F491589
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1201 | 974 | 487 | 341 |
Family's Representative Sequence
| Representative Sequence | 3300003693|Ga0032354_1026823|Ga0032354_10268231 |
| Length | 380 |
| Sequence | MNAFKLTVAALAASAAFAGAAVARDQVQVSGSSTVLPYAKIVAETFGETFKDFKTPVVESGGTGAGLKEFCKGVGPDTIDVANASRPINAKELEACKAAGVTDIQEVKIGYDGIVFATDSSNPDVAYEPADLYKALAAQVVVDGKLVANPYKKWSEVNSKLPAVDIAAYIPGEKHGTREVFELNVLAAGCKDSGALEVISKEIADKAAQSKACVAVRKDGAAVDIDGDYPETLARIAANKTGVGVFGLSFYENNADKLKVATVKGIVPSPETIADGTYPVSRPLFFYVKKAHLGVIPGLKEYVNFFVSDQMVGPDSPLVEYGLVAAPDAEREATRKSVEDGKAFVRSMGAVKLNYSMIGSRDGRSAVSLLGAEGLGDLNE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 4 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 5 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 6 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 7 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 8 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 9 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 10 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 11 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 12 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 13 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 14 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 15 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 16 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 17 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 18 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 19 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 20 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 21 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 22 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 23 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 24 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 25 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 26 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 27 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 28 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 29 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 30 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 31 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 32 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 33 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 34 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 35 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 36 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 37 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 38 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 39 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 40 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 41 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 42 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 43 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 44 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 45 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 46 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 47 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 48 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 49 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 50 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 51 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 52 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 53 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 54 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 55 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 56 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 57 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 58 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 59 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 60 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 61 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 62 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 63 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 64 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 65 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 66 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 67 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 68 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 69 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 70 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 71 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 72 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 73 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 74 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 75 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 76 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 77 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 78 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 79 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 80 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 81 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 82 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 83 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 84 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 85 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 86 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 87 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 88 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 89 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 90 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 91 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 92 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 93 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 94 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 95 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 96 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 97 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 98 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 99 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 100 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 101 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 102 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 103 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 104 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 105 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 106 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 107 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 108 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 109 | 2639762793 | Acinetobacter calcoaceticus GK1 | Isolate | Rhizosphere |
| 110 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 111 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 112 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 113 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 114 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 115 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 116 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 117 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 118 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 119 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 120 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 121 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 122 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 123 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 124 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 125 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 126 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 127 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 128 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 129 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 130 | 2643221665 | Acinetobacter sp. Root1280 | Isolate | Unclassified |
| 131 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 132 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 133 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 134 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 135 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 136 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 137 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 138 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 139 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 140 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 141 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 142 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 143 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 144 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 145 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 146 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 147 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 148 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 149 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 150 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 151 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 152 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 153 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 154 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 155 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 156 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 157 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 158 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 159 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 160 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 161 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 162 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 163 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 164 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 165 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 166 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 167 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 168 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 169 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 170 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 171 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 172 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 173 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 174 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 175 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 176 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 177 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 178 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 179 | 2744054655 | Acinetobacter sp. BMW17 | Isolate | Unclassified |
