 Bacteria 3167
397 Ga0496126_0100613 3300048929 Bacteria 2529
398 Ga0495678_019359 3300049459 Bacteria 3039
399 Ga0501314_005259 3300049530 Bacteria 1096
400 Ga0501031_0017803 3300049568 Bacteria 4620
401 Ga0501031_0022299 3300049568 Bacteria 4127
402 Ga0501031_0087598 3300049568 Bacteria 2030
403 Ga0501032_0000029 3300049569 Bacteria 130865
404 Ga0501032_0015869 3300049569 Bacteria 5308
405 Ga0501033_0000367 3300049570 Bacteria 43237
406 Ga0501033_0116255 3300049570 Bacteria 1943
407 Ga0501034_0000659 3300049571 Bacteria 53076
408 Ga0501034_0000740 3300049571 Bacteria 49364
409 Ga0501034_0019150 3300049571 Bacteria 7008
410 Ga0501034_0096949 3300049571 Bacteria 2945
411 Ga0501034_0134887 3300049571 Bacteria 2450
412 Ga0501034_0308564 3300049571 Bacteria 1517
413 Ga0501036_0104009 3300049572 Bacteria 2401
414 Ga0501037_0000462 3300049573 Bacteria 33017
415 Ga0501038_0001661 3300049574 Bacteria 20629
416 Ga0501038_0120609 3300049574 Bacteria 2163
417 Ga0501039_0000040 3300049575 Bacteria 115567
418 Ga0501043_0000296 3300049579 Bacteria 45015
419 Ga0501043_0031725 3300049579 Bacteria 4153
420 Ga0501047_0205431 3300049581 Bacteria 1829
421 Ga0501067_0084102 3300049583 Bacteria 1765
422 Ga0501073_0092668 3300049589 Bacteria 2100
423 Ga0501073_0106179 3300049589 Bacteria 1949
424 Ga0501076_0175281 3300049592 Bacteria 1748
425 Ga0501079_0078537 3300049741 Bacteria 2553
426 Ga0501079_0266024 3300049741 Bacteria 1340
427 Ga0501081_0237343 3300049743 Bacteria 1329
428 Ga0501081_0344530 3300049743 Bacteria 1098
429 Ga0501083_0055845 3300049744 Bacteria 2646
430 Ga0501035_0000144 3300049822 Bacteria 86257
431 Ga0501044_0002802 3300049823 Bacteria 19865
432 Ga0501044_0143836 3300049823 Bacteria 2372
433 Ga0501044_0242241 3300049823 Bacteria 1747
434 nmdc:mga03683_14096_c1 3300050489 Bacteria 2953
435 nmdc:mga00v17_270_c1 3300050491 Bacteria 30629
436 nmdc:mga00v17_6830_c1 3300050491 Bacteria 6064
437 nmdc:mga00v17_71099_c1 3300050491 Bacteria 2156
438 nmdc:mga00v17_88514_c1 3300050491 Bacteria 1942
439 nmdc:mga0yw44_10674_c1 3300050492 Bacteria 4702
440 nmdc:mga0yw44_185_c2 3300050492 Bacteria 9875
441 nmdc:mga0yw44_35075_c1 3300050492 Bacteria 2945
442 nmdc:mga0yw44_3994_c1 3300050492 Bacteria 6666
443 nmdc:mga0k408_22759_c1 3300050493 Bacteria 3531
444 nmdc:mga06z11_1463_c1 3300050494 Bacteria 8791
445 nmdc:mga04h51_3320_c1 3300050495 Bacteria 3903
446 nmdc:mga04h51_702_c1 3300050495 Bacteria 4831
447 nmdc:mga07m45_11621_c1 3300050496 Bacteria 4629
448 nmdc:mga07m45_143855_c1 3300050496 Bacteria 1382
449 nmdc:mga07m45_52305_c1 3300050496 Bacteria 2306
450 nmdc:mga06r32_161085_c1 3300050510 Bacteria 2226
451 nmdc:mga0sz30_1697_c1 3300050516 Bacteria 7827
452 nmdc:mga0sz30_18668_c1 3300050516 Bacteria 2778
453 nmdc:mga0sz30_61547_c1 3300050516 Bacteria 1604
454 Ga0500654_104648 3300053099 Bacteria 1189
455 Ga0500560_003440 3300053107 Bacteria 3200
456 Ga0500572_013955 3300053111 Bacteria 1998
457 Ga0500618_009865 3300053125 Bacteria 2589
458 Ga0500568_0000035 3300053139 Bacteria 137912
459 Ga0500573_0005911 3300053140 Bacteria 6582
460 Ga0500616_0001195 3300053153 Bacteria 26384
461 Ga0500616_0001322 3300053153 Bacteria 24433
462 Ga0500616_0121879 3300053153 Bacteria 1244
463 Ga0500622_0000117 3300053156 Bacteria 82720
464 Ga0500624_000960 3300053157 Bacteria 5940
465 Ga0500627_0022208 3300053158 Bacteria 2570
466 Ga0500634_0010532 3300053161 Bacteria 4728
467 Ga0500634_0010597 3300053161 Bacteria 4716
468 Ga0500636_0000006 3300053177 Bacteria 183899
469 Ga0500636_0006086 3300053177 Bacteria 6924
470 Ga0587077_020742 3300059493 Bacteria 1159
471 Ga0587082_007053 3300059504 Bacteria 1521
472 Ga0587083_0022550 3300059505 Bacteria 1180
473 Ga0587090_005104 3300059510 Bacteria 1628
474 Ga0587091_003098 3300059511 Bacteria 2055
475 Ga0587106_002790 3300059605 Bacteria 1762
476 Ga0587101_002817 3300059623 Bacteria 1706
477 Ga0587109_019549 3300059624 Bacteria 1195
478 Ga0587115_007114 3300059626 Bacteria 1313
479 Ga0587062_009354 3300059639 Bacteria 1192
480 Ga0587067_017373 3300059640 Bacteria 1193
481 Ga0587072_017600 3300059643 Bacteria 1234
482 Ga0587076_017439 3300059645 Bacteria 1145
483 Ga0587079_006543 3300059647 Bacteria 1702
484 Ga0587079_022219 3300059647 Bacteria 1150
485 Ga0587071_002877 3300060344 Bacteria 2398
486 Ga0587111_0024026 3300060346 Bacteria 1197
487 Ga0501082_0125361 3300060353 Bacteria 2228

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2842357229 2842361033 293
2 3300006038 Ga0075365_10069608 Ga0075365_100696082 296
3 iso_pu_bacteria 2885350715 2885356688 301
4 3300006847 Ga0075431_100018162 Ga0075431_1000181625 304
5 3300050510 nmdc:mga06r32_161085_c1 nmdc:mga06r32_161085_c1_206_1255 304
6 3300050493 nmdc:mga0k408_22759_c1 nmdc:mga0k408_22759_c1_1238_2179 313
7 iso_pu_bacteria 2970532167 2970532423 313
8 3300006048 Ga0075363_100012121 Ga0075363_1000121213 314
9 3300006178 Ga0075367_10010702 Ga0075367_100107024 314
10 3300014326 Ga0157380_10065172 Ga0157380_100651722 314
11 3300025297 Ga0209758_1029006 Ga0209758_10290062 314
12 3300027866 Ga0209813_10001913 Ga0209813_100019134 314
13 3300050495 nmdc:mga04h51_702_c1 nmdc:mga04h51_702_c1_151_1185 314
14 3300006880 Ga0075429_100027195 Ga0075429_1000271953 315
15 3300050491 nmdc:mga00v17_88514_c1 nmdc:mga00v17_88514_c1_149_1144 315
16 3300050492 nmdc:mga0yw44_10674_c1 nmdc:mga0yw44_10674_c1_413_1408 315
17 3300005340 Ga0070689_100186898 Ga0070689_1001868982 316
18 3300025936 Ga0207670_10233698 Ga0207670_102336982 316
19 3300027907 Ga0207428_10148329 Ga0207428_101483292 316
20 3300050492 nmdc:mga0yw44_35075_c1 nmdc:mga0yw44_35075_c1_387_1421 316
21 3300027866 Ga0209813_10004409 Ga0209813_100044092 317
22 3300053153 Ga0500616_0001322 Ga0500616_0001322_4375_5409 317
23 3300006353 Ga0075370_10056684 Ga0075370_100566842 319
24 3300041505 Ga0451849_0403391 Ga0451849_0403391_577_1611 321
25 3300003316 rootH1_10074705 rootH1_100747052 323
26 3300049568 Ga0501031_0017803 Ga0501031_0017803_1081_2196 323
27 3300049569 Ga0501032_0000029 Ga0501032_0000029_39384_40499 323
28 3300049570 Ga0501033_0000367 Ga0501033_0000367_21052_22167 323
29 3300049571 Ga0501034_0000659 Ga0501034_0000659_21044_22159 323
30 3300049573 Ga0501037_0000462 Ga0501037_0000462_21172_22287 323
31 3300049574 Ga0501038_0001661 Ga0501038_0001661_10343_11458 323
32 3300049575 Ga0501039_0000040 Ga0501039_0000040_23432_24547 323
33 3300049579 Ga0501043_0000296 Ga0501043_0000296_30840_31955 323
34 3300049581 Ga0501047_0205431 Ga0501047_0205431_293_1408 323
35 3300049822 Ga0501035_0000144 Ga0501035_0000144_49170_50285 323
36 3300049823 Ga0501044_0002802 Ga0501044_0002802_10401_11516 323
37 iso_pu_bacteria 3004195979 3004197946 324
38 3300006178 Ga0075367_10029453 Ga0075367_100294532 325
39 3300049571 Ga0501034_0096949 Ga0501034_0096949_38_1078 325
40 3300027866 Ga0209813_10012143 Ga0209813_100121432 328
41 3300033541 Ga0316596_1033371 Ga0316596_10333712 329
42 3300006051 Ga0075364_10000847 Ga0075364_100008478 330
43 3300006178 Ga0075367_10001337 Ga0075367_100013374 330
44 3300027866 Ga0209813_10006494 Ga0209813_100064942 330
45 3300049571 Ga0501034_0000740 Ga0501034_0000740_23031_24089 330
46 3300050494 nmdc:mga06z11_1463_c1 nmdc:mga06z11_1463_c1_4531_5580 330
47 3300050495 nmdc:mga04h51_3320_c1 nmdc:mga04h51_3320_c1_683_1732 330
48 iso_pu_bacteria 2643221665 2644361831 330
49 iso_pu_bacteria 2928515477 2928517946 330
50 3300005983 Ga0081540_1004695 Ga0081540_10046952 331
51 3300059626 Ga0587115_007114 Ga0587115_007114_85_1107 331
52 3300005328 Ga0070676_10063006 Ga0070676_100630063 332
53 3300005548 Ga0070665_100047383 Ga0070665_1000473832 332
54 3300006051 Ga0075364_10068629 Ga0075364_100686292 332
55 3300006178 Ga0075367_10011945 Ga0075367_100119452 332
56 3300006353 Ga0075370_10158561 Ga0075370_101585611 332
57 3300009011 Ga0105251_10019463 Ga0105251_100194633 332
58 3300009553 Ga0105249_10001408 Ga0105249_100014087 332
59 3300013102 Ga0157371_10005117 Ga0157371_100051178 332
60 3300013297 Ga0157378_10237575 Ga0157378_102375752 332
61 3300025961 Ga0207712_10005520 Ga0207712_100055207 332
62 3300026089 Ga0207648_10064676 Ga0207648_100646762 332
63 3300028379 Ga0268266_10090135 Ga0268266_100901352 332
64 3300050496 nmdc:mga07m45_143855_c1 nmdc:mga07m45_143855_c1_32_1060 332
65 iso_pu_bacteria 3000405567 3000408315 332
66 3300050491 nmdc:mga00v17_71099_c1 nmdc:mga00v17_71099_c1_312_1340 333
67 3300050492 nmdc:mga0yw44_3994_c1 nmdc:mga0yw44_3994_c1_3040_4068 333
68 iso_pu_bacteria 2891048133 2891049263 333
69 iso_pu_bacteria 2989771324 2989772326 333
70 iso_pu_bacteria 8054558443 8054562634 333
71 3300032004 Ga0307414_10219787 Ga0307414_102197871 334
72 iso_pu_bacteria 2690315857 2691329395 334
73 iso_pu_bacteria 2744054655 2745161757 334
74 iso_pu_bacteria 2891633521 2891634760 334
75 iso_pu_bacteria 2958137437 2958137716 334
76 iso_pu_bacteria 2574179768 2574430544 335
77 iso_pu_bacteria 2643221629 2644169780 335
78 iso_pu_bacteria 2643221662 2644350415 335
79 iso_pu_bacteria 2838029111 2838029443 335
80 iso_pu_bacteria 2842475841 2842476127 335
81 iso_pu_bacteria 2842502639 2842502971 335
82 3300003578 Ga0006562J51391_1072973 Ga0006562J51391_10729731 336
83 3300003856 Ga0058692_1000001 Ga0058692_1000001611 336
84 3300005272 Ga0065703_1000122 Ga0065703_100012241 336
85 3300005353 Ga0070669_100093928 Ga0070669_1000939282 336
86 3300005473 Ga0074250_12179 Ga0074250_121792 336
87 3300009093 Ga0105240_10082262 Ga0105240_100822622 336
88 3300009101 Ga0105247_10000344 Ga0105247_1000034423 336
89 3300009148 Ga0105243_10000013 Ga0105243_10000013227 336
90 3300025711 Ga0207696_1008767 Ga0207696_10087673 336
91 3300025728 Ga0207655_1000881 Ga0207655_100088122 336
92 3300025728 Ga0207655_1000882 Ga0207655_100088222 336
93 3300025735 Ga0207713_1001253 Ga0207713_100125319 336
94 3300025900 Ga0207710_10000005 Ga0207710_10000005211 336
95 3300025913 Ga0207695_10093107 Ga0207695_100931072 336
96 3300025923 Ga0207681_10009212 Ga0207681_100092125 336
97 3300025935 Ga0207709_10000001 Ga0207709_10000001220 336
98 3300027312 Ga0209371_1000008 Ga0209371_1000008733 336
99 3300030500 Ga0268256_1000009 Ga0268256_1000009733 336
100 3300032004 Ga0307414_10040840 Ga0307414_100408401 336
101 3300037471 Ga0395905_0003361 Ga0395905_0003361_2213_3247 336
102 3300048924 Ga0496121_0257274 Ga0496121_0257274_153_1166 336
103 3300049530 Ga0501314_005259 Ga0501314_005259_36_1055 336
104 iso_pu_bacteria 2510065059 2510317902 336
105 iso_pu_bacteria 2513237305 2514417766 336
106 iso_pu_bacteria 2551306352 2552747429 336
107 iso_pu_bacteria 2639762793 2640735164 336
108 iso_pu_bacteria 2675903507 2678232029 336
109 iso_pu_bacteria 2687453392 2688596728 336
110 iso_pu_bacteria 2721755686 2723573829 336
111 iso_pu_bacteria 2773857761 2774389757 336
112 iso_pu_bacteria 2773857770 2774436503 336
113 iso_pu_bacteria 2834578030 2834578673 336
114 iso_pu_bacteria 2844009547 2844011982 336
115 iso_pu_bacteria 2856328259 2856329602 336
116 iso_pu_bacteria 2856334872 2856338233 336
117 iso_pu_bacteria 2856349417 2856355091 336
118 iso_pu_bacteria 2857367948 2857371033 336
119 iso_pu_bacteria 2869169390 2869173326 336
120 iso_pu_bacteria 2869234852 2869240091 336
121 iso_pu_bacteria 2869249662 2869251899 336
122 iso_pu_bacteria 2869256925 2869259079 336
123 iso_pu_bacteria 2869264136 2869266612 336
124 iso_pu_bacteria 2871435913 2871443923 336
125 iso_pu_bacteria 2871451962 2871459018 336
126 iso_pu_bacteria 2871459585 2871463893 336
127 iso_pu_bacteria 2871481445 2871483265 336
128 iso_pu_bacteria 2871488783 2871489201 336
129 iso_pu_bacteria 2874109183 2874112925 336
130 iso_pu_bacteria 2874123672 2874128690 336
131 iso_pu_bacteria 2874131515 2874134243 336
132 iso_pu_bacteria 2874162495 2874165313 336
133 iso_pu_bacteria 2874168670 2874175864 336
134 iso_pu_bacteria 2876386047 2876390771 336
135 iso_pu_bacteria 2876399893 2876400468 336
136 iso_pu_bacteria 2876406927 2876408502 336
137 iso_pu_bacteria 2876420981 2876421089 336
138 iso_pu_bacteria 2878730984 2878731206 336
139 iso_pu_bacteria 2878753008 2878754675 336
140 iso_pu_bacteria 2878774303 2878780415 336
141 iso_pu_bacteria 2881155292 2881160509 336
142 iso_pu_bacteria 2881845957 2881847036 336
143 iso_pu_bacteria 2881853255 2881858105 336
144 iso_pu_bacteria 2881861095 2881861956 336
145 iso_pu_bacteria 2882632389 2882638230 336
146 iso_pu_bacteria 2882912400 2882914970 336
147 iso_pu_bacteria 2885318864 2885321409 336
148 iso_pu_bacteria 2899259804 2899260534 336
149 iso_pu_bacteria 2903492973 2903495888 336
150 iso_pu_bacteria 2903513507 2903520702 336
151 iso_pu_bacteria 2906363423 2906368191 336
152 iso_pu_bacteria 2906370794 2906372883 336
153 iso_pu_bacteria 2906393657 2906397954 336
154 iso_pu_bacteria 2906401398 2906406048 336
155 iso_pu_bacteria 2906408224 2906410889 336
156 iso_pu_bacteria 2916699645 2916702669 336
157 iso_pu_bacteria 2919182534 2919183215 336
158 iso_pu_bacteria 2919506607 2919509432 336
159 iso_pu_bacteria 2919534386 2919536095 336
160 iso_pu_bacteria 2922151315 2922154757 336
161 iso_pu_bacteria 2922172374 2922174769 336
162 iso_pu_bacteria 2922178524 2922182551 336
163 iso_pu_bacteria 2924710171 2924716508 336
164 iso_pu_bacteria 2924733363 2924735646 336
165 iso_pu_bacteria 2924741084 2924746150 336
166 iso_pu_bacteria 2924762789 2924766433 336
167 iso_pu_bacteria 2924784321 2924790298 336
168 iso_pu_bacteria 2937822353 2937828255 336
169 iso_pu_bacteria 2937861824 2937865900 336
170 iso_pu_bacteria 2937980651 2937984907 336
171 iso_pu_bacteria 2958108152 2958109336 336
172 iso_pu_bacteria 2958122699 2958123110 336
173 iso_pu_bacteria 2961127735 2961134004 336
174 iso_pu_bacteria 2961170736 2961171231 336
175 iso_pu_bacteria 2961183825 2961184450 336
176 iso_pu_bacteria 2965025482 2965025555 336
177 iso_pu_bacteria 2965032056 2965034025 336
178 iso_pu_bacteria 2965040258 2965041588 336
179 iso_pu_bacteria 2965047637 2965050049 336
180 iso_pu_bacteria 2965089291 2965093591 336
181 iso_pu_bacteria 2965102966 2965105685 336
182 iso_pu_bacteria 2967996073 2967996264 336
183 iso_pu_bacteria 2968003550 2968004499 336
184 iso_pu_bacteria 2970489779 2970491266 336
185 iso_pu_bacteria 2970503327 2970503828 336
186 iso_pu_bacteria 2970510686 2970514479 336
187 iso_pu_bacteria 2970547951 2970551243 336
188 iso_pu_bacteria 2970619444 2970624734 336
189 iso_pu_bacteria 2970627176 2970629630 336
190 iso_pu_bacteria 2977821940 2977823892 336
191 iso_pu_bacteria 2977828996 2977831073 336
192 iso_pu_bacteria 2977851361 2977856327 336
193 iso_pu_bacteria 2977872689 2977874713 336
194 iso_pu_bacteria 2977907340 2977909937 336
195 iso_pu_bacteria 2977935797 2977935895 336
196 iso_pu_bacteria 2977950692 2977952727 336
197 iso_pu_bacteria 2977957713 2977959268 336
198 iso_pu_bacteria 2979772303 2979776805 336
199 iso_pu_bacteria 2979793036 2979795717 336
200 iso_pu_bacteria 2979808191 2979808461 336
201 iso_pu_bacteria 2984568884 2984569040 336
202 iso_pu_bacteria 2987645492 2987649627 336
203 iso_pu_bacteria 2987666974 2987671639 336
204 iso_pu_bacteria 2987673487 2987674708 336
205 iso_pu_bacteria 2996386984 2996390440 336
206 iso_pu_bacteria 3000135777 3000141480 336
207 iso_pu_bacteria 3004167301 3004174086 336
208 iso_pu_bacteria 3004232784 3004239544 336
209 iso_pu_bacteria 3004248173 3004254182 336
210 iso_pu_bacteria 3004268573 3004271328 336
211 iso_pu_bacteria 649633066 649871284 336
212 iso_pu_bacteria 8004361976 8004366282 336
213 iso_pu_bacteria 8004374579 8004376255 336
214 iso_pu_bacteria 8004695233 8004702314 336
215 iso_pu_bacteria 8004727605 8004732136 336
216 iso_pu_bacteria 8033232454 8033232966 336
217 iso_pu_bacteria 8054563764 8054565962 336
218 iso_pu_bacteria 8057132660 8057133352 336
219 3300049568 Ga0501031_0022299 Ga0501031_0022299_915_1955 337
220 iso_pu_bacteria 2510461069 2510839469 337
221 iso_pu_bacteria 2558860983 2561466742 337
222 iso_pu_bacteria 2643221643 2644242399 337
223 iso_pu_bacteria 2713897090 2715500104 337
224 iso_pu_bacteria 2775507049 2776911818 337
225 iso_pu_bacteria 2840878972 2840879858 337
226 iso_pu_bacteria 2855020534 2855021543 337
227 iso_pu_bacteria 8005658619 8005660132 337
228 3300049589 Ga0501073_0106179 Ga0501073_0106179_770_1795 338
229 3300049741 Ga0501079_0078537 Ga0501079_0078537_377_1405 338
230 3300049743 Ga0501081_0344530 Ga0501081_0344530_56_1084 338
231 3300060353 Ga0501082_0125361 Ga0501082_0125361_1156_2184 338
232 iso_pu_bacteria 2837678835 2837683491 338
233 iso_pu_bacteria 2894817345 2894818542 338
234 3300031824 Ga0307413_10017491 Ga0307413_100174911 339
235 3300036712 Ga0316584_0064933 Ga0316584_0064933_1142_2191 339
236 3300044684 Ga0466966_0042662 Ga0466966_0042662_1017_2036 339
237 3300044694 Ga0466963_0004025 Ga0466963_0004025_4315_5334 339
238 3300044765 Ga0466970_0011014 Ga0466970_0011014_505_1524 339
239 3300044842 Ga0466957_0030293 Ga0466957_0030293_1843_2862 339
240 3300045836 Ga0466958_0074527 Ga0466958_0074527_306_1325 339
241 3300048922 Ga0496119_0016346 Ga0496119_0016346_1035_2054 339
242 3300048923 Ga0496120_0102129 Ga0496120_0102129_192_1211 339
243 3300048925 Ga0496122_0017248 Ga0496122_0017248_3732_4751 339
244 3300048926 Ga0496123_0027843 Ga0496123_0027843_1287_2306 339
245 3300048927 Ga0496124_0092622 Ga0496124_0092622_1139_2158 339
246 3300049571 Ga0501034_0019150 Ga0501034_0019150_4741_5763 339