| 180 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 181 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 182 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 183 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 184 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 185 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 186 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 187 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 188 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 189 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 190 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 191 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 192 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 193 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 194 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 195 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 196 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 197 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 198 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 199 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 200 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 201 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 202 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 203 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 204 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 205 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 206 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 207 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 208 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 209 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 210 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 211 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 212 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 213 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 214 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 215 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 216 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 217 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 218 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 219 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 220 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 221 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 222 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 223 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 224 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 225 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 226 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 227 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 228 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 229 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 230 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 231 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 232 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 233 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 234 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 235 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 236 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 237 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 238 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 239 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 240 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 241 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 242 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 243 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 244 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 245 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 246 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 247 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 248 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 249 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 250 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 251 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 252 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 253 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 254 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 255 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 256 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 257 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 258 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 259 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 260 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 261 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 262 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 263 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 264 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 265 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 266 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 267 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 268 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 269 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 270 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 271 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 272 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 273 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 274 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 275 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 276 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 277 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 278 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 279 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 280 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 281 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 282 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 283 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 284 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 285 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 286 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 287 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 288 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 289 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 290 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 291 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 292 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 293 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 294 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 295 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 296 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 297 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 298 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 299 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 300 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 301 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 302 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 303 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 304 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 305 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 306 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 307 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 308 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 309 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 310 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 311 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 312 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 313 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 314 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 315 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 316 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 317 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 318 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 319 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 320 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 321 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 322 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 323 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 324 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 325 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 326 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 327 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 328 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 329 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 330 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 331 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 332 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 333 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 334 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 335 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 336 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 337 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 338 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 339 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 340 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 341 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 342 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 343 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 344 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 345 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 346 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 347 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 348 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 349 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 350 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 351 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 352 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 353 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 354 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 355 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 356 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 357 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 358 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 359 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 360 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 361 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 362 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 363 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 364 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 365 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 366 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 367 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 368 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 369 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 370 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 371 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 372 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 373 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 374 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 375 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 376 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 377 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 378 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 379 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 380 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 381 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 382 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 383 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 384 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 385 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 386 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 387 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 388 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 389 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 390 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 391 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 392 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 393 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 394 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 395 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 396 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 397 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 398 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 399 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 400 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 401 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 402 | 2916699645 | Acinetobacter ursingii M3 | Isolate | Unclassified |