247 3300049823 Ga0501044_0242241 Ga0501044_0242241_198_1223 339
248 3300053139 Ga0500568_0000035 Ga0500568_0000035_2155_3180 339
249 iso_pu_bacteria 2513237146 2513926015 339
250 iso_pu_bacteria 2524023209 2524458211 339
251 iso_pu_bacteria 2599185170 2599417492 339
252 iso_pu_bacteria 2838035591 2838038297 339
253 iso_pu_bacteria 2838661181 2838661826 339
254 iso_pu_bacteria 2842298080 2842299604 339
255 iso_pu_bacteria 2995392953 2995395439 339
256 3300003203 JGI25406J46586_10011996 JGI25406J46586_100119964 340
257 3300005548 Ga0070665_100105884 Ga0070665_1001058842 340
258 3300005983 Ga0081540_1043567 Ga0081540_10435672 340
259 3300005985 Ga0081539_10001304 Ga0081539_1000130429 340
260 3300025926 Ga0207659_10273323 Ga0207659_102733232 340
261 3300025986 Ga0207658_10072382 Ga0207658_100723822 340
262 3300026121 Ga0207683_10050590 Ga0207683_100505901 340
263 3300028379 Ga0268266_10233325 Ga0268266_102333252 340
264 3300041460 Ga0451802_1285483 Ga0451802_1285483_385_1440 340
265 3300042012 Ga0439455_0008427 Ga0439455_0008427_685_1713 340
266 3300046519 Ga0495632_0049160 Ga0495632_0049160_370_1398 340
267 3300046524 Ga0495648_0100031 Ga0495648_0100031_179_1207 340
268 3300046660 Ga0495625_0074576 Ga0495625_0074576_436_1464 340
269 3300047443 Ga0495687_032193 Ga0495687_032193_776_1804 340
270 3300047472 Ga0495686_0059943 Ga0495686_0059943_257_1285 340
271 3300049823 Ga0501044_0143836 Ga0501044_0143836_741_1790 340
272 3300053158 Ga0500627_0022208 Ga0500627_0022208_1203_2303 340
273 3300059624 Ga0587109_019549 Ga0587109_019549_120_1148 340
274 iso_pu_bacteria 2508501122 2509109080 340
275 iso_pu_bacteria 2509276019 2509375188 340
276 iso_pu_bacteria 2509276021 2509388658 340
277 iso_pu_bacteria 2509276033 2509444240 340
278 iso_pu_bacteria 2510065019 2510131197 340
279 iso_pu_bacteria 2510065057 2510303461 340
280 iso_pu_bacteria 2510461076 2510897528 340
281 iso_pu_bacteria 2510917022 2511134724 340
282 iso_pu_bacteria 2510917026 2511172701 340
283 iso_pu_bacteria 2510917028 2511184584 340
284 iso_pu_bacteria 2510917030 2511197750 340
285 iso_pu_bacteria 2511231027 2511392452 340
286 iso_pu_bacteria 2511231052 2511500259 340
287 iso_pu_bacteria 2512047086 2512531792 340
288 iso_pu_bacteria 2512875026 2512972950 340
289 iso_pu_bacteria 2513237084 2513570401 340
290 iso_pu_bacteria 2513237085 2513574590 340
291 iso_pu_bacteria 2513237086 2513582329 340
292 iso_pu_bacteria 2513237088 2513597303 340
293 iso_pu_bacteria 2513237089 2513604469 340
294 iso_pu_bacteria 2513237091 2513616557 340
295 iso_pu_bacteria 2513237093 2513635929 340
296 iso_pu_bacteria 2513237103 2513707229 340
297 iso_pu_bacteria 2513237138 2513870895 340
298 iso_pu_bacteria 2513237140 2513885824 340
299 iso_pu_bacteria 2513237143 2513903895 340
300 iso_pu_bacteria 2513237144 2513911205 340
301 iso_pu_bacteria 2513237156 2513986803 340
302 iso_pu_bacteria 2513237159 2513996554 340
303 iso_pu_bacteria 2513237160 2514008908 340
304 iso_pu_bacteria 2513237162 2514020484 340
305 iso_pu_bacteria 2515075009 2515110134 340
306 iso_pu_bacteria 2515154107 2515607532 340
307 iso_pu_bacteria 2515154113 2515637517 340
308 iso_pu_bacteria 2515154114 2515646944 340
309 iso_pu_bacteria 2515154116 2515656962 340
310 iso_pu_bacteria 2515154134 2515740792 340
311 iso_pu_bacteria 2516143018 2516204523 340
312 iso_pu_bacteria 2516653046 2516891660 340
313 iso_pu_bacteria 2516653077 2517038819 340
314 iso_pu_bacteria 2516653085 2517079074 340
315 iso_pu_bacteria 2517093000 2517093008 340
316 iso_pu_bacteria 2517287029 2517409285 340
317 iso_pu_bacteria 2517487022 2517568433 340
318 iso_pu_bacteria 2519899620 2520379020 340
319 iso_pu_bacteria 2524023207 2524450735 340
320 iso_pu_bacteria 2529292951 2530648029 340
321 iso_pu_bacteria 2534681786 2535485576 340
322 iso_pu_bacteria 2534681796 2535514883 340
323 iso_pu_bacteria 2537561587 2537873293 340
324 iso_pu_bacteria 2551306084 2551674438 340
325 iso_pu_bacteria 2551306085 2551686515 340
326 iso_pu_bacteria 2551306086 2551693744 340
327 iso_pu_bacteria 2551306087 2551702938 340
328 iso_pu_bacteria 2551306089 2551708995 340
329 iso_pu_bacteria 2551306089 2551712737 340
330 iso_pu_bacteria 2551306090 2551716555 340
331 iso_pu_bacteria 2551306090 2551720254 340
332 iso_pu_bacteria 2551306091 2551730721 340
333 iso_pu_bacteria 2551306092 2551733576 340
334 iso_pu_bacteria 2551306093 2551746301 340
335 iso_pu_bacteria 2554235003 2554246494 340
336 iso_pu_bacteria 2558860100 2558866291 340
337 iso_pu_bacteria 2558860242 2559293669 340
338 iso_pu_bacteria 2582581283 2585164707 340
339 iso_pu_bacteria 2582581294 2585205620 340
340 iso_pu_bacteria 2582581298 2585223572 340
341 iso_pu_bacteria 2582581299 2585229633 340
342 iso_pu_bacteria 2582581304 2585256088 340
343 iso_pu_bacteria 2582581306 2585265052 340
344 iso_pu_bacteria 2582581307 2585273791 340
345 iso_pu_bacteria 2582581308 2585280090 340
346 iso_pu_bacteria 2582581315 2585326133 340
347 iso_pu_bacteria 2582581316 2585330299 340
348 iso_pu_bacteria 2582581865 2585385888 340
349 iso_pu_bacteria 2582581866 2585392123 340
350 iso_pu_bacteria 2582581867 2585398774 340
351 iso_pu_bacteria 2585427526 2585523589 340
352 iso_pu_bacteria 2585427527 2585533659 340
353 iso_pu_bacteria 2585427528 2585541988 340
354 iso_pu_bacteria 2585427529 2585545832 340
355 iso_pu_bacteria 2585427530 2585553250 340
356 iso_pu_bacteria 2585427590 2585819104 340
357 iso_pu_bacteria 2585427593 2585840364 340
358 iso_pu_bacteria 2585427594 2585844019 340
359 iso_pu_bacteria 2585427608 2585900642 340
360 iso_pu_bacteria 2585427609 2585905853 340
361 iso_pu_bacteria 2585427633 2585994213 340
362 iso_pu_bacteria 2585427634 2585998731 340
363 iso_pu_bacteria 2585428125 2587979031 340
364 iso_pu_bacteria 2599185156 2599332830 340
365 iso_pu_bacteria 2599185210 2599605757 340
366 iso_pu_bacteria 2599185236 2599719042 340
367 iso_pu_bacteria 2599185352 2600191205 340
368 iso_pu_bacteria 2600254933 2600376523 340
369 iso_pu_bacteria 2600255279 2601609310 340
370 iso_pu_bacteria 2600255308 2601746085 340
371 iso_pu_bacteria 2615840624 2616293642 340
372 iso_pu_bacteria 2615840626 2616309273 340
373 iso_pu_bacteria 2615840698 2616553255 340
374 iso_pu_bacteria 2643221550 2643770090 340
375 iso_pu_bacteria 2643221557 2643806092 340
376 iso_pu_bacteria 2643221558 2643812743 340
377 iso_pu_bacteria 2643221564 2643840258 340
378 iso_pu_bacteria 2643221568 2643857306 340
379 iso_pu_bacteria 2643221582 2643920833 340
380 iso_pu_bacteria 2643221599 2644004706 340
381 iso_pu_bacteria 2643221607 2644047423 340
382 iso_pu_bacteria 2643221610 2644070354 340
383 iso_pu_bacteria 2643221618 2644103492 340
384 iso_pu_bacteria 2643221623 2644131181 340
385 iso_pu_bacteria 2643221626 2644144371 340
386 iso_pu_bacteria 2643221634 2644190375 340
387 iso_pu_bacteria 2643221636 2644199841 340
388 iso_pu_bacteria 2643221637 2644207035 340
389 iso_pu_bacteria 2643221655 2644306422 340
390 iso_pu_bacteria 2643221659 2644330612 340
391 iso_pu_bacteria 2643221668 2644377353 340
392 iso_pu_bacteria 2643221675 2644421116 340
393 iso_pu_bacteria 2643221680 2644454639 340
394 iso_pu_bacteria 2643221686 2644480212 340
395 iso_pu_bacteria 2643221688 2644495644 340
396 iso_pu_bacteria 2643221689 2644497020 340
397 iso_pu_bacteria 2643221693 2644519364 340
398 iso_pu_bacteria 2643221698 2644542584 340
399 iso_pu_bacteria 2643221712 2644612033 340
400 iso_pu_bacteria 2643221718 2644650683 340
401 iso_pu_bacteria 2643221723 2644671779 340
402 iso_pu_bacteria 2643221726 2644692578 340
403 iso_pu_bacteria 2667528174 2671113814 340
404 iso_pu_bacteria 2690316117 2692317480 340
405 iso_pu_bacteria 2718217882 2719179334 340
406 iso_pu_bacteria 2718217927 2719383908 340
407 iso_pu_bacteria 2718217997 2719663699 340
408 iso_pu_bacteria 2718218009 2719730004 340
409 iso_pu_bacteria 2718218199 2720490118 340
410 iso_pu_bacteria 2718218232 2720611498 340
411 iso_pu_bacteria 2718218233 2720618348 340
412 iso_pu_bacteria 2718218235 2720629754 340
413 iso_pu_bacteria 2718218269 2720773450 340
414 iso_pu_bacteria 2718218363 2721145427 340
415 iso_pu_bacteria 2718218365 2721156958 340
416 iso_pu_bacteria 2718218366 2721162322 340
417 iso_pu_bacteria 2718218423 2721397678 340
418 iso_pu_bacteria 2721755514 2722838492 340
419 iso_pu_bacteria 2721755556 2723025120 340
420 iso_pu_bacteria 2721755684 2723558705 340
421 iso_pu_bacteria 2721755685 2723565276 340
422 iso_pu_bacteria 2721755809 2724036488 340
423 iso_pu_bacteria 2721755810 2724042760 340
424 iso_pu_bacteria 2721755819 2724088057 340
425 iso_pu_bacteria 2721755822 2724102541 340
426 iso_pu_bacteria 2721755823 2724108438 340
427 iso_pu_bacteria 2724679232 2725952044 340
428 iso_pu_bacteria 2728369352 2730106056 340
429 iso_pu_bacteria 2728369365 2730162571 340
430 iso_pu_bacteria 2728369397 2730296590 340
431 iso_pu_bacteria 2738541293 2738801424 340
432 iso_pu_bacteria 2738541333 2739036783 340
433 iso_pu_bacteria 2738543024 2739309692 340
434 iso_pu_bacteria 2751185800 2753360599 340
435 iso_pu_bacteria 2751185821 2753462641 340
436 iso_pu_bacteria 2757320392 2757570065 340
437 iso_pu_bacteria 2758568016 2758643040 340
438 iso_pu_bacteria 2765235802 2765467353 340
439 iso_pu_bacteria 2765235942 2766063514 340
440 iso_pu_bacteria 2767802442 2770198083 340
441 iso_pu_bacteria 2775506902 2776269932 340
442 iso_pu_bacteria 2775506904 2776281049 340
443 iso_pu_bacteria 2775507266 2778179564 340
444 iso_pu_bacteria 2791355091 2792621224 340
445 iso_pu_bacteria 2791355092 2792625439 340
446 iso_pu_bacteria 2791355094 2792637873 340
447 iso_pu_bacteria 2791355253 2793282210 340
448 iso_pu_bacteria 2791355256 2793299818 340
449 iso_pu_bacteria 2791355259 2793318513 340
450 iso_pu_bacteria 2791355260 2793325460 340
451 iso_pu_bacteria 2791355261 2793329995 340
452 iso_pu_bacteria 2791355262 2793338276 340
453 iso_pu_bacteria 2791355263 2793344187 340
454 iso_pu_bacteria 2791355264 2793348364 340
455 iso_pu_bacteria 2791355265 2793352805 340
456 iso_pu_bacteria 2791355266 2793363763 340
457 iso_pu_bacteria 2791355267 2793365666 340
458 iso_pu_bacteria 2802428858 2802718518 340
459 iso_pu_bacteria 2802428859 2802724199 340
460 iso_pu_bacteria 2802428860 2802730140 340
461 iso_pu_bacteria 2802428861 2802737482 340
462 iso_pu_bacteria 2802428862 2802742398 340
463 iso_pu_bacteria 2802428863 2802749105 340
464 iso_pu_bacteria 2802429605 2805931690 340
465 iso_pu_bacteria 2802429606 2805932572 340
466 iso_pu_bacteria 2802429633 2806049769 340
467 iso_pu_bacteria 2802429634 2806055956 340
468 iso_pu_bacteria 2802429635 2806062716 340
469 iso_pu_bacteria 2802429636 2806066476 340
470 iso_pu_bacteria 2802429637 2806073539 340
471 iso_pu_bacteria 2808606387 2808986560 340
472 iso_pu_bacteria 2818991439 2819556631 340
473 iso_pu_bacteria 2818991448 2819608561 340
474 iso_pu_bacteria 2818991453 2819640667 340
475 iso_pu_bacteria 2821123053 2821123462 340
476 iso_pu_bacteria 2837651117 2837651795 340
477 iso_pu_bacteria 2838016132 2838022283 340
478 iso_pu_bacteria 2838022645 2838027700 340
479 iso_pu_bacteria 2838042994 2838048637 340
480 iso_pu_bacteria 2838048938 2838054594 340
481 iso_pu_bacteria 2838061910 2838064286 340
482 iso_pu_bacteria 2838068647 2838070892 340
483 iso_pu_bacteria 2838074704 2838075155 340
484 iso_pu_bacteria 2838668709 2838673328 340
485 iso_pu_bacteria 2838675328 2838677363 340
486 iso_pu_bacteria 2838680041 2838680368 340
487 iso_pu_bacteria 2838686498 2838693694 340
488 iso_pu_bacteria 2838694306 2838695600 340
489 iso_pu_bacteria 2838701080 2838706075 340
490 iso_pu_bacteria 2838707686 2838708976 340
491 iso_pu_bacteria 2838714209 2838716251 340
492 iso_pu_bacteria 2838719591 2838719949 340
493 iso_pu_bacteria 2838724970 2838727003 340
494 iso_pu_bacteria 2838729681 2838736370 340
495 iso_pu_bacteria 2838736955 2838739515 340
496 iso_pu_bacteria 2838742623 2838749189 340
497 iso_pu_bacteria 2839993093 2839998099 340
498 iso_pu_bacteria 2841840854 2841844361 340
499 iso_pu_bacteria 2841846520 2841846880 340
500 iso_pu_bacteria 2841851746 2841858486 340
501 iso_pu_bacteria 2841859092 2841860592 340
502 iso_pu_bacteria 2841864319 2841870843 340
503 iso_pu_bacteria 2842077413 2842079789 340
504 iso_pu_bacteria 2842110456 2842111966 340
505 iso_pu_bacteria 2842118031 2842120407 340
506 iso_pu_bacteria 2842124991 2842127091 340
507 iso_pu_bacteria 2842130223 2842132256 340
508 iso_pu_bacteria 2842140634 2842144082 340
509 iso_pu_bacteria 2842146304 2842150582 340
510 iso_pu_bacteria 2842152218 2842152575 340
511 iso_pu_bacteria 2842156927 2842163304 340
512 iso_pu_bacteria 2842163707 2842165394 340
513 iso_pu_bacteria 2842170452 2842172496 340
514 iso_pu_bacteria 2842175837 2842176194 340
515 iso_pu_bacteria 2842180545 2842186931 340
516 iso_pu_bacteria 2842187318 2842189358 340
517 iso_pu_bacteria 2842192696 2842198037 340
518 iso_pu_bacteria 2842198810 2842204257 340
519 iso_pu_bacteria 2842205361 2842207159 340
520 iso_pu_bacteria 2842211629 2842213672 340
521 iso_pu_bacteria 2842217011 2842219067 340
522 iso_pu_bacteria 2842224351 2842224710 340
523 iso_pu_bacteria 2842229732 2842236509 340
524 iso_pu_bacteria 2842237096 2842238387 340
525 iso_pu_bacteria 2842243621 2842250088 340
526 iso_pu_bacteria 2842250916 2842255539 340
527 iso_pu_bacteria 2842257432 2842264099 340
528 iso_pu_bacteria 2842264693 2842270651 340
529 iso_pu_bacteria 2842271015 2842278232 340
530 iso_pu_bacteria 2842278818 2842280148 340
531 iso_pu_bacteria 2842285085 2842286607 340
532 iso_pu_bacteria 2842291075 2842293450 340
533 iso_pu_bacteria 2842304105 2842310480 340
534 iso_pu_bacteria 2842311132 2842317549 340
535 iso_pu_bacteria 2842317721 2842323782 340
536 iso_pu_bacteria 2842341865 2842343296 340
537 iso_pu_bacteria 2842363717 2842367348 340
538 iso_pu_bacteria 2842370503 2842370831 340
539 iso_pu_bacteria 2842377471 2842379847 340
540 iso_pu_bacteria 2842384541 2842386918 340
541 iso_pu_bacteria 2842395702 2842399007 340
542 iso_pu_bacteria 2842402390 2842403840 340
543 iso_pu_bacteria 2842409023 2842410458 340
544 iso_pu_bacteria 2842415677 2842417105 340
545 iso_pu_bacteria 2842422224 2842424507 340
546 iso_pu_bacteria 2842428310 2842434521 340
547 iso_pu_bacteria 2842434925 2842440906 340
548 iso_pu_bacteria 2842441272 2842447508 340
549 iso_pu_bacteria 2842447887 2842454311 340
550 iso_pu_bacteria 2842462802 2842468927 340
551 iso_pu_bacteria 2842469257 2842475471 340
552 iso_pu_bacteria 2842482326 2842486214 340
553 iso_pu_bacteria 2842489311 2842492665 340
554 iso_pu_bacteria 2842509118 2842512821 340
555 iso_pu_bacteria 2842515876 2842517377 340
556 iso_pu_bacteria 2842521101 2842521481 340
557 iso_pu_bacteria 2842871566 2842874818 340
558 iso_pu_bacteria 2842922631 2842923119 340
559 iso_pu_bacteria 2844163670 2844165056 340
560 iso_pu_bacteria 2844454524 2844456238 340
561 iso_pu_bacteria 2847417321 2847417450 340
562 iso_pu_bacteria 2848992105 2848992286 340
563 iso_pu_bacteria 2850079185 2850079789 340
564 iso_pu_bacteria 2852387548 2852388313 340
565 iso_pu_bacteria 2854896431 2854898046 340
566 iso_pu_bacteria 2854911287 2854913790 340
567 iso_pu_bacteria 2854916844 2854919742 340
568 iso_pu_bacteria 2855825444 2855828027 340
569 iso_pu_bacteria 2855839649 2855839797 340
570 iso_pu_bacteria 2855872281 2855873574 340
571 iso_pu_bacteria 2857516855 2857524092 340
572 iso_pu_bacteria 2857531043 2857533588 340
573 iso_pu_bacteria 2858800743 2858803772 340
574 iso_pu_bacteria 2891373044 2891375163 340
575 iso_pu_bacteria 2894652903 2894656374 340
576 iso_pu_bacteria 2896384573 2896388572 340
577 iso_pu_bacteria 2899792073 2899794619 340
578 iso_pu_bacteria 2899845264 2899845959 340
579 iso_pu_bacteria 2904578770 2904580264 340
580 iso_pu_bacteria 2915650412 2915650671 340
581 iso_pu_bacteria 2915980308 2915986441 340
582 iso_pu_bacteria 2915986958 2915990656 340
583 iso_pu_bacteria 2915993759 2915997196 340
584 iso_pu_bacteria 2916000859 2916000898 340
585 iso_pu_bacteria 2916007675 2916011207 340
586 iso_pu_bacteria 2916014648 2916021259 340
587 iso_pu_bacteria 2916021584 2916021954 340
588 iso_pu_bacteria 2916028427 2916034112 340
589 iso_pu_bacteria 2916035215 2916036315 340
590 iso_pu_bacteria 2916041962 2916048377 340
591 iso_pu_bacteria 2916048683 2916053629 340
592 iso_pu_bacteria 2916055098 2916056971 340
593 iso_pu_bacteria 2916061851 2916065181 340
594 iso_pu_bacteria 2916068649 2916071426 340
595 iso_pu_bacteria 2916076590 2916076890 340
596 iso_pu_bacteria 2919100787 2919101542 340
597 iso_pu_bacteria 2919114240 2919116455 340
598 iso_pu_bacteria 2919119836 2919120062 340
599 iso_pu_bacteria 2919166419 2919166717 340
600 iso_pu_bacteria 2919171160 2919172223 340
601 iso_pu_bacteria 2919408235 2919408646 340
602 iso_pu_bacteria 2920760137 2920763591 340
603 iso_pu_bacteria 2920822456 2920823185 340
604 iso_pu_bacteria 2921201388 2921206126 340
605 iso_pu_bacteria 2921208531 2921213729 340
606 iso_pu_bacteria 2921237296 2921241490 340
607 iso_pu_bacteria 2921244191 2921247069 340
608 iso_pu_bacteria 2921250672 2921252712 340
609 iso_pu_bacteria 2921257292 2921262803 340
610 iso_pu_bacteria 2921263974 2921268717 340
611 iso_pu_bacteria 2921282425 2921288198 340
612 iso_pu_bacteria 2921289301 2921293762 340
613 iso_pu_bacteria 2921296804 2921300825 340
614 iso_pu_bacteria 2923556063 2923556504 340