| 403 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 404 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 405 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 406 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 407 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 408 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 409 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 410 | 2919506607 | Acinetobacter sp. 3657 | Isolate | Unclassified |
| 411 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 412 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 413 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 414 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 415 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 416 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 417 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 418 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 419 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 420 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 421 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 422 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 423 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 424 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 425 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 426 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 427 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 428 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 429 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 430 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 431 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 432 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 433 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 434 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 435 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 436 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 437 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 438 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 439 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 440 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 441 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 442 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 443 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 444 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 445 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 446 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 447 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 448 | 2928515477 | Acinetobacter bereziniae 1375 | Isolate | Rhizosphere |
| 449 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 450 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 451 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 452 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 453 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 454 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 455 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 456 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 457 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 458 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 459 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 460 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 461 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 462 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 463 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 464 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 465 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 466 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 467 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 468 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 469 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 470 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 471 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 472 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 473 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 474 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 475 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 476 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 477 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 478 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 479 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 480 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 481 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 482 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 483 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 484 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 485 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 486 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 487 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 488 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 489 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 490 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 491 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 492 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 493 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 494 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 495 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 496 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 497 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 498 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 499 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 500 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 501 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 502 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 503 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 504 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 505 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 506 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 507 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 508 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 509 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 510 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 511 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 512 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 513 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 514 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 515 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 516 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 517 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 518 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 519 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 520 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 521 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 522 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 523 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 524 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 525 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 526 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 527 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 528 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 529 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 530 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 531 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 532 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 533 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 534 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 535 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 536 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 537 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 538 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 539 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 540 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 541 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 542 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 543 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 544 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 545 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 546 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 547 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 548 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 549 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 550 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 551 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 552 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 553 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 554 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 555 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 556 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 557 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 558 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 559 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 560 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 561 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 562 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 563 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 564 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 565 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 566 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 567 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 568 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 569 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 570 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 571 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 572 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 573 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 574 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 575 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 576 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 577 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 578 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 579 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 580 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 581 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 582 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 583 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 584 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 585 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 586 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 587 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 588 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 589 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 590 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 591 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 592 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 593 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 594 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 595 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 596 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 597 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 598 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 599 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 600 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 601 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 602 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 603 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 604 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 605 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 606 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 607 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 608 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 609 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 610 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 611 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 612 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 613 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 614 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 615 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 616 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 617 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 618 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 619 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 620 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 621 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 622 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 623 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 624 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 625 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 626 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 627 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 628 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 629 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 630 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 631 | 2984568884 | Acinetobacter baylyi SORGH_AS893 | Isolate | Aerial Root |