615 iso_pu_bacteria 2924144063 2924150734 340
616 iso_pu_bacteria 2924150972 2924156701 340
617 iso_pu_bacteria 2924158325 2924160287 340
618 iso_pu_bacteria 2924165586 2924170762 340
619 iso_pu_bacteria 2924172951 2924176879 340
620 iso_pu_bacteria 2924179722 2924183675 340
621 iso_pu_bacteria 2924186466 2924190408 340
622 iso_pu_bacteria 2924193448 2924198961 340
623 iso_pu_bacteria 2924200457 2924200829 340
624 iso_pu_bacteria 2924207177 2924209247 340
625 iso_pu_bacteria 2924214083 2924220996 340
626 iso_pu_bacteria 2924221636 2924222240 340
627 iso_pu_bacteria 2924228884 2924232721 340
628 iso_pu_bacteria 2926754445 2926754447 340
629 iso_pu_bacteria 2926760298 2926761651 340
630 iso_pu_bacteria 2929138655 2929142198 340
631 iso_pu_bacteria 2933006813 2933007221 340
632 iso_pu_bacteria 2933011516 2933015189 340
633 iso_pu_bacteria 2933570622 2933576918 340
634 iso_pu_bacteria 2933586486 2933587296 340
635 iso_pu_bacteria 2933594066 2933594422 340
636 iso_pu_bacteria 2933599457 2933601693 340
637 iso_pu_bacteria 2935894831 2935896122 340
638 iso_pu_bacteria 2935901341 2935902686 340
639 iso_pu_bacteria 2936367885 2936369171 340
640 iso_pu_bacteria 2936375103 2936377485 340
641 iso_pu_bacteria 2936381700 2936387204 340
642 iso_pu_bacteria 2936996657 2936998453 340
643 iso_pu_bacteria 2937002841 2937007733 340
644 iso_pu_bacteria 2937009748 2937014982 340
645 iso_pu_bacteria 2937016420 2937022274 340
646 iso_pu_bacteria 2937023124 2937023402 340
647 iso_pu_bacteria 2937029754 2937031533 340
648 iso_pu_bacteria 2937036028 2937040532 340
649 iso_pu_bacteria 2937042894 2937044829 340
650 iso_pu_bacteria 2937049772 2937053338 340
651 iso_pu_bacteria 2937056579 2937061573 340
652 iso_pu_bacteria 2937063883 2937064266 340
653 iso_pu_bacteria 2937071275 2937074918 340
654 iso_pu_bacteria 2937078374 2937083256 340
655 iso_pu_bacteria 2937084907 2937089017 340
656 iso_pu_bacteria 2937091812 2937092075 340
657 iso_pu_bacteria 2937098957 2937099912 340
658 iso_pu_bacteria 2937106411 2937106442 340
659 iso_pu_bacteria 2937113482 2937119446 340
660 iso_pu_bacteria 2937119839 2937126216 340
661 iso_pu_bacteria 2937126314 2937131639 340
662 iso_pu_bacteria 2941499720 2941500916 340
663 iso_pu_bacteria 2957375807 2957377732 340
664 iso_pu_bacteria 2957382221 2957388703 340
665 iso_pu_bacteria 2957388812 2957393353 340
666 iso_pu_bacteria 2957395598 2957397799 340
667 iso_pu_bacteria 2957402308 2957403918 340
668 iso_pu_bacteria 2957408893 2957413348 340
669 iso_pu_bacteria 2957415311 2957417702 340
670 iso_pu_bacteria 2957422303 2957427019 340
671 iso_pu_bacteria 2957430029 2957436861 340
672 iso_pu_bacteria 2957437181 2957438865 340
673 iso_pu_bacteria 2957443900 2957447324 340
674 iso_pu_bacteria 2957450854 2957451246 340
675 iso_pu_bacteria 2957457609 2957460153 340
676 iso_pu_bacteria 2957464669 2957469549 340
677 iso_pu_bacteria 2957471148 2957473497 340
678 iso_pu_bacteria 2957478035 2957481978 340
679 iso_pu_bacteria 2957484790 2957484804 340
680 iso_pu_bacteria 2957491536 2957492079 340
681 iso_pu_bacteria 2957498199 2957500695 340
682 iso_pu_bacteria 2957505466 2957508097 340
683 iso_pu_bacteria 2960584000 2960590224 340
684 iso_pu_bacteria 2960591022 2960594567 340
685 iso_pu_bacteria 2960597568 2960603357 340
686 iso_pu_bacteria 2960603979 2960607835 340
687 iso_pu_bacteria 2960610863 2960611697 340
688 iso_pu_bacteria 2960617483 2960620053 340
689 iso_pu_bacteria 2960624210 2960626744 340
690 iso_pu_bacteria 2960631154 2960637207 340
691 iso_pu_bacteria 2960637947 2960641508 340
692 iso_pu_bacteria 2960645483 2960648112 340
693 iso_pu_bacteria 2960652885 2960654449 340
694 iso_pu_bacteria 2960660292 2960660608 340
695 iso_pu_bacteria 2960667422 2960672157 340
696 iso_pu_bacteria 2960674078 2960679631 340
697 iso_pu_bacteria 2960680706 2960684457 340
698 iso_pu_bacteria 2960687367 2960687477 340
699 iso_pu_bacteria 2960693952 2960698569 340
700 iso_pu_bacteria 2964607997 2964610507 340
701 iso_pu_bacteria 2964615318 2964618399 340
702 iso_pu_bacteria 2964621998 2964625466 340
703 iso_pu_bacteria 2964628898 2964633758 340
704 iso_pu_bacteria 2964636051 2964639493 340
705 iso_pu_bacteria 2964643177 2964649410 340
706 iso_pu_bacteria 2964649959 2964650136 340
707 iso_pu_bacteria 2964656573 2964663108 340
708 iso_pu_bacteria 2964663802 2964668066 340
709 iso_pu_bacteria 2964670856 2964671098 340
710 iso_pu_bacteria 2964678106 2964682492 340
711 iso_pu_bacteria 2964685014 2964687599 340
712 iso_pu_bacteria 2964691889 2964696596 340
713 iso_pu_bacteria 2964698721 2964703385 340
714 iso_pu_bacteria 2964705432 2964710232 340
715 iso_pu_bacteria 2964712639 2964717192 340
716 iso_pu_bacteria 2964719344 2964722004 340
717 iso_pu_bacteria 2967664464 2967670495 340
718 iso_pu_bacteria 2967671571 2967671828 340
719 iso_pu_bacteria 2967678726 2967680961 340
720 iso_pu_bacteria 2967686174 2967690393 340
721 iso_pu_bacteria 2967693043 2967694874 340
722 iso_pu_bacteria 2967699805 2967703564 340
723 iso_pu_bacteria 2967706974 2967712329 340
724 iso_pu_bacteria 2967714385 2967714468 340
725 iso_pu_bacteria 2967721400 2967723415 340
726 iso_pu_bacteria 2967728569 2967730359 340
727 iso_pu_bacteria 2967735183 2967739218 340
728 iso_pu_bacteria 2967742019 2967743254 340
729 iso_pu_bacteria 2967748971 2967754856 340
730 iso_pu_bacteria 2967755722 2967758221 340
731 iso_pu_bacteria 2967762386 2967766585 340
732 iso_pu_bacteria 2967769361 2967769910 340
733 iso_pu_bacteria 2967775926 2967778034 340
734 iso_pu_bacteria 2970019648 2970023257 340
735 iso_pu_bacteria 2970026789 2970031867 340
736 iso_pu_bacteria 2970033650 2970037141 340
737 iso_pu_bacteria 2970040964 2970041085 340
738 iso_pu_bacteria 2970047711 2970050663 340
739 iso_pu_bacteria 2970054988 2970056879 340
740 iso_pu_bacteria 2970061556 2970062869 340
741 iso_pu_bacteria 2970068827 2970075424 340
742 iso_pu_bacteria 2970076120 2970081813 340
743 iso_pu_bacteria 2970082768 2970088354 340
744 iso_pu_bacteria 2970088815 2970089471 340
745 iso_pu_bacteria 2970095765 2970098821 340
746 iso_pu_bacteria 2970102677 2970106014 340
747 iso_pu_bacteria 2970109326 2970110890 340
748 iso_pu_bacteria 2970116247 2970118233 340
749 iso_pu_bacteria 2970122695 2970128168 340
750 iso_pu_bacteria 2970129317 2970131372 340
751 iso_pu_bacteria 2970136068 2970138938 340
752 iso_pu_bacteria 2970143518 2970144249 340
753 iso_pu_bacteria 2970149975 2970154502 340
754 iso_pu_bacteria 2970156795 2970162035 340
755 iso_pu_bacteria 2970164137 2970170147 340
756 iso_pu_bacteria 2970170962 2970175856 340
757 iso_pu_bacteria 2970177841 2970183650 340
758 iso_pu_bacteria 2970184632 2970188812 340
759 iso_pu_bacteria 2970191845 2970197483 340
760 iso_pu_bacteria 2977516862 2977521085 340
761 iso_pu_bacteria 2977523885 2977528516 340
762 iso_pu_bacteria 2977530762 2977532646 340
763 iso_pu_bacteria 2977537788 2977543770 340
764 iso_pu_bacteria 2977544691 2977550728 340
765 iso_pu_bacteria 2977551784 2977553491 340
766 iso_pu_bacteria 2977558990 2977563756 340
767 iso_pu_bacteria 2977565890 2977571706 340
768 iso_pu_bacteria 2977572785 2977574713 340
769 iso_pu_bacteria 2977579622 2977584409 340
770 iso_pu_bacteria 2978969890 2978973116 340
771 iso_pu_bacteria 2979089926 2979093087 340
772 iso_pu_bacteria 2979095461 2979099525 340
773 iso_pu_bacteria 2979100975 2979105055 340
774 iso_pu_bacteria 2984509177 2984513131 340
775 iso_pu_bacteria 2984518228 2984520502 340
776 iso_pu_bacteria 2984537506 2984539797 340
777 iso_pu_bacteria 2984587000 2984591386 340
778 iso_pu_bacteria 2984601300 2984602010 340
779 iso_pu_bacteria 2989349275 2989351676 340
780 iso_pu_bacteria 2996310559 2996315625 340
781 iso_pu_bacteria 2996887358 2996888299 340
782 iso_pu_bacteria 3002141150 3002141398 340
783 iso_pu_bacteria 3003930520 3003931723 340
784 iso_pu_bacteria 3005409236 3005410959 340
785 iso_pu_bacteria 3005416602 3005422964 340
786 iso_pu_bacteria 3005445848 3005445994 340
787 iso_pu_bacteria 3005452660 3005456667 340
788 iso_pu_bacteria 639633055 639646417 340
789 iso_pu_bacteria 643692032 643824353 340
790 iso_pu_bacteria 648276728 648738424 340
791 iso_pu_bacteria 650716007 650738911 340
792 iso_pu_bacteria 8002285264 8002290344 340
793 iso_pu_bacteria 8003570095 8003572467 340
794 iso_pu_bacteria 8003992118 8003992251 340
795 iso_pu_bacteria 8003999396 8003999514 340
796 iso_pu_bacteria 8005258706 8005261144 340
797 iso_pu_bacteria 8005275841 8005278618 340
798 iso_pu_bacteria 8005282627 8005287690 340
799 iso_pu_bacteria 8005289223 8005291303 340
800 iso_pu_bacteria 8005301065 8005301329 340
801 iso_pu_bacteria 8005307578 8005310612 340
802 iso_pu_bacteria 8005314921 8005315291 340