| 632 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 633 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 634 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 635 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 636 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 637 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 638 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 639 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 640 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 641 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 642 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 643 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 644 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 645 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 646 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 647 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 648 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 649 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 650 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 651 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 652 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 653 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 654 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 655 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 656 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 657 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 658 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 659 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 660 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 661 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 662 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 663 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 664 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 665 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 666 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 667 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 668 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 669 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 670 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 671 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 672 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 673 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 674 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 675 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 676 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 677 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 678 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 679 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 680 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 681 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 682 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 683 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 684 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 685 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 686 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 687 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 688 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 689 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 690 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 691 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 692 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 693 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 694 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 695 | 3300005473 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v2 (version 2) | Metagenome | Rhizosphere |
| 696 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 697 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 698 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 699 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 700 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 701 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 702 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 703 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 704 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 705 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 706 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 707 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 708 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 709 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 710 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 711 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 712 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 713 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 714 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 715 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 716 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 717 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 718 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 719 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 720 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 721 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 722 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 723 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 724 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 725 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 726 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 727 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 728 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 729 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 730 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 731 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 732 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 733 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 734 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 735 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 736 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 737 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 738 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 739 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 740 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 741 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 742 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 743 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 744 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 745 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 746 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 747 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 748 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 749 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 750 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 751 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 752 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 753 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 754 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 755 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 756 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 757 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 758 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 759 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 760 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 761 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 762 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 763 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 764 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 765 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 766 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 767 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 768 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 769 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 770 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 771 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 772 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 773 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 774 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 775 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 776 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 777 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 778 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 779 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 780 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 781 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 782 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 783 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 784 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 785 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 786 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 787 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 788 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 789 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 790 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 791 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 792 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 793 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 794 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 795 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 796 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 797 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 798 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 799 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 800 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 801 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 802 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 803 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 804 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 805 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 806 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 807 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 808 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 809 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 810 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 811 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 812 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 813 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 814 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 815 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 816 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 817 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 818 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 819 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 820 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 821 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 822 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 823 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 824 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 825 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 826 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 827 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 828 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 829 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 830 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 831 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 832 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 833 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 834 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 835 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 836 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 837 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 838 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 839 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 840 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 841 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 842 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 843 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 844 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 845 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 846 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 847 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 848 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 849 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 850 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 851 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 852 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 853 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 854 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 855 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 856 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 857 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 858 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 859 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 860 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 861 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 862 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 863 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 864 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 865 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 866 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 867 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 868 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 869 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 870 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 871 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 872 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 873 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 874 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 875 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 876 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 877 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 878 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 879 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 880 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 881 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 882 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 883 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 884 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 885 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 886 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 887 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 888 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 889 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 890 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 891 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 892 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 893 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 894 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 895 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 896 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 897 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 898 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 899 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 900 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 901 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 902 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 903 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 904 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 905 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 906 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 907 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 908 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 909 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 910 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 911 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 912 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 913 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 914 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 915 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 916 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 917 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 918 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 919 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 920 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 921 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 922 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 923 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 924 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 925 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 926 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 927 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 928 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 929 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 930 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 931 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 932 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 933 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 934 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 935 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 936 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 937 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 938 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 939 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 940 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 941 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 942 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 943 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 944 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 945 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 946 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 947 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 948 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 949 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 950 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 951 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 952 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 953 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 954 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 955 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 956 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 957 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 958 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 959 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 960 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 961 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 962 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 963 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 964 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 965 | 8033232454 | Acinetobacter radioresistens SA188 | Isolate | Unclassified |
| 966 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 967 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 968 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 969 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 970 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 971 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 972 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
| 973 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 974 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 38.47 |
| Metatranscriptomes | 2.08 |
| Isolates | 59.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.5 |
| Bulb | 0 |
| Endosphere | 14.99 |
| Nodule | 44.3 |
| Rhizoplane | 1.92 |
| Rhizosphere | 21.48 |
| Stem | 0 |
| Stem Tuber | 0.08 |
| Unclassified | 16.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000265 | 3300001979 | Bacteria | 21989 |
| 2 | JGI24738J21930_10024076 | 3300002075 | Bacteria | 1253 |
| 3 | JGI25155J39150_1000013 | 3300002704 | Bacteria | 198215 |
| 4 | JGI25156J39149_1000011 | 3300002705 | Bacteria | 198215 |
| 5 | JGI25162J39368_1000773 | 3300002737 | Bacteria | 21561 |
| 6 | JGI25162J39368_1001043 | 3300002737 | Bacteria | 17032 |
| 7 | JGI25154J39366_1000030 | 3300002738 | Bacteria | 191444 |
| 8 | JGI25157J39369_1000013 | 3300002741 | Bacteria | 198211 |
| 9 | JGI25152J39213_1003141 | 3300002773 | Bacteria | 5769 |
| 10 | JGI25152J39213_1005083 | 3300002773 | Bacteria | 3955 |
| 11 | JGI25152J39213_1008236 | 3300002773 | Bacteria | 2606 |
| 12 | JGI25150J39212_1000276 | 3300002774 | Bacteria | 27042 |
| 13 | JGI25150J39212_1013325 | 3300002774 | Bacteria | 1428 |
| 14 | JGI25159J45721_1000003 | 3300002987 | Bacteria | 274069 |
| 15 | JGI25159J45721_1000320 | 3300002987 | Bacteria | 22279 |
| 16 | JGI25159J45721_1000553 | 3300002987 | Bacteria | 16968 |
| 17 | Ga0006778J45830_1028201 | 3300003162 | Bacteria | 1371 |
| 18 | JGI25151J46595_10000110 | 3300003187 | Bacteria | 111972 |
| 19 | JGI25151J46595_10000425 | 3300003187 | Bacteria | 42264 |
| 20 | JGI25151J46595_10017623 | 3300003187 | Bacteria | 3091 |
| 21 | JGI25151J46595_10024082 | 3300003187 | Bacteria | 2496 |
| 22 | JGI25406J46586_10011996 | 3300003203 | Bacteria | 3777 |
| 23 | JGI25165J46597_1000602 | 3300003214 | Bacteria | 30787 |
| 24 | JGI25165J46597_1001279 | 3300003214 | Bacteria | 14641 |
| 25 | JGI25153J46596_10019417 | 3300003215 | Bacteria | 2606 |
| 26 | JGI25153J46596_10034665 | 3300003215 | Bacteria | 1646 |
| 27 | rootH1_10074705 | 3300003316 | Bacteria | 2877 |
| 28 | JGI25160J50197_1000003 | 3300003354 | Bacteria | 482719 |
| 29 | JGI25160J50197_1000041 | 3300003354 | Bacteria | 152843 |
| 30 | JGI25160J50197_1002266 | 3300003354 | Bacteria | 9022 |
| 31 | JGI25160J50197_1002665 | 3300003354 | Bacteria | 8226 |
| 32 | JGI25160J50197_1003367 | 3300003354 | Bacteria | 7166 |
| 33 | JGI25161J50226_1000002 | 3300003374 | Bacteria | 420324 |
| 34 | JGI25161J50226_1000315 | 3300003374 | Bacteria | 26611 |
| 35 | JGI25161J50226_1000318 | 3300003374 | Bacteria | 26473 |