803 iso_pu_bacteria 8005321885 8005322826 340
804 iso_pu_bacteria 8005376324 8005377664 340
805 iso_pu_bacteria 8005382845 8005386437 340
806 iso_pu_bacteria 8005395548 8005399901 340
807 iso_pu_bacteria 8005430974 8005432711 340
808 iso_pu_bacteria 8005460587 8005460770 340
809 iso_pu_bacteria 8005484373 8005484793 340
810 iso_pu_bacteria 8005497431 8005498441 340
811 iso_pu_bacteria 8005542996 8005543555 340
812 iso_pu_bacteria 8005556819 8005560374 340
813 iso_pu_bacteria 8005563573 8005564166 340
814 iso_pu_bacteria 8005570704 8005573731 340
815 iso_pu_bacteria 8005619151 8005619633 340
816 iso_pu_bacteria 8005626139 8005628203 340
817 iso_pu_bacteria 8005645114 8005649486 340
818 iso_pu_bacteria 8005668836 8005669850 340
819 iso_pu_bacteria 8005682033 8005685268 340
820 iso_pu_bacteria 8005688590 8005692464 340
821 iso_pu_bacteria 8005695170 8005699504 340
822 iso_pu_bacteria 8018127388 8018132876 340
823 iso_pu_bacteria 8018163183 8018163831 340
824 iso_pu_bacteria 8018176218 8018181161 340
825 iso_pu_bacteria 8023680758 8023684473 340
826 iso_pu_bacteria 8024479707 8024480060 340
827 iso_pu_bacteria 8024501048 8024502316 340
828 iso_pu_bacteria 8046767195 8046770857 340
829 iso_pu_bacteria 8054460903 8054461171 340
830 iso_pu_bacteria 8056375014 8056376259 340
831 iso_pu_bacteria 8056382006 8056385556 340
832 iso_pu_bacteria 8057575449 8057580534 340
833 iso_pu_bacteria 8057874678 8057879685 340
834 3300039062 Ga0400483_164349 Ga0400483_164349_2602_3657 341
835 3300028794 Ga0307515_10000198 Ga0307515_100001982 343
836 3300031456 Ga0307513_10006546 Ga0307513_100065462 343
837 3300002075 JGI24738J21930_10024076 JGI24738J21930_100240761 344
838 3300002704 JGI25155J39150_1000013 JGI25155J39150_100001366 344
839 3300002705 JGI25156J39149_1000011 JGI25156J39149_100001166 344
840 3300002737 JGI25162J39368_1000773 JGI25162J39368_100077321 344
841 3300002737 JGI25162J39368_1001043 JGI25162J39368_10010434 344
842 3300002738 JGI25154J39366_1000030 JGI25154J39366_100003066 344
843 3300002741 JGI25157J39369_1000013 JGI25157J39369_100001366 344
844 3300002773 JGI25152J39213_1003141 JGI25152J39213_10031412 344
845 3300002773 JGI25152J39213_1005083 JGI25152J39213_10050832 344
846 3300002773 JGI25152J39213_1008236 JGI25152J39213_10082361 344
847 3300002774 JGI25150J39212_1000276 JGI25150J39212_10002769 344
848 3300002774 JGI25150J39212_1013325 JGI25150J39212_10133251 344
849 3300002987 JGI25159J45721_1000003 JGI25159J45721_1000003161 344
850 3300002987 JGI25159J45721_1000320 JGI25159J45721_10003205 344
851 3300002987 JGI25159J45721_1000553 JGI25159J45721_100055312 344
852 3300003162 Ga0006778J45830_1028201 Ga0006778J45830_10282011 344
853 3300003187 JGI25151J46595_10000110 JGI25151J46595_1000011065 344
854 3300003187 JGI25151J46595_10000425 JGI25151J46595_1000042523 344
855 3300003187 JGI25151J46595_10017623 JGI25151J46595_100176232 344
856 3300003187 JGI25151J46595_10024082 JGI25151J46595_100240822 344
857 3300003214 JGI25165J46597_1000602 JGI25165J46597_10006024 344
858 3300003214 JGI25165J46597_1001279 JGI25165J46597_100127914 344
859 3300003215 JGI25153J46596_10019417 JGI25153J46596_100194171 344
860 3300003215 JGI25153J46596_10034665 JGI25153J46596_100346652 344
861 3300003354 JGI25160J50197_1000003 JGI25160J50197_1000003342 344
862 3300003354 JGI25160J50197_1000041 JGI25160J50197_1000041133 344
863 3300003354 JGI25160J50197_1002266 JGI25160J50197_10022666 344
864 3300003354 JGI25160J50197_1002665 JGI25160J50197_10026653 344
865 3300003354 JGI25160J50197_1003367 JGI25160J50197_10033675 344
866 3300003374 JGI25161J50226_1000002 JGI25161J50226_1000002133 344
867 3300003374 JGI25161J50226_1000315 JGI25161J50226_100031526 344
868 3300003374 JGI25161J50226_1000318 JGI25161J50226_100031819 344
869 3300003559 Ga0007427J51700_108555 Ga0007427J51700_1085551 344
870 3300003578 Ga0006562J51391_1021039 Ga0006562J51391_10210391 344
871 3300003693 Ga0032354_1026823 Ga0032354_10268231 344
872 3300003735 Ga0006780_1022426 Ga0006780_10224261 344
873 3300003771 Ga0055526_1000550 Ga0055526_100055019 344
874 3300003771 Ga0055526_1002545 Ga0055526_10025454 344
875 3300003771 Ga0055526_1013939 Ga0055526_10139392 344
876 3300003771 Ga0055526_1018148 Ga0055526_10181482 344
877 3300003775 Ga0055524_1002964 Ga0055524_10029645 344
878 3300003775 Ga0055524_1003575 Ga0055524_10035758 344
879 3300003775 Ga0055524_1015989 Ga0055524_10159891 344
880 3300003775 Ga0055524_1025467 Ga0055524_10254671 344
881 3300003781 Ga0055536_1007402 Ga0055536_10074022 344
882 3300003790 Ga0055528_1000095 Ga0055528_100009549 344
883 3300003790 Ga0055528_1001482 Ga0055528_10014825 344
884 3300003790 Ga0055528_1008657 Ga0055528_10086572 344
885 3300003791 Ga0055530_10032093 Ga0055530_100320932 344
886 3300003792 Ga0055540_1001140 Ga0055540_10011403 344
887 3300003792 Ga0055540_1002617 Ga0055540_10026175 344
888 3300003794 Ga0055531_10002234 Ga0055531_100022346 344
889 3300003794 Ga0055531_10005165 Ga0055531_100051656 344
890 3300003794 Ga0055531_10025343 Ga0055531_100253431 344
891 3300004625 Ga0055543_1000037 Ga0055543_100003715 344
892 3300004625 Ga0055543_1000203 Ga0055543_100020323 344
893 3300004625 Ga0055543_1000466 Ga0055543_100046619 344
894 3300005262 Ga0065165_1000031 Ga0065165_1000031146 344
895 3300005262 Ga0065165_1000084 Ga0065165_100008418 344
896 3300005262 Ga0065165_1004130 Ga0065165_10041303 344
897 3300005337 Ga0070682_100210418 Ga0070682_1002104181 344
898 3300005355 Ga0070671_100045810 Ga0070671_1000458102 344
899 3300005548 Ga0070665_100154271 Ga0070665_1001542714 344
900 3300005578 Ga0068854_100028036 Ga0068854_1000280362 344
901 3300005614 Ga0068856_100056858 Ga0068856_1000568582 344
902 3300005614 Ga0068856_100105944 Ga0068856_1001059442 344
903 3300005616 Ga0068852_100051558 Ga0068852_1000515583 344
904 3300005937 Ga0081455_10001548 Ga0081455_100015485 344
905 3300006038 Ga0075365_10000298 Ga0075365_100002988 344
906 3300006038 Ga0075365_10005677 Ga0075365_100056772 344
907 3300006038 Ga0075365_10159211 Ga0075365_101592111 344
908 3300006042 Ga0075368_10003333 Ga0075368_100033331 344
909 3300006051 Ga0075364_10022919 Ga0075364_100229192 344
910 3300006177 Ga0075362_10002602 Ga0075362_100026025 344
911 3300006177 Ga0075362_10010718 Ga0075362_100107182 344
912 3300006178 Ga0075367_10000382 Ga0075367_100003825 344
913 3300006178 Ga0075367_10007489 Ga0075367_100074895 344
914 3300006186 Ga0075369_10001075 Ga0075369_100010752 344
915 3300006186 Ga0075369_10055639 Ga0075369_100556391 344
916 3300006195 Ga0075366_10069909 Ga0075366_100699091 344
917 3300006353 Ga0075370_10061903 Ga0075370_100619032 344
918 3300006946 Ga0079104_1011186 Ga0079104_10111862 344
919 3300006946 Ga0079104_1012844 Ga0079104_10128441 344
920 3300006948 Ga0099826_10019370 Ga0099826_100193705 344
921 3300009093 Ga0105240_10000024 Ga0105240_1000002434 344
922 3300009148 Ga0105243_10004039 Ga0105243_1000403912 344
923 3300009148 Ga0105243_10055476 Ga0105243_100554763 344
924 3300009177 Ga0105248_10147694 Ga0105248_101476942 344
925 3300009545 Ga0105237_10000836 Ga0105237_100008363 344
926 3300009765 Ga0123341_1000103 Ga0123341_100010330 344
927 3300009765 Ga0123341_1062925 Ga0123341_10629252 344
928 3300009766 Ga0123342_1012202 Ga0123342_10122026 344
929 3300010375 Ga0105239_10003536 Ga0105239_100035364 344
930 3300011119 Ga0105246_10149590 Ga0105246_101495902 344
931 3300012490 Ga0157322_1000529 Ga0157322_10005291 344
932 3300013102 Ga0157371_10000004 Ga0157371_10000004351 344
933 3300013102 Ga0157371_10010262 Ga0157371_100102626 344
934 3300013104 Ga0157370_10003256 Ga0157370_1000325612 344
935 3300013104 Ga0157370_10003765 Ga0157370_1000376512 344
936 3300013104 Ga0157370_10058687 Ga0157370_100586872 344
937 3300013105 Ga0157369_10047578 Ga0157369_100475783 344
938 3300013105 Ga0157369_10523787 Ga0157369_105237872 344
939 3300013249 Ga0171463_1001 Ga0171463_1001946 344
940 3300014497 Ga0182008_10034276 Ga0182008_100342762 344
941 3300015262 Ga0182007_10001106 Ga0182007_1000110610 344
942 3300015690 Ga0183363_1140 Ga0183363_114013 344
943 3300021321 Ga0214542_1004397 Ga0214542_100439721 344
944 3300021327 Ga0214543_1000027 Ga0214543_1000027135 344
945 3300022739 Ga0228711_1001182 Ga0228711_100118224 344
946 3300022740 Ga0228710_1000008 Ga0228710_1000008150 344
947 3300025206 Ga0209435_100026 Ga0209435_10002665 344
948 3300025208 Ga0209436_100006 Ga0209436_100006144 344
949 3300025208 Ga0209436_102997 Ga0209436_1029973 344
950 3300025233 Ga0209437_100050 Ga0209437_100050393 344
951 3300025233 Ga0209437_100056 Ga0209437_100056124 344
952 3300025245 Ga0207425_1000012 Ga0207425_1000012101 344
953 3300025245 Ga0207425_1004096 Ga0207425_10040964 344
954 3300025245 Ga0207425_1016448 Ga0207425_10164482 344
955 3300025245 Ga0207425_1026807 Ga0207425_10268071 344
956 3300025246 Ga0209646_1000084 Ga0209646_100008465 344
957 3300025246 Ga0209646_1002915 Ga0209646_10029152 344
958 3300025250 Ga0209026_1000080 Ga0209026_100008065 344
959 3300025253 Ga0209677_101825 Ga0209677_1018259 344
960 3300025254 Ga0209148_1006421 Ga0209148_10064212 344
961 3300025256 Ga0209759_1000061 Ga0209759_100006165 344
962 3300025258 Ga0209129_1000110 Ga0209129_1000110101 344
963 3300025258 Ga0209129_1000206 Ga0209129_100020620 344
964 3300025258 Ga0209129_1000985 Ga0209129_10009859 344
965 3300025258 Ga0209129_1001015 Ga0209129_100101511 344
966 3300025258 Ga0209129_1001804 Ga0209129_10018048 344
967 3300025261 Ga0209233_1000037 Ga0209233_1000037435 344
968 3300025261 Ga0209233_1000071 Ga0209233_1000071124 344
969 3300025261 Ga0209233_1000327 Ga0209233_10003277 344
970 3300025273 Ga0209673_1000024 Ga0209673_1000024397 344
971 3300025273 Ga0209673_1000063 Ga0209673_1000063112 344
972 3300025273 Ga0209673_1002553 Ga0209673_10025532 344
973 3300025273 Ga0209673_1002642 Ga0209673_10026422 344
974 3300025273 Ga0209673_1004535 Ga0209673_10045355 344
975 3300025273 Ga0209673_1027734 Ga0209673_10277342 344
976 3300025284 Ga0209130_1000002 Ga0209130_1000002280 344
977 3300025284 Ga0209130_1000005 Ga0209130_1000005136 344
978 3300025284 Ga0209130_1000028 Ga0209130_1000028315 344
979 3300025284 Ga0209130_1024193 Ga0209130_10241931 344
980 3300025284 Ga0209130_1027156 Ga0209130_10271561 344
981 3300025292 Ga0209676_1005679 Ga0209676_10056792 344
982 3300025292 Ga0209676_1022122 Ga0209676_10221222 344
983 3300025294 Ga0209025_1000024 Ga0209025_1000024101 344
984 3300025294 Ga0209025_1000037 Ga0209025_1000037168 344
985 3300025294 Ga0209025_1000060 Ga0209025_1000060213 344
986 3300025294 Ga0209025_1000479 Ga0209025_100047930 344
987 3300025294 Ga0209025_1001805 Ga0209025_100180518 344
988 3300025294 Ga0209025_1001859 Ga0209025_100185919 344
989 3300025294 Ga0209025_1007478 Ga0209025_10074784 344
990 3300025294 Ga0209025_1007820 Ga0209025_10078202 344
991 3300025295 Ga0209564_1000093 Ga0209564_1000093139 344
992 3300025295 Ga0209564_1000316 Ga0209564_100031654 344
993 3300025295 Ga0209564_1000977 Ga0209564_100097739 344
994 3300025295 Ga0209564_1001013 Ga0209564_100101315 344
995 3300025295 Ga0209564_1011493 Ga0209564_10114931 344
996 3300025297 Ga0209758_1000150 Ga0209758_100015064 344
997 3300025297 Ga0209758_1000170 Ga0209758_10001702 344
998 3300025297 Ga0209758_1001467 Ga0209758_100146719 344
999 3300025297 Ga0209758_1001806 Ga0209758_10018069 344
1000 3300025297 Ga0209758_1007099 Ga0209758_10070997 344
1001 3300025298 Ga0209050_1004464 Ga0209050_100446410 344
1002 3300025298 Ga0209050_1018151 Ga0209050_10181512 344
1003 3300025298 Ga0209050_1018305 Ga0209050_10183052 344
1004 3300025299 Ga0209256_1000027 Ga0209256_1000027272 344
1005 3300025299 Ga0209256_1000996 Ga0209256_10009961 344
1006 3300025299 Ga0209256_1001570 Ga0209256_100157019 344
1007 3300025299 Ga0209256_1002960 Ga0209256_10029601 344
1008 3300025299 Ga0209256_1004495 Ga0209256_10044955 344
1009 3300025302 Ga0207426_1000012 Ga0207426_1000012267 344
1010 3300025302 Ga0207426_1000013 Ga0207426_1000013280 344
1011 3300025302 Ga0207426_1000015 Ga0207426_1000015463 344
1012 3300025302 Ga0207426_1000070 Ga0207426_1000070159 344
1013 3300025302 Ga0207426_1000638 Ga0207426_10006389 344
1014 3300025303 Ga0209051_1000135 Ga0209051_100013535 344
1015 3300025303 Ga0209051_1004038 Ga0209051_10040388 344
1016 3300025303 Ga0209051_1009326 Ga0209051_10093262 344
1017 3300025304 Ga0209257_1009998 Ga0209257_10099984 344
1018 3300025304 Ga0209257_1016029 Ga0209257_10160292 344
1019 3300025913 Ga0207695_10000036 Ga0207695_10000036105 344
1020 3300025914 Ga0207671_10000153 Ga0207671_1000015344 344
1021 3300025931 Ga0207644_10216111 Ga0207644_102161112 344
1022 3300025941 Ga0207711_10097502 Ga0207711_100975022 344
1023 3300025961 Ga0207712_10109929 Ga0207712_101099292 344
1024 3300025972 Ga0207668_10235290 Ga0207668_102352901 344
1025 3300026078 Ga0207702_10167066 Ga0207702_101670662 344
1026 3300026142 Ga0207698_10038068 Ga0207698_100380683 344
1027 3300026142 Ga0207698_10402129 Ga0207698_104021291 344
1028 3300027111 Ga0209281_1000043 Ga0209281_1000043326 344
1029 3300027111 Ga0209281_1000306 Ga0209281_100030613 344
1030 3300027111 Ga0209281_1000520 Ga0209281_100052044 344
1031 3300027312 Ga0209371_1000009 Ga0209371_1000009646 344
1032 3300027312 Ga0209371_1001826 Ga0209371_10018266 344
1033 3300027312 Ga0209371_1002409 Ga0209371_10024099 344
1034 3300027666 Ga0209282_1000121 Ga0209282_100012137 344
1035 3300027666 Ga0209282_1002108 Ga0209282_10021086 344
1036 3300027666 Ga0209282_1083474 Ga0209282_10834742 344
1037 3300028379 Ga0268266_10016408 Ga0268266_100164082 344
1038 3300028379 Ga0268266_10038736 Ga0268266_100387362 344
1039 3300028794 Ga0307515_10001776 Ga0307515_1000177615 344
1040 3300030500 Ga0268256_1000010 Ga0268256_1000010645 344
1041 3300030500 Ga0268256_1002677 Ga0268256_10026774 344
1042 3300030744 Ga0316181_1260635 Ga0316181_12606352 344
1043 3300031456 Ga0307513_10243493 Ga0307513_102434932 344
1044 3300031548 Ga0307408_100020322 Ga0307408_1000203223 344
1045 3300031616 Ga0307508_10302293 Ga0307508_103022931 344
1046 3300031731 Ga0307405_10001435 Ga0307405_100014355 344
1047 3300031901 Ga0307406_10033463 Ga0307406_100334632 344
1048 3300031901 Ga0307406_10209597 Ga0307406_102095971 344
1049 3300031901 Ga0307406_10300568 Ga0307406_103005681 344
1050 3300031911 Ga0307412_10072680 Ga0307412_100726802 344
1051 3300031967 Ga0315914_1000754 Ga0315914_10007546 344
1052 3300032002 Ga0307416_100234803 Ga0307416_1002348031 344
1053 3300033430 Ga0315913_1000195 Ga0315913_100019537 344
1054 3300033464 Ga0315915_1000247 Ga0315915_100024713 344
1055 3300035692 Ga0373935_0020800 Ga0373935_0020800_2060_3100 344
1056 3300035695 Ga0373927_0000053 Ga0373927_0000053_57641_58681 344
1057 3300037068 Ga0373925_0012359 Ga0373925_0012359_4429_5469 344
1058 3300037312 Ga0395899_0000058 Ga0395899_0000058_68483_69520 344
1059 3300037418 Ga0395900_0000056 Ga0395900_0000056_68511_69548 344
1060 3300037466 Ga0395898_0000114 Ga0395898_0000114_68502_69539 344
1061 3300037466 Ga0395898_0425316 Ga0395898_0425316_213_1247 344
1062 3300037471 Ga0395905_0000053 Ga0395905_0000053_143530_144567 344
1063 3300038443 Ga0395901_0000037 Ga0395901_0000037_68511_69548 344
1064 3300041413 Ga0439465_0041163 Ga0439465_0041163_254_1288 344
1065 3300041441 Ga0451787_844771 Ga0451787_844771_337_1371 344
1066 3300041451 Ga0451791_0335165 Ga0451791_0335165_337_1371 344
1067 3300041458 Ga0451798_0653057 Ga0451798_0653057_416_1450 344
1068 3300045976 Ga0466967_0134359 Ga0466967_0134359_374_1408 344
1069 3300046460 Ga0495638_0042269 Ga0495638_0042269_1355_2389 344
1070 3300046507 Ga0495606_0006045 Ga0495606_0006045_4828_5862 344
1071 3300046507 Ga0495606_0159121 Ga0495606_0159121_172_1206 344
1072 3300046512 Ga0495610_0058992 Ga0495610_0058992_268_1302 344
1073 3300046515 Ga0495620_0018822 Ga0495620_0018822_311_1345 344
1074 3300046518 Ga0495631_0045617 Ga0495631_0045617_541_1575 344
1075 3300046530 Ga0495654_0001320 Ga0495654_0001320_4579_5613 344
1076 3300046558 Ga0495633_0025401 Ga0495633_0025401_1318_2352 344
1077 3300046660 Ga0495625_0030670 Ga0495625_0030670_2539_3573 344
1078 3300046674 Ga0495588_0000697 Ga0495588_0000697_6678_7712 344
1079 3300046674 Ga0495588_0045977 Ga0495588_0045977_182_1216 344
1080 3300046692 Ga0495671_0018240 Ga0495671_0018240_1500_2534 344
1081 3300047470 Ga0495681_0022350 Ga0495681_0022350_632_1666 344
1082 3300047472 Ga0495686_0002953 Ga0495686_0002953_9809_10909 344
1083 3300047472 Ga0495686_0054250 Ga0495686_0054250_321_1355 344
1084 3300048903 Ga0496100_0042919 Ga0496100_0042919_1494_2528 344
1085 3300048904 Ga0496101_0084608 Ga0496101_0084608_260_1294 344
1086 3300048905 Ga0496102_0016809 Ga0496102_0016809_4523_5557 344
1087 3300048906 Ga0496103_0013692 Ga0496103_0013692_1272_2306 344
1088 3300048909 Ga0496106_0079772 Ga0496106_0079772_444_1478 344
1089 3300048913 Ga0496110_0145413 Ga0496110_0145413_652_1686 344
1090 3300048914 Ga0496111_0003716 Ga0496111_0003716_5846_6880 344
1091 3300048916 Ga0496113_0023658 Ga0496113_0023658_1827_2861 344
1092 3300048919 Ga0496116_0000100 Ga0496116_0000100_24851_25885 344
1093 3300048919 Ga0496116_0008443 Ga0496116_0008443_2944_3978 344
1094 3300048919 Ga0496116_0011001 Ga0496116_0011001_2710_3744 344
1095 3300048919 Ga0496116_0081067 Ga0496116_0081067_779_1813 344
1096 3300048920 Ga0496117_0000002 Ga0496117_0000002_2106474_2107508 344