| 36 | Ga0007427J51700_108555 | 3300003559 | Bacteria | 1300 |
| 37 | Ga0006562J51391_1021039 | 3300003578 | Bacteria | 2749 |
| 38 | Ga0006562J51391_1072973 | 3300003578 | Bacteria | 1975 |
| 39 | Ga0032354_1026823 | 3300003693 | Bacteria | 1335 |
| 40 | Ga0006780_1022426 | 3300003735 | Bacteria | 1473 |
| 41 | Ga0055526_1000550 | 3300003771 | Bacteria | 29646 |
| 42 | Ga0055526_1002545 | 3300003771 | Bacteria | 12244 |
| 43 | Ga0055526_1013939 | 3300003771 | Bacteria | 3351 |
| 44 | Ga0055526_1018148 | 3300003771 | Bacteria | 2642 |
| 45 | Ga0055524_1002964 | 3300003775 | Bacteria | 8459 |
| 46 | Ga0055524_1003575 | 3300003775 | Bacteria | 7491 |
| 47 | Ga0055524_1015989 | 3300003775 | Bacteria | 2713 |
| 48 | Ga0055524_1025467 | 3300003775 | Bacteria | 1852 |
| 49 | Ga0055536_1007402 | 3300003781 | Bacteria | 4925 |
| 50 | Ga0055528_1000095 | 3300003790 | Bacteria | 70572 |
| 51 | Ga0055528_1001482 | 3300003790 | Bacteria | 14257 |
| 52 | Ga0055528_1008657 | 3300003790 | Bacteria | 4326 |
| 53 | Ga0055530_10032093 | 3300003791 | Bacteria | 1370 |
| 54 | Ga0055540_1001140 | 3300003792 | Bacteria | 16584 |
| 55 | Ga0055540_1002617 | 3300003792 | Bacteria | 9353 |
| 56 | Ga0055531_10002234 | 3300003794 | Bacteria | 13113 |
| 57 | Ga0055531_10005165 | 3300003794 | Bacteria | 7698 |
| 58 | Ga0055531_10025343 | 3300003794 | Bacteria | 2157 |
| 59 | Ga0058692_1000001 | 3300003856 | Bacteria | 834230 |
| 60 | Ga0055543_1000037 | 3300004625 | Bacteria | 125386 |
| 61 | Ga0055543_1000203 | 3300004625 | Bacteria | 48554 |
| 62 | Ga0055543_1000466 | 3300004625 | Bacteria | 23733 |
| 63 | Ga0065165_1000031 | 3300005262 | Bacteria | 216330 |
| 64 | Ga0065165_1000084 | 3300005262 | Bacteria | 154822 |
| 65 | Ga0065165_1004130 | 3300005262 | Bacteria | 9332 |
| 66 | Ga0065703_1000122 | 3300005272 | Bacteria | 39740 |
| 67 | Ga0070676_10063006 | 3300005328 | Bacteria | 2208 |
| 68 | Ga0070682_100210418 | 3300005337 | Bacteria | 1378 |
| 69 | Ga0070689_100186898 | 3300005340 | Bacteria | 1686 |
| 70 | Ga0070669_100093928 | 3300005353 | Bacteria | 2253 |
| 71 | Ga0070671_100045810 | 3300005355 | Bacteria | 3636 |
| 72 | Ga0074250_12179 | 3300005473 | Bacteria | 1705 |
| 73 | Ga0070665_100047383 | 3300005548 | Bacteria | 4314 |
| 74 | Ga0070665_100105884 | 3300005548 | Bacteria | 2814 |
| 75 | Ga0070665_100154271 | 3300005548 | Bacteria | 2298 |
| 76 | Ga0068854_100028036 | 3300005578 | Bacteria | 3887 |
| 77 | Ga0068856_100056858 | 3300005614 | Bacteria | 3861 |
| 78 | Ga0068856_100105944 | 3300005614 | Bacteria | 2806 |
| 79 | Ga0068852_100051558 | 3300005616 | Bacteria | 3532 |
| 80 | Ga0081455_10001548 | 3300005937 | Bacteria | 28314 |
| 81 | Ga0081540_1004695 | 3300005983 | Bacteria | 10339 |
| 82 | Ga0081540_1043567 | 3300005983 | Bacteria | 2300 |
| 83 | Ga0081539_10001304 | 3300005985 | Bacteria | 43613 |
| 84 | Ga0075365_10000298 | 3300006038 | Bacteria | 17275 |
| 85 | Ga0075365_10005677 | 3300006038 | Bacteria | 6764 |
| 86 | Ga0075365_10069608 | 3300006038 | Bacteria | 2365 |
| 87 | Ga0075365_10159211 | 3300006038 | Bacteria | 1573 |
| 88 | Ga0075368_10003333 | 3300006042 | Bacteria | 5348 |
| 89 | Ga0075363_100012121 | 3300006048 | Bacteria | 4147 |
| 90 | Ga0075364_10000847 | 3300006051 | Bacteria | 16120 |
| 91 | Ga0075364_10022919 | 3300006051 | Bacteria | 3949 |
| 92 | Ga0075364_10068629 | 3300006051 | Bacteria | 2332 |
| 93 | Ga0075362_10002602 | 3300006177 | Bacteria | 6104 |
| 94 | Ga0075362_10010718 | 3300006177 | Bacteria | 3588 |
| 95 | Ga0075367_10000382 | 3300006178 | Bacteria | 16047 |
| 96 | Ga0075367_10001337 | 3300006178 | Bacteria | 10460 |
| 97 | Ga0075367_10007489 | 3300006178 | Bacteria | 5592 |
| 98 | Ga0075367_10010702 | 3300006178 | Bacteria | 4829 |
| 99 | Ga0075367_10011945 | 3300006178 | Bacteria | 4614 |
| 100 | Ga0075367_10029453 | 3300006178 | Bacteria | 3140 |
| 101 | Ga0075369_10001075 | 3300006186 | Bacteria | 9163 |
| 102 | Ga0075369_10055639 | 3300006186 | Bacteria | 1719 |
| 103 | Ga0075366_10069909 | 3300006195 | Bacteria | 2090 |
| 104 | Ga0075370_10056684 | 3300006353 | Bacteria | 2227 |
| 105 | Ga0075370_10061903 | 3300006353 | Bacteria | 2132 |
| 106 | Ga0075370_10158561 | 3300006353 | Bacteria | 1327 |
| 107 | Ga0075431_100018162 | 3300006847 | Bacteria | 7155 |
| 108 | Ga0075429_100027195 | 3300006880 | Bacteria | 4965 |
| 109 | Ga0079104_1011186 | 3300006946 | Bacteria | 2900 |
| 110 | Ga0079104_1012844 | 3300006946 | Bacteria | 2609 |
| 111 | Ga0099826_10019370 | 3300006948 | Bacteria | 5117 |
| 112 | Ga0105251_10019463 | 3300009011 | Bacteria | 3586 |
| 113 | Ga0105240_10000024 | 3300009093 | Bacteria | 375919 |
| 114 | Ga0105240_10082262 | 3300009093 | Bacteria | 3954 |
| 115 | Ga0105247_10000344 | 3300009101 | Bacteria | 40748 |
| 116 | Ga0105243_10000013 | 3300009148 | Bacteria | 275151 |
| 117 | Ga0105243_10004039 | 3300009148 | Bacteria | 11685 |
| 118 | Ga0105243_10055476 | 3300009148 | Bacteria | 3149 |
| 119 | Ga0105248_10147694 | 3300009177 | Bacteria | 2653 |
| 120 | Ga0105237_10000836 | 3300009545 | Bacteria | 42087 |
| 121 | Ga0105249_10001408 | 3300009553 | Bacteria | 21068 |
| 122 | Ga0123341_1000103 | 3300009765 | Bacteria | 37078 |
| 123 | Ga0123341_1062925 | 3300009765 | Bacteria | 1777 |
| 124 | Ga0123342_1012202 | 3300009766 | Bacteria | 9084 |
| 125 | Ga0105239_10003536 | 3300010375 | Bacteria | 19113 |
| 126 | Ga0105246_10149590 | 3300011119 | Bacteria | 1766 |
| 127 | Ga0157322_1000529 | 3300012490 | Bacteria | 1474 |
| 128 | Ga0157371_10000004 | 3300013102 | Bacteria | 512593 |
| 129 | Ga0157371_10005117 | 3300013102 | Bacteria | 11183 |
| 130 | Ga0157371_10010262 | 3300013102 | Bacteria | 7310 |
| 131 | Ga0157370_10003256 | 3300013104 | Bacteria | 19133 |
| 132 | Ga0157370_10003765 | 3300013104 | Bacteria | 17703 |
| 133 | Ga0157370_10058687 | 3300013104 | Bacteria | 3657 |
| 134 | Ga0157369_10047578 | 3300013105 | Bacteria | 4655 |
| 135 | Ga0157369_10523787 | 3300013105 | Bacteria | 1226 |
| 136 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 137 | Ga0157378_10237575 | 3300013297 | Bacteria | 1740 |
| 138 | Ga0157380_10065172 | 3300014326 | Bacteria | 2927 |
| 139 | Ga0182008_10034276 | 3300014497 | Bacteria | 2546 |
| 140 | Ga0182007_10001106 | 3300015262 | Bacteria | 14613 |
| 141 | Ga0183363_1140 | 3300015690 | Bacteria | 18543 |
| 142 | Ga0214542_1004397 | 3300021321 | Bacteria | 27975 |
| 143 | Ga0214543_1000027 | 3300021327 | Bacteria | 215065 |
| 144 | Ga0228711_1001182 | 3300022739 | Bacteria | 37363 |
| 145 | Ga0228710_1000008 | 3300022740 | Bacteria | 174306 |
| 146 | Ga0209435_100026 | 3300025206 | Bacteria | 198295 |
| 147 | Ga0209436_100006 | 3300025208 | Bacteria | 150277 |
| 148 | Ga0209436_102997 | 3300025208 | Bacteria | 4689 |
| 149 | Ga0209437_100050 | 3300025233 | Bacteria | 394010 |
| 150 | Ga0209437_100056 | 3300025233 | Bacteria | 363071 |
| 151 | Ga0207425_1000012 | 3300025245 | Bacteria | 528324 |
| 152 | Ga0207425_1004096 | 3300025245 | Bacteria | 4459 |
| 153 | Ga0207425_1016448 | 3300025245 | Bacteria | 1640 |
| 154 | Ga0207425_1026807 | 3300025245 | Bacteria | 1179 |
| 155 | Ga0209646_1000084 | 3300025246 | Bacteria | 198295 |
| 156 | Ga0209646_1002915 | 3300025246 | Bacteria | 3565 |
| 157 | Ga0209026_1000080 | 3300025250 | Bacteria | 198295 |
| 158 | Ga0209677_101825 | 3300025253 | Bacteria | 8706 |
| 159 | Ga0209148_1006421 | 3300025254 | Bacteria | 2550 |
| 160 | Ga0209759_1000061 | 3300025256 | Bacteria | 198295 |
| 161 | Ga0209129_1000110 | 3300025258 | Bacteria | 150918 |
| 162 | Ga0209129_1000206 | 3300025258 | Bacteria | 68903 |
| 163 | Ga0209129_1000985 | 3300025258 | Bacteria | 17076 |
| 164 | Ga0209129_1001015 | 3300025258 | Bacteria | 16716 |
| 165 | Ga0209129_1001804 | 3300025258 | Bacteria | 11369 |
| 166 | Ga0209233_1000037 | 3300025261 | Bacteria | 554620 |
| 167 | Ga0209233_1000071 | 3300025261 | Bacteria | 363290 |
| 168 | Ga0209233_1000327 | 3300025261 | Bacteria | 49691 |
| 169 | Ga0209673_1000024 | 3300025273 | Bacteria | 409632 |
| 170 | Ga0209673_1000063 | 3300025273 | Bacteria | 256709 |
| 171 | Ga0209673_1002553 | 3300025273 | Bacteria | 12420 |
| 172 | Ga0209673_1002642 | 3300025273 | Bacteria | 12012 |
| 173 | Ga0209673_1004535 | 3300025273 | Bacteria | 7387 |
| 174 | Ga0209673_1027734 | 3300025273 | Bacteria | 1837 |
| 175 | Ga0209130_1000002 | 3300025284 | Bacteria | 722648 |
| 176 | Ga0209130_1000005 | 3300025284 | Bacteria | 599620 |
| 177 | Ga0209130_1000028 | 3300025284 | Bacteria | 325668 |
| 178 | Ga0209130_1024193 | 3300025284 | Bacteria | 1330 |
| 179 | Ga0209130_1027156 | 3300025284 | Bacteria | 1219 |
| 180 | Ga0209676_1005679 | 3300025292 | Bacteria | 6418 |
| 181 | Ga0209676_1022122 | 3300025292 | Bacteria | 2114 |
| 182 | Ga0209025_1000024 | 3300025294 | Bacteria | 528324 |
| 183 | Ga0209025_1000037 | 3300025294 | Bacteria | 383429 |
| 184 | Ga0209025_1000060 | 3300025294 | Bacteria | 305017 |
| 185 | Ga0209025_1000479 | 3300025294 | Bacteria | 77489 |
| 186 | Ga0209025_1001805 | 3300025294 | Bacteria | 25363 |
| 187 | Ga0209025_1001859 | 3300025294 | Bacteria | 24728 |
| 188 | Ga0209025_1007478 | 3300025294 | Bacteria | 8126 |
| 189 | Ga0209025_1007820 | 3300025294 | Bacteria | 7857 |
| 190 | Ga0209564_1000093 | 3300025295 | Bacteria | 245793 |
| 191 | Ga0209564_1000316 | 3300025295 | Bacteria | 94849 |
| 192 | Ga0209564_1000977 | 3300025295 | Bacteria | 35999 |
| 193 | Ga0209564_1001013 | 3300025295 | Bacteria | 34890 |
| 194 | Ga0209564_1011493 | 3300025295 | Bacteria | 3961 |
| 195 | Ga0209758_1000150 | 3300025297 | Bacteria | 163494 |
| 196 | Ga0209758_1000170 | 3300025297 | Bacteria | 149476 |
| 197 | Ga0209758_1001467 | 3300025297 | Bacteria | 27671 |
| 198 | Ga0209758_1001806 | 3300025297 | Bacteria | 23637 |
| 199 | Ga0209758_1007099 | 3300025297 | Bacteria | 7754 |
| 200 | Ga0209758_1029006 | 3300025297 | Bacteria | 2326 |
| 201 | Ga0209050_1004464 | 3300025298 | Bacteria | 9430 |
| 202 | Ga0209050_1018151 | 3300025298 | Bacteria | 2750 |
| 203 | Ga0209050_1018305 | 3300025298 | Bacteria | 2730 |
| 204 | Ga0209256_1000027 | 3300025299 | Bacteria | 423283 |
| 205 | Ga0209256_1000996 | 3300025299 | Bacteria | 33661 |
| 206 | Ga0209256_1001570 | 3300025299 | Bacteria | 22473 |
| 207 | Ga0209256_1002960 | 3300025299 | Bacteria | 12725 |
| 208 | Ga0209256_1004495 | 3300025299 | Bacteria | 8711 |
| 209 | Ga0207426_1000012 | 3300025302 | Bacteria | 730942 |
| 210 | Ga0207426_1000013 | 3300025302 | Bacteria | 721897 |
| 211 | Ga0207426_1000015 | 3300025302 | Bacteria | 599316 |
| 212 | Ga0207426_1000070 | 3300025302 | Bacteria | 331559 |
| 213 | Ga0207426_1000638 | 3300025302 | Bacteria | 43881 |
| 214 | Ga0209051_1000135 | 3300025303 | Bacteria | 138142 |
| 215 | Ga0209051_1004038 | 3300025303 | Bacteria | 9273 |
| 216 | Ga0209051_1009326 | 3300025303 | Bacteria | 5070 |
| 217 | Ga0209257_1009998 | 3300025304 | Bacteria | 4921 |
| 218 | Ga0209257_1016029 | 3300025304 | Bacteria | 3062 |
| 219 | Ga0207696_1008767 | 3300025711 | Bacteria | 3831 |
| 220 | Ga0207655_1000881 | 3300025728 | Bacteria | 31790 |
| 221 | Ga0207655_1000882 | 3300025728 | Bacteria | 31789 |
| 222 | Ga0207713_1001253 | 3300025735 | Bacteria | 21040 |
| 223 | Ga0207710_10000005 | 3300025900 | Bacteria | 607066 |
| 224 | Ga0207695_10000036 | 3300025913 | Bacteria | 477897 |
| 225 | Ga0207695_10093107 | 3300025913 | Bacteria | 3023 |
| 226 | Ga0207671_10000153 | 3300025914 | Bacteria | 107114 |
| 227 | Ga0207681_10009212 | 3300025923 | Bacteria | 6033 |
| 228 | Ga0207659_10273323 | 3300025926 | Bacteria | 1379 |
| 229 | Ga0207644_10216111 | 3300025931 | Bacteria | 1517 |
| 230 | Ga0207709_10000001 | 3300025935 | Bacteria | 2228154 |
| 231 | Ga0207670_10233698 | 3300025936 | Bacteria | 1413 |
| 232 | Ga0207711_10097502 | 3300025941 | Bacteria | 2596 |
| 233 | Ga0207712_10005520 | 3300025961 | Bacteria | 7977 |
| 234 | Ga0207712_10109929 | 3300025961 | Bacteria | 2065 |
| 235 | Ga0207668_10235290 | 3300025972 | Bacteria | 1479 |
| 236 | Ga0207658_10072382 | 3300025986 | Bacteria | 2613 |
| 237 | Ga0207702_10167066 | 3300026078 | Bacteria | 2014 |
| 238 | Ga0207648_10064676 | 3300026089 | Bacteria | 3188 |
| 239 | Ga0207683_10050590 | 3300026121 | Bacteria | 3640 |
| 240 | Ga0207698_10038068 | 3300026142 | Bacteria | 3550 |
| 241 | Ga0207698_10402129 | 3300026142 | Bacteria | 1309 |
| 242 | Ga0209281_1000043 | 3300027111 | Bacteria | 341543 |
| 243 | Ga0209281_1000306 | 3300027111 | Bacteria | 87720 |
| 244 | Ga0209281_1000520 | 3300027111 | Bacteria | 49942 |
| 245 | Ga0209371_1000008 | 3300027312 | Bacteria | 1024606 |
| 246 | Ga0209371_1000009 | 3300027312 | Bacteria | 963030 |
| 247 | Ga0209371_1001826 | 3300027312 | Bacteria | 13215 |
| 248 | Ga0209371_1002409 | 3300027312 | Bacteria | 10508 |
| 249 | Ga0209282_1000121 | 3300027666 | Bacteria | 49713 |
| 250 | Ga0209282_1002108 | 3300027666 | Bacteria | 11333 |
| 251 | Ga0209282_1083474 | 3300027666 | Bacteria | 1699 |
| 252 | Ga0209813_10001913 | 3300027866 | Bacteria | 4693 |
| 253 | Ga0209813_10004409 | 3300027866 | Bacteria | 3361 |
| 254 | Ga0209813_10006494 | 3300027866 | Bacteria | 2891 |
| 255 | Ga0209813_10012143 | 3300027866 | Bacteria | 2268 |
| 256 | Ga0207428_10148329 | 3300027907 | Bacteria | 1787 |
| 257 | Ga0268266_10016408 | 3300028379 | Bacteria | 6332 |
| 258 | Ga0268266_10038736 | 3300028379 | Bacteria | 4058 |
| 259 | Ga0268266_10090135 | 3300028379 | Bacteria | 2687 |
| 260 | Ga0268266_10233325 | 3300028379 | Bacteria | 1695 |
| 261 | Ga0307515_10000198 | 3300028794 | Bacteria | 147738 |
| 262 | Ga0307515_10001776 | 3300028794 | Bacteria | 48034 |
| 263 | Ga0268256_1000009 | 3300030500 | Bacteria | 1022625 |
| 264 | Ga0268256_1000010 | 3300030500 | Bacteria | 963034 |
| 265 | Ga0268256_1002677 | 3300030500 | Bacteria | 8781 |
| 266 | Ga0316181_1260635 | 3300030744 | Bacteria | 2643 |
| 267 | Ga0307513_10006546 | 3300031456 | Bacteria | 15215 |
| 268 | Ga0307513_10243493 | 3300031456 | Bacteria | 1601 |
| 269 | Ga0307408_100020322 | 3300031548 | Bacteria | 4480 |
| 270 | Ga0307508_10302293 | 3300031616 | Bacteria | 1193 |
| 271 | Ga0307405_10001435 | 3300031731 | Bacteria | 10031 |
| 272 | Ga0307413_10017491 | 3300031824 | Bacteria | 3735 |
| 273 | Ga0307406_10033463 | 3300031901 | Bacteria | 3147 |
| 274 | Ga0307406_10209597 | 3300031901 | Bacteria | 1441 |
| 275 | Ga0307406_10300568 | 3300031901 | Bacteria | 1233 |
| 276 | Ga0307412_10072680 | 3300031911 | Bacteria | 2351 |
| 277 | Ga0315914_1000754 | 3300031967 | Bacteria | 43901 |
| 278 | Ga0307416_100234803 | 3300032002 | Bacteria | 1771 |
| 279 | Ga0307414_10040840 | 3300032004 | Bacteria | 3136 |
| 280 | Ga0307414_10219787 | 3300032004 | Bacteria | 1559 |
| 281 | Ga0315913_1000195 | 3300033430 | Bacteria | 44144 |
| 282 | Ga0315915_1000247 | 3300033464 | Bacteria | 49711 |
| 283 | Ga0316596_1033371 | 3300033541 | Bacteria | 1341 |
| 284 | Ga0373935_0020800 | 3300035692 | Bacteria | 4013 |
| 285 | Ga0373927_0000053 | 3300035695 | Bacteria | 82381 |
| 286 | Ga0316584_0064933 | 3300036712 | Bacteria | 2734 |
| 287 | Ga0373925_0012359 | 3300037068 | Bacteria | 6182 |
| 288 | Ga0395899_0000058 | 3300037312 | Bacteria | 213049 |
| 289 | Ga0395900_0000056 | 3300037418 | Bacteria | 213077 |
| 290 | Ga0395898_0000114 | 3300037466 | Bacteria | 213068 |
| 291 | Ga0395898_0425316 | 3300037466 | Bacteria | 1266 |
| 292 | Ga0395905_0000053 | 3300037471 | Bacteria | 213077 |
| 293 | Ga0395905_0003361 | 3300037471 | Bacteria | 17152 |
| 294 | Ga0395901_0000037 | 3300038443 | Bacteria | 213059 |
| 295 | Ga0400483_164349 | 3300039062 | Bacteria | 4446 |
| 296 | Ga0439465_0041163 | 3300041413 | Bacteria | 1495 |
| 297 | Ga0451787_844771 | 3300041441 | Bacteria | 1843 |
| 298 | Ga0451791_0335165 | 3300041451 | Bacteria | 2285 |
| 299 | Ga0451798_0653057 | 3300041458 | Bacteria | 1835 |
| 300 | Ga0451802_1285483 | 3300041460 | Bacteria | 1930 |
| 301 | Ga0451849_0403391 | 3300041505 | Bacteria | 1712 |
| 302 | Ga0439455_0008427 | 3300042012 | Bacteria | 2211 |
| 303 | Ga0466966_0042662 | 3300044684 | Bacteria | 2910 |
| 304 | Ga0466963_0004025 | 3300044694 | Bacteria | 8500 |
| 305 | Ga0466970_0011014 | 3300044765 | Bacteria | 4602 |
| 306 | Ga0466957_0030293 | 3300044842 | Bacteria | 3230 |
| 307 | Ga0466958_0074527 | 3300045836 | Bacteria | 2080 |
| 308 | Ga0466967_0134359 | 3300045976 | Bacteria | 2300 |
| 309 | Ga0495638_0042269 | 3300046460 | Bacteria | 2880 |
| 310 | Ga0495606_0006045 | 3300046507 | Bacteria | 11324 |
| 311 | Ga0495606_0159121 | 3300046507 | Bacteria | 1319 |
| 312 | Ga0495610_0058992 | 3300046512 | Bacteria | 1833 |
| 313 | Ga0495620_0018822 | 3300046515 | Bacteria | 3413 |
| 314 | Ga0495631_0045617 | 3300046518 | Bacteria | 1929 |
| 315 | Ga0495632_0049160 | 3300046519 | Bacteria | 2086 |
| 316 | Ga0495648_0100031 | 3300046524 | Bacteria | 1603 |
| 317 | Ga0495654_0001320 | 3300046530 | Bacteria | 17329 |
| 318 | Ga0495633_0025401 | 3300046558 | Bacteria | 2918 |
| 319 | Ga0495625_0030670 | 3300046660 | Bacteria | 4008 |
| 320 | Ga0495625_0074576 | 3300046660 | Bacteria | 2376 |
| 321 | Ga0495588_0000697 | 3300046674 | Bacteria | 15501 |
| 322 | Ga0495588_0045977 | 3300046674 | Bacteria | 2239 |
| 323 | Ga0495671_0018240 | 3300046692 | Bacteria | 3726 |
| 324 | Ga0495687_032193 | 3300047443 | Bacteria | 2397 |
| 325 | Ga0495681_0022350 | 3300047470 | Bacteria | 3387 |
| 326 | Ga0495686_0002953 | 3300047472 | Bacteria | 15200 |
| 327 | Ga0495686_0054250 | 3300047472 | Bacteria | 2510 |
| 328 | Ga0495686_0059943 | 3300047472 | Bacteria | 2367 |
| 329 | Ga0496100_0042919 | 3300048903 | Bacteria | 2890 |
| 330 | Ga0496101_0084608 | 3300048904 | Bacteria | 2349 |
| 331 | Ga0496102_0016809 | 3300048905 | Bacteria | 6399 |
| 332 | Ga0496103_0013692 | 3300048906 | Bacteria | 4812 |
| 333 | Ga0496106_0079772 | 3300048909 | Bacteria | 2513 |
| 334 | Ga0496110_0145413 | 3300048913 | Bacteria | 2144 |
| 335 | Ga0496111_0003716 | 3300048914 | Bacteria | 9493 |
| 336 | Ga0496113_0023658 | 3300048916 | Bacteria | 4358 |
| 337 | Ga0496116_0000100 | 3300048919 | Bacteria | 194740 |
| 338 | Ga0496116_0008443 | 3300048919 | Bacteria | 8931 |
| 339 | Ga0496116_0011001 | 3300048919 | Bacteria | 7530 |
| 340 | Ga0496116_0081067 | 3300048919 | Bacteria | 2013 |
| 341 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 342 | Ga0496117_0003751 | 3300048920 | Bacteria | 17399 |
| 343 | Ga0496117_0009021 | 3300048920 | Bacteria | 9377 |
| 344 | Ga0496118_0000776 | 3300048921 | Bacteria | 51291 |
| 345 | Ga0496118_0012211 | 3300048921 | Bacteria | 8273 |
| 346 | Ga0496118_0016123 | 3300048921 | Bacteria | 6872 |
| 347 | Ga0496118_0051791 | 3300048921 | Bacteria | 3138 |
| 348 | Ga0496118_0074369 | 3300048921 | Bacteria | 2429 |
| 349 | Ga0496119_0001813 | 3300048922 | Bacteria | 24824 |
| 350 | Ga0496119_0016196 | 3300048922 | Bacteria | 5694 |
| 351 | Ga0496119_0016346 | 3300048922 | Bacteria | 5652 |
| 352 | Ga0496119_0020462 | 3300048922 | Bacteria | 4829 |
| 353 | Ga0496119_0022254 | 3300048922 | Bacteria | 4547 |
| 354 | Ga0496119_0065582 | 3300048922 | Bacteria | 2150 |
| 355 | Ga0496120_0000034 | 3300048923 | Bacteria | 215228 |
| 356 | Ga0496120_0017769 | 3300048923 | Bacteria | 4598 |
| 357 | Ga0496120_0102129 | 3300048923 | Bacteria | 1513 |
| 358 | Ga0496121_0000220 | 3300048924 | Bacteria | 123930 |
| 359 | Ga0496121_0002488 | 3300048924 | Bacteria | 28040 |
| 360 | Ga0496121_0005480 | 3300048924 | Bacteria | 16248 |
| 361 | Ga0496121_0012849 | 3300048924 | Bacteria | 9058 |
| 362 | Ga0496121_0146856 | 3300048924 | Bacteria | 1741 |
| 363 | Ga0496121_0257274 | 3300048924 | Bacteria | 1207 |
| 364 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 365 | Ga0496122_0001480 | 3300048925 | Bacteria | 37788 |
| 366 | Ga0496122_0004948 | 3300048925 | Bacteria | 16157 |
| 367 | Ga0496122_0007958 | 3300048925 | Bacteria | 11586 |
| 368 | Ga0496122_0013812 | 3300048925 | Bacteria | 7865 |
| 369 | Ga0496122_0017248 | 3300048925 | Bacteria | 6766 |
| 370 | Ga0496122_0088715 | 3300048925 | Bacteria | 2118 |
| 371 | Ga0496122_0135007 | 3300048925 | Bacteria | 1557 |
| 372 | Ga0496122_0224450 | 3300048925 | Bacteria | 1074 |
| 373 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 374 | Ga0496123_0000238 | 3300048926 | Bacteria | 111297 |
| 375 | Ga0496123_0009385 | 3300048926 | Bacteria | 8818 |
| 376 | Ga0496123_0012845 | 3300048926 | Bacteria | 7093 |
| 377 | Ga0496123_0027843 | 3300048926 | Bacteria | 4199 |
| 378 | Ga0496123_0043341 | 3300048926 | Bacteria | 3092 |
| 379 | Ga0496124_0000083 | 3300048927 | Bacteria | 207798 |
| 380 | Ga0496124_0001450 | 3300048927 | Bacteria | 35027 |
| 381 | Ga0496124_0004345 | 3300048927 | Bacteria | 16605 |
| 382 | Ga0496124_0007026 | 3300048927 | Bacteria | 12059 |
| 383 | Ga0496124_0023874 | 3300048927 | Bacteria | 5571 |
| 384 | Ga0496124_0079046 | 3300048927 | Bacteria | 2709 |
| 385 | Ga0496124_0092622 | 3300048927 | Bacteria | 2462 |
| 386 | Ga0496124_0150064 | 3300048927 | Bacteria | 1829 |
| 387 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 388 | Ga0496125_0000633 | 3300048928 | Bacteria | 58848 |
| 389 | Ga0496125_0009600 | 3300048928 | Bacteria | 9898 |
| 390 | Ga0496125_0015127 | 3300048928 | Bacteria | 7480 |
| 391 | Ga0496125_0098066 | 3300048928 | Bacteria | 2169 |
| 392 | Ga0496126_0000311 | 3300048929 | Bacteria | 103353 |
| 393 | Ga0496126_0000971 | 3300048929 | Bacteria | 49163 |
| 394 | Ga0496126_0019003 | 3300048929 | Bacteria | 6786 |
| 395 | Ga0496126_0067815 | 3300048929 | Bacteria | 3186 |
| 396 | Ga0496126_0068539 | 3300048929 | Bacteria | 3167 |
| 397 | Ga0496126_0100613 | 3300048929 | Bacteria | 2529 |
| 398 | Ga0495678_019359 | 3300049459 | Bacteria | 3039 |
| 399 | Ga0501314_005259 | 3300049530 | Bacteria | 1096 |
| 400 | Ga0501031_0017803 | 3300049568 | Bacteria | 4620 |
| 401 | Ga0501031_0022299 | 3300049568 | Bacteria | 4127 |
| 402 | Ga0501031_0087598 | 3300049568 | Bacteria | 2030 |
| 403 | Ga0501032_0000029 | 3300049569 | Bacteria | 130865 |
| 404 | Ga0501032_0015869 | 3300049569 | Bacteria | 5308 |
| 405 | Ga0501033_0000367 | 3300049570 | Bacteria | 43237 |
| 406 | Ga0501033_0116255 | 3300049570 | Bacteria | 1943 |
| 407 | Ga0501034_0000659 | 3300049571 | Bacteria | 53076 |
| 408 | Ga0501034_0000740 | 3300049571 | Bacteria | 49364 |
| 409 | Ga0501034_0019150 | 3300049571 | Bacteria | 7008 |
| 410 | Ga0501034_0096949 | 3300049571 | Bacteria | 2945 |
| 411 | Ga0501034_0134887 | 3300049571 | Bacteria | 2450 |
| 412 | Ga0501034_0308564 | 3300049571 | Bacteria | 1517 |
| 413 | Ga0501036_0104009 | 3300049572 | Bacteria | 2401 |
| 414 | Ga0501037_0000462 | 3300049573 | Bacteria | 33017 |
| 415 | Ga0501038_0001661 | 3300049574 | Bacteria | 20629 |
| 416 | Ga0501038_0120609 | 3300049574 | Bacteria | 2163 |
| 417 | Ga0501039_0000040 | 3300049575 | Bacteria | 115567 |
| 418 | Ga0501043_0000296 | 3300049579 | Bacteria | 45015 |
| 419 | Ga0501043_0031725 | 3300049579 | Bacteria | 4153 |
| 420 | Ga0501047_0205431 | 3300049581 | Bacteria | 1829 |
| 421 | Ga0501067_0084102 | 3300049583 | Bacteria | 1765 |
| 422 | Ga0501073_0092668 | 3300049589 | Bacteria | 2100 |
| 423 | Ga0501073_0106179 | 3300049589 | Bacteria | 1949 |
| 424 | Ga0501076_0175281 | 3300049592 | Bacteria | 1748 |
| 425 | Ga0501079_0078537 | 3300049741 | Bacteria | 2553 |
| 426 | Ga0501079_0266024 | 3300049741 | Bacteria | 1340 |
| 427 | Ga0501081_0237343 | 3300049743 | Bacteria | 1329 |
| 428 | Ga0501081_0344530 | 3300049743 | Bacteria | 1098 |
| 429 | Ga0501083_0055845 | 3300049744 | Bacteria | 2646 |
| 430 | Ga0501035_0000144 | 3300049822 | Bacteria | 86257 |
| 431 | Ga0501044_0002802 | 3300049823 | Bacteria | 19865 |
| 432 | Ga0501044_0143836 | 3300049823 | Bacteria | 2372 |
| 433 | Ga0501044_0242241 | 3300049823 | Bacteria | 1747 |
| 434 | nmdc:mga03683_14096_c1 | 3300050489 | Bacteria | 2953 |
| 435 | nmdc:mga00v17_270_c1 | 3300050491 | Bacteria | 30629 |