1097 3300048920 Ga0496117_0003751 Ga0496117_0003751_16300_17334 344
1098 3300048920 Ga0496117_0009021 Ga0496117_0009021_4343_5377 344
1099 3300048921 Ga0496118_0000776 Ga0496118_0000776_17367_18401 344
1100 3300048921 Ga0496118_0012211 Ga0496118_0012211_3802_4836 344
1101 3300048921 Ga0496118_0016123 Ga0496118_0016123_5783_6817 344
1102 3300048921 Ga0496118_0051791 Ga0496118_0051791_990_2024 344
1103 3300048921 Ga0496118_0074369 Ga0496118_0074369_944_1978 344
1104 3300048922 Ga0496119_0001813 Ga0496119_0001813_10864_11940 344
1105 3300048922 Ga0496119_0016196 Ga0496119_0016196_1318_2352 344
1106 3300048922 Ga0496119_0020462 Ga0496119_0020462_1314_2348 344
1107 3300048922 Ga0496119_0022254 Ga0496119_0022254_2493_3527 344
1108 3300048922 Ga0496119_0065582 Ga0496119_0065582_1105_2139 344
1109 3300048923 Ga0496120_0000034 Ga0496120_0000034_39775_40809 344
1110 3300048923 Ga0496120_0017769 Ga0496120_0017769_2010_3044 344
1111 3300048924 Ga0496121_0000220 Ga0496121_0000220_121186_122220 344
1112 3300048924 Ga0496121_0002488 Ga0496121_0002488_25591_26625 344
1113 3300048924 Ga0496121_0005480 Ga0496121_0005480_11777_12811 344
1114 3300048924 Ga0496121_0012849 Ga0496121_0012849_4649_5683 344
1115 3300048924 Ga0496121_0146856 Ga0496121_0146856_367_1401 344
1116 3300048925 Ga0496122_0000001 Ga0496122_0000001_1477264_1478298 344
1117 3300048925 Ga0496122_0001480 Ga0496122_0001480_15581_16615 344
1118 3300048925 Ga0496122_0004948 Ga0496122_0004948_11311_12345 344
1119 3300048925 Ga0496122_0007958 Ga0496122_0007958_1889_2923 344
1120 3300048925 Ga0496122_0013812 Ga0496122_0013812_879_1913 344
1121 3300048925 Ga0496122_0088715 Ga0496122_0088715_950_1984 344
1122 3300048925 Ga0496122_0135007 Ga0496122_0135007_119_1195 344
1123 3300048925 Ga0496122_0224450 Ga0496122_0224450_14_1048 344
1124 3300048926 Ga0496123_0000001 Ga0496123_0000001_1480995_1482029 344
1125 3300048926 Ga0496123_0000238 Ga0496123_0000238_89090_90124 344
1126 3300048926 Ga0496123_0009385 Ga0496123_0009385_41_1075 344
1127 3300048926 Ga0496123_0012845 Ga0496123_0012845_4517_5551 344
1128 3300048926 Ga0496123_0043341 Ga0496123_0043341_422_1498 344
1129 3300048927 Ga0496124_0000083 Ga0496124_0000083_190786_191820 344
1130 3300048927 Ga0496124_0001450 Ga0496124_0001450_1749_2783 344
1131 3300048927 Ga0496124_0004345 Ga0496124_0004345_11718_12752 344
1132 3300048927 Ga0496124_0007026 Ga0496124_0007026_9792_10826 344
1133 3300048927 Ga0496124_0023874 Ga0496124_0023874_3448_4560 344
1134 3300048927 Ga0496124_0079046 Ga0496124_0079046_1476_2510 344
1135 3300048927 Ga0496124_0150064 Ga0496124_0150064_14_1048 344
1136 3300048928 Ga0496125_0000001 Ga0496125_0000001_121326_122360 344
1137 3300048928 Ga0496125_0000633 Ga0496125_0000633_4819_5853 344
1138 3300048928 Ga0496125_0009600 Ga0496125_0009600_345_1379 344
1139 3300048928 Ga0496125_0015127 Ga0496125_0015127_3264_4298 344
1140 3300048928 Ga0496125_0098066 Ga0496125_0098066_250_1284 344
1141 3300048929 Ga0496126_0000311 Ga0496126_0000311_80088_81122 344
1142 3300048929 Ga0496126_0000971 Ga0496126_0000971_62_1096 344
1143 3300048929 Ga0496126_0019003 Ga0496126_0019003_3780_4814 344
1144 3300048929 Ga0496126_0067815 Ga0496126_0067815_41_1075 344
1145 3300048929 Ga0496126_0068539 Ga0496126_0068539_108_1142 344
1146 3300048929 Ga0496126_0100613 Ga0496126_0100613_1183_2259 344
1147 3300049459 Ga0495678_019359 Ga0495678_019359_437_1471 344
1148 3300049568 Ga0501031_0087598 Ga0501031_0087598_683_1717 344
1149 3300049569 Ga0501032_0015869 Ga0501032_0015869_1074_2108 344
1150 3300049570 Ga0501033_0116255 Ga0501033_0116255_413_1447 344
1151 3300049571 Ga0501034_0134887 Ga0501034_0134887_494_1528 344
1152 3300049571 Ga0501034_0308564 Ga0501034_0308564_331_1365 344
1153 3300049572 Ga0501036_0104009 Ga0501036_0104009_751_1785 344
1154 3300049574 Ga0501038_0120609 Ga0501038_0120609_710_1744 344
1155 3300049579 Ga0501043_0031725 Ga0501043_0031725_2697_3731 344
1156 3300049583 Ga0501067_0084102 Ga0501067_0084102_417_1454 344
1157 3300049589 Ga0501073_0092668 Ga0501073_0092668_238_1272 344
1158 3300049592 Ga0501076_0175281 Ga0501076_0175281_523_1569 344
1159 3300049741 Ga0501079_0266024 Ga0501079_0266024_30_1118 344
1160 3300049743 Ga0501081_0237343 Ga0501081_0237343_149_1237 344
1161 3300049744 Ga0501083_0055845 Ga0501083_0055845_1435_2469 344
1162 3300050489 nmdc:mga03683_14096_c1 nmdc:mga03683_14096_c1_1303_2337 344
1163 3300050491 nmdc:mga00v17_270_c1 nmdc:mga00v17_270_c1_2448_3482 344
1164 3300050491 nmdc:mga00v17_6830_c1 nmdc:mga00v17_6830_c1_149_1183 344
1165 3300050492 nmdc:mga0yw44_185_c2 nmdc:mga0yw44_185_c2_6163_7197 344
1166 3300050496 nmdc:mga07m45_11621_c1 nmdc:mga07m45_11621_c1_1420_2454 344
1167 3300050496 nmdc:mga07m45_52305_c1 nmdc:mga07m45_52305_c1_928_1962 344
1168 3300050516 nmdc:mga0sz30_1697_c1 nmdc:mga0sz30_1697_c1_4913_5947 344
1169 3300050516 nmdc:mga0sz30_18668_c1 nmdc:mga0sz30_18668_c1_641_1675 344
1170 3300050516 nmdc:mga0sz30_61547_c1 nmdc:mga0sz30_61547_c1_175_1209 344
1171 3300053099 Ga0500654_104648 Ga0500654_104648_122_1156 344
1172 3300053107 Ga0500560_003440 Ga0500560_003440_1900_2934 344
1173 3300053111 Ga0500572_013955 Ga0500572_013955_235_1269 344
1174 3300053125 Ga0500618_009865 Ga0500618_009865_1132_2166 344
1175 3300053140 Ga0500573_0005911 Ga0500573_0005911_2633_3667 344
1176 3300053153 Ga0500616_0001195 Ga0500616_0001195_1832_2866 344
1177 3300053153 Ga0500616_0121879 Ga0500616_0121879_64_1098 344
1178 3300053156 Ga0500622_0000117 Ga0500622_0000117_60304_61338 344
1179 3300053157 Ga0500624_000960 Ga0500624_000960_1345_2379 344
1180 3300053161 Ga0500634_0010532 Ga0500634_0010532_956_1990 344
1181 3300053161 Ga0500634_0010597 Ga0500634_0010597_3479_4513 344
1182 3300053177 Ga0500636_0000006 Ga0500636_0000006_37755_38789 344
1183 3300053177 Ga0500636_0006086 Ga0500636_0006086_4672_5706 344
1184 3300059493 Ga0587077_020742 Ga0587077_020742_64_1098 344
1185 3300059504 Ga0587082_007053 Ga0587082_007053_84_1118 344
1186 3300059505 Ga0587083_0022550 Ga0587083_0022550_58_1092 344
1187 3300059510 Ga0587090_005104 Ga0587090_005104_504_1538 344
1188 3300059511 Ga0587091_003098 Ga0587091_003098_78_1112 344
1189 3300059605 Ga0587106_002790 Ga0587106_002790_91_1125 344
1190 3300059623 Ga0587101_002817 Ga0587101_002817_239_1273 344
1191 3300059639 Ga0587062_009354 Ga0587062_009354_78_1112 344
1192 3300059640 Ga0587067_017373 Ga0587067_017373_80_1114 344
1193 3300059643 Ga0587072_017600 Ga0587072_017600_120_1154 344
1194 3300059645 Ga0587076_017439 Ga0587076_017439_31_1065 344
1195 3300059647 Ga0587079_006543 Ga0587079_006543_76_1110 344
1196 3300059647 Ga0587079_022219 Ga0587079_022219_49_1083 344
1197 3300060344 Ga0587071_002877 Ga0587071_002877_1277_2311 344
1198 3300060346 Ga0587111_0024026 Ga0587111_0024026_89_1123 344
1199 iso_pu_bacteria 2585427531 2585559967 344
1200 iso_pu_bacteria 2996893221 2996893231 344
1201 3300001979 JGI24740J21852_10000265 JGI24740J21852_100002659 345

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12849

PBP_like_2

PBP superfamily domain

17

310

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jwo-assembly1.cif.gz_A the crystal structure of a possible phosphate binding protein from planctomyces limnophilus dsm 3776 0.8554 26 343
4jwo-assembly1.cif.gz_A the crystal structure of a possible phosphate binding protein from planctomyces limnophilus dsm 3776 0.8386 26 343
1twy-assembly10.cif.gz_B crystal structure of an abc-type phosphate transport receptor from vibrio cholerae 0.8129 26 328
1twy-assembly10.cif.gz_B crystal structure of an abc-type phosphate transport receptor from vibrio cholerae 0.81 26 328
1twy-assembly1.cif.gz_A crystal structure of an abc-type phosphate transport receptor from vibrio cholerae 0.803 26 328
ID Description Score Start End Superfamily
4jwoA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9306 26 110 3.40.190.10
1twyF01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9014 26 110 3.40.190.10
1pc3B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8865 26 110 3.40.190.10
4lvqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8521 26 110 3.40.190.10
4gd5B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8475 26 110 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2S6BBB0-F1-model_v4 deleted 0.9955 23 105
AF-A0A259DCA8-F1-model_v4 Phosphonate ABC transporter substrate-binding protein 0.9822 27 345
AF-A0A3B9UK91-F1-model_v4 deleted 0.9801 24 92
AF-A0A4Q2YS71-F1-model_v4 Phosphate ABC transporter substrate-binding protein 0.9762 23 103
AF-A0A357RWG2-F1-model_v4 deleted 0.972 93 345

Feature Viewer

pLDDT pTM Quality
88.2 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map