| 436 | nmdc:mga00v17_6830_c1 | 3300050491 | Bacteria | 6064 |
| 437 | nmdc:mga00v17_71099_c1 | 3300050491 | Bacteria | 2156 |
| 438 | nmdc:mga00v17_88514_c1 | 3300050491 | Bacteria | 1942 |
| 439 | nmdc:mga0yw44_10674_c1 | 3300050492 | Bacteria | 4702 |
| 440 | nmdc:mga0yw44_185_c2 | 3300050492 | Bacteria | 9875 |
| 441 | nmdc:mga0yw44_35075_c1 | 3300050492 | Bacteria | 2945 |
| 442 | nmdc:mga0yw44_3994_c1 | 3300050492 | Bacteria | 6666 |
| 443 | nmdc:mga0k408_22759_c1 | 3300050493 | Bacteria | 3531 |
| 444 | nmdc:mga06z11_1463_c1 | 3300050494 | Bacteria | 8791 |
| 445 | nmdc:mga04h51_3320_c1 | 3300050495 | Bacteria | 3903 |
| 446 | nmdc:mga04h51_702_c1 | 3300050495 | Bacteria | 4831 |
| 447 | nmdc:mga07m45_11621_c1 | 3300050496 | Bacteria | 4629 |
| 448 | nmdc:mga07m45_143855_c1 | 3300050496 | Bacteria | 1382 |
| 449 | nmdc:mga07m45_52305_c1 | 3300050496 | Bacteria | 2306 |
| 450 | nmdc:mga06r32_161085_c1 | 3300050510 | Bacteria | 2226 |
| 451 | nmdc:mga0sz30_1697_c1 | 3300050516 | Bacteria | 7827 |
| 452 | nmdc:mga0sz30_18668_c1 | 3300050516 | Bacteria | 2778 |
| 453 | nmdc:mga0sz30_61547_c1 | 3300050516 | Bacteria | 1604 |
| 454 | Ga0500654_104648 | 3300053099 | Bacteria | 1189 |
| 455 | Ga0500560_003440 | 3300053107 | Bacteria | 3200 |
| 456 | Ga0500572_013955 | 3300053111 | Bacteria | 1998 |
| 457 | Ga0500618_009865 | 3300053125 | Bacteria | 2589 |
| 458 | Ga0500568_0000035 | 3300053139 | Bacteria | 137912 |
| 459 | Ga0500573_0005911 | 3300053140 | Bacteria | 6582 |
| 460 | Ga0500616_0001195 | 3300053153 | Bacteria | 26384 |
| 461 | Ga0500616_0001322 | 3300053153 | Bacteria | 24433 |
| 462 | Ga0500616_0121879 | 3300053153 | Bacteria | 1244 |
| 463 | Ga0500622_0000117 | 3300053156 | Bacteria | 82720 |
| 464 | Ga0500624_000960 | 3300053157 | Bacteria | 5940 |
| 465 | Ga0500627_0022208 | 3300053158 | Bacteria | 2570 |
| 466 | Ga0500634_0010532 | 3300053161 | Bacteria | 4728 |
| 467 | Ga0500634_0010597 | 3300053161 | Bacteria | 4716 |
| 468 | Ga0500636_0000006 | 3300053177 | Bacteria | 183899 |
| 469 | Ga0500636_0006086 | 3300053177 | Bacteria | 6924 |
| 470 | Ga0587077_020742 | 3300059493 | Bacteria | 1159 |
| 471 | Ga0587082_007053 | 3300059504 | Bacteria | 1521 |
| 472 | Ga0587083_0022550 | 3300059505 | Bacteria | 1180 |
| 473 | Ga0587090_005104 | 3300059510 | Bacteria | 1628 |
| 474 | Ga0587091_003098 | 3300059511 | Bacteria | 2055 |
| 475 | Ga0587106_002790 | 3300059605 | Bacteria | 1762 |
| 476 | Ga0587101_002817 | 3300059623 | Bacteria | 1706 |
| 477 | Ga0587109_019549 | 3300059624 | Bacteria | 1195 |
| 478 | Ga0587115_007114 | 3300059626 | Bacteria | 1313 |
| 479 | Ga0587062_009354 | 3300059639 | Bacteria | 1192 |
| 480 | Ga0587067_017373 | 3300059640 | Bacteria | 1193 |
| 481 | Ga0587072_017600 | 3300059643 | Bacteria | 1234 |
| 482 | Ga0587076_017439 | 3300059645 | Bacteria | 1145 |
| 483 | Ga0587079_006543 | 3300059647 | Bacteria | 1702 |
| 484 | Ga0587079_022219 | 3300059647 | Bacteria | 1150 |
| 485 | Ga0587071_002877 | 3300060344 | Bacteria | 2398 |
| 486 | Ga0587111_0024026 | 3300060346 | Bacteria | 1197 |
| 487 | Ga0501082_0125361 | 3300060353 | Bacteria | 2228 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2842357229 | 2842361033 | 293 |
| 2 | 3300006038 | Ga0075365_10069608 | Ga0075365_100696082 | 296 |
| 3 | iso_pu_bacteria | 2885350715 | 2885356688 | 301 |
| 4 | 3300006847 | Ga0075431_100018162 | Ga0075431_1000181625 | 304 |
| 5 | 3300050510 | nmdc:mga06r32_161085_c1 | nmdc:mga06r32_161085_c1_206_1255 | 304 |
| 6 | 3300050493 | nmdc:mga0k408_22759_c1 | nmdc:mga0k408_22759_c1_1238_2179 | 313 |
| 7 | iso_pu_bacteria | 2970532167 | 2970532423 | 313 |
| 8 | 3300006048 | Ga0075363_100012121 | Ga0075363_1000121213 | 314 |
| 9 | 3300006178 | Ga0075367_10010702 | Ga0075367_100107024 | 314 |
| 10 | 3300014326 | Ga0157380_10065172 | Ga0157380_100651722 | 314 |
| 11 | 3300025297 | Ga0209758_1029006 | Ga0209758_10290062 | 314 |
| 12 | 3300027866 | Ga0209813_10001913 | Ga0209813_100019134 | 314 |
| 13 | 3300050495 | nmdc:mga04h51_702_c1 | nmdc:mga04h51_702_c1_151_1185 | 314 |
| 14 | 3300006880 | Ga0075429_100027195 | Ga0075429_1000271953 | 315 |
| 15 | 3300050491 | nmdc:mga00v17_88514_c1 | nmdc:mga00v17_88514_c1_149_1144 | 315 |
| 16 | 3300050492 | nmdc:mga0yw44_10674_c1 | nmdc:mga0yw44_10674_c1_413_1408 | 315 |
| 17 | 3300005340 | Ga0070689_100186898 | Ga0070689_1001868982 | 316 |
| 18 | 3300025936 | Ga0207670_10233698 | Ga0207670_102336982 | 316 |
| 19 | 3300027907 | Ga0207428_10148329 | Ga0207428_101483292 | 316 |
| 20 | 3300050492 | nmdc:mga0yw44_35075_c1 | nmdc:mga0yw44_35075_c1_387_1421 | 316 |
| 21 | 3300027866 | Ga0209813_10004409 | Ga0209813_100044092 | 317 |
| 22 | 3300053153 | Ga0500616_0001322 | Ga0500616_0001322_4375_5409 | 317 |
| 23 | 3300006353 | Ga0075370_10056684 | Ga0075370_100566842 | 319 |
| 24 | 3300041505 | Ga0451849_0403391 | Ga0451849_0403391_577_1611 | 321 |
| 25 | 3300003316 | rootH1_10074705 | rootH1_100747052 | 323 |
| 26 | 3300049568 | Ga0501031_0017803 | Ga0501031_0017803_1081_2196 | 323 |
| 27 | 3300049569 | Ga0501032_0000029 | Ga0501032_0000029_39384_40499 | 323 |
| 28 | 3300049570 | Ga0501033_0000367 | Ga0501033_0000367_21052_22167 | 323 |
| 29 | 3300049571 | Ga0501034_0000659 | Ga0501034_0000659_21044_22159 | 323 |
| 30 | 3300049573 | Ga0501037_0000462 | Ga0501037_0000462_21172_22287 | 323 |
| 31 | 3300049574 | Ga0501038_0001661 | Ga0501038_0001661_10343_11458 | 323 |
| 32 | 3300049575 | Ga0501039_0000040 | Ga0501039_0000040_23432_24547 | 323 |
| 33 | 3300049579 | Ga0501043_0000296 | Ga0501043_0000296_30840_31955 | 323 |
| 34 | 3300049581 | Ga0501047_0205431 | Ga0501047_0205431_293_1408 | 323 |
| 35 | 3300049822 | Ga0501035_0000144 | Ga0501035_0000144_49170_50285 | 323 |
| 36 | 3300049823 | Ga0501044_0002802 | Ga0501044_0002802_10401_11516 | 323 |
| 37 | iso_pu_bacteria | 3004195979 | 3004197946 | 324 |
| 38 | 3300006178 | Ga0075367_10029453 | Ga0075367_100294532 | 325 |
| 39 | 3300049571 | Ga0501034_0096949 | Ga0501034_0096949_38_1078 | 325 |
| 40 | 3300027866 | Ga0209813_10012143 | Ga0209813_100121432 | 328 |
| 41 | 3300033541 | Ga0316596_1033371 | Ga0316596_10333712 | 329 |
| 42 | 3300006051 | Ga0075364_10000847 | Ga0075364_100008478 | 330 |
| 43 | 3300006178 | Ga0075367_10001337 | Ga0075367_100013374 | 330 |
| 44 | 3300027866 | Ga0209813_10006494 | Ga0209813_100064942 | 330 |
| 45 | 3300049571 | Ga0501034_0000740 | Ga0501034_0000740_23031_24089 | 330 |
| 46 | 3300050494 | nmdc:mga06z11_1463_c1 | nmdc:mga06z11_1463_c1_4531_5580 | 330 |
| 47 | 3300050495 | nmdc:mga04h51_3320_c1 | nmdc:mga04h51_3320_c1_683_1732 | 330 |
| 48 | iso_pu_bacteria | 2643221665 | 2644361831 | 330 |
| 49 | iso_pu_bacteria | 2928515477 | 2928517946 | 330 |
| 50 | 3300005983 | Ga0081540_1004695 | Ga0081540_10046952 | 331 |
| 51 | 3300059626 | Ga0587115_007114 | Ga0587115_007114_85_1107 | 331 |
| 52 | 3300005328 | Ga0070676_10063006 | Ga0070676_100630063 | 332 |
| 53 | 3300005548 | Ga0070665_100047383 | Ga0070665_1000473832 | 332 |
| 54 | 3300006051 | Ga0075364_10068629 | Ga0075364_100686292 | 332 |
| 55 | 3300006178 | Ga0075367_10011945 | Ga0075367_100119452 | 332 |
| 56 | 3300006353 | Ga0075370_10158561 | Ga0075370_101585611 | 332 |
| 57 | 3300009011 | Ga0105251_10019463 | Ga0105251_100194633 | 332 |
| 58 | 3300009553 | Ga0105249_10001408 | Ga0105249_100014087 | 332 |
| 59 | 3300013102 | Ga0157371_10005117 | Ga0157371_100051178 | 332 |
| 60 | 3300013297 | Ga0157378_10237575 | Ga0157378_102375752 | 332 |
| 61 | 3300025961 | Ga0207712_10005520 | Ga0207712_100055207 | 332 |
| 62 | 3300026089 | Ga0207648_10064676 | Ga0207648_100646762 | 332 |
| 63 | 3300028379 | Ga0268266_10090135 | Ga0268266_100901352 | 332 |
| 64 | 3300050496 | nmdc:mga07m45_143855_c1 | nmdc:mga07m45_143855_c1_32_1060 | 332 |
| 65 | iso_pu_bacteria | 3000405567 | 3000408315 | 332 |
| 66 | 3300050491 | nmdc:mga00v17_71099_c1 | nmdc:mga00v17_71099_c1_312_1340 | 333 |
| 67 | 3300050492 | nmdc:mga0yw44_3994_c1 | nmdc:mga0yw44_3994_c1_3040_4068 | 333 |
| 68 | iso_pu_bacteria | 2891048133 | 2891049263 | 333 |
| 69 | iso_pu_bacteria | 2989771324 | 2989772326 | 333 |
| 70 | iso_pu_bacteria | 8054558443 | 8054562634 | 333 |
| 71 | 3300032004 | Ga0307414_10219787 | Ga0307414_102197871 | 334 |
| 72 | iso_pu_bacteria | 2690315857 | 2691329395 | 334 |
| 73 | iso_pu_bacteria | 2744054655 | 2745161757 | 334 |
| 74 | iso_pu_bacteria | 2891633521 | 2891634760 | 334 |
| 75 | iso_pu_bacteria | 2958137437 | 2958137716 | 334 |
| 76 | iso_pu_bacteria | 2574179768 | 2574430544 | 335 |
| 77 | iso_pu_bacteria | 2643221629 | 2644169780 | 335 |
| 78 | iso_pu_bacteria | 2643221662 | 2644350415 | 335 |
| 79 | iso_pu_bacteria | 2838029111 | 2838029443 | 335 |
| 80 | iso_pu_bacteria | 2842475841 | 2842476127 | 335 |
| 81 | iso_pu_bacteria | 2842502639 | 2842502971 | 335 |
| 82 | 3300003578 | Ga0006562J51391_1072973 | Ga0006562J51391_10729731 | 336 |
| 83 | 3300003856 | Ga0058692_1000001 | Ga0058692_1000001611 | 336 |
| 84 | 3300005272 | Ga0065703_1000122 | Ga0065703_100012241 | 336 |
| 85 | 3300005353 | Ga0070669_100093928 | Ga0070669_1000939282 | 336 |
| 86 | 3300005473 | Ga0074250_12179 | Ga0074250_121792 | 336 |
| 87 | 3300009093 | Ga0105240_10082262 | Ga0105240_100822622 | 336 |
| 88 | 3300009101 | Ga0105247_10000344 | Ga0105247_1000034423 | 336 |
| 89 | 3300009148 | Ga0105243_10000013 | Ga0105243_10000013227 | 336 |
| 90 | 3300025711 | Ga0207696_1008767 | Ga0207696_10087673 | 336 |
| 91 | 3300025728 | Ga0207655_1000881 | Ga0207655_100088122 | 336 |
| 92 | 3300025728 | Ga0207655_1000882 | Ga0207655_100088222 | 336 |
| 93 | 3300025735 | Ga0207713_1001253 | Ga0207713_100125319 | 336 |
| 94 | 3300025900 | Ga0207710_10000005 | Ga0207710_10000005211 | 336 |
| 95 | 3300025913 | Ga0207695_10093107 | Ga0207695_100931072 | 336 |
| 96 | 3300025923 | Ga0207681_10009212 | Ga0207681_100092125 | 336 |
| 97 | 3300025935 | Ga0207709_10000001 | Ga0207709_10000001220 | 336 |
| 98 | 3300027312 | Ga0209371_1000008 | Ga0209371_1000008733 | 336 |
| 99 | 3300030500 | Ga0268256_1000009 | Ga0268256_1000009733 | 336 |
| 100 | 3300032004 | Ga0307414_10040840 | Ga0307414_100408401 | 336 |
| 101 | 3300037471 | Ga0395905_0003361 | Ga0395905_0003361_2213_3247 | 336 |
| 102 | 3300048924 | Ga0496121_0257274 | Ga0496121_0257274_153_1166 | 336 |
| 103 | 3300049530 | Ga0501314_005259 | Ga0501314_005259_36_1055 | 336 |
| 104 | iso_pu_bacteria | 2510065059 | 2510317902 | 336 |
| 105 | iso_pu_bacteria | 2513237305 | 2514417766 | 336 |
| 106 | iso_pu_bacteria | 2551306352 | 2552747429 | 336 |
| 107 | iso_pu_bacteria | 2639762793 | 2640735164 | 336 |
| 108 | iso_pu_bacteria | 2675903507 | 2678232029 | 336 |
| 109 | iso_pu_bacteria | 2687453392 | 2688596728 | 336 |
| 110 | iso_pu_bacteria | 2721755686 | 2723573829 | 336 |
| 111 | iso_pu_bacteria | 2773857761 | 2774389757 | 336 |
| 112 | iso_pu_bacteria | 2773857770 | 2774436503 | 336 |
| 113 | iso_pu_bacteria | 2834578030 | 2834578673 | 336 |
| 114 | iso_pu_bacteria | 2844009547 | 2844011982 | 336 |
| 115 | iso_pu_bacteria | 2856328259 | 2856329602 | 336 |
| 116 | iso_pu_bacteria | 2856334872 | 2856338233 | 336 |
| 117 | iso_pu_bacteria | 2856349417 | 2856355091 | 336 |
| 118 | iso_pu_bacteria | 2857367948 | 2857371033 | 336 |
| 119 | iso_pu_bacteria | 2869169390 | 2869173326 | 336 |
| 120 | iso_pu_bacteria | 2869234852 | 2869240091 | 336 |
| 121 | iso_pu_bacteria | 2869249662 | 2869251899 | 336 |
| 122 | iso_pu_bacteria | 2869256925 | 2869259079 | 336 |
| 123 | iso_pu_bacteria | 2869264136 | 2869266612 | 336 |
| 124 | iso_pu_bacteria | 2871435913 | 2871443923 | 336 |
| 125 | iso_pu_bacteria | 2871451962 | 2871459018 | 336 |
| 126 | iso_pu_bacteria | 2871459585 | 2871463893 | 336 |
| 127 | iso_pu_bacteria | 2871481445 | 2871483265 | 336 |
| 128 | iso_pu_bacteria | 2871488783 | 2871489201 | 336 |
| 129 | iso_pu_bacteria | 2874109183 | 2874112925 | 336 |
| 130 | iso_pu_bacteria | 2874123672 | 2874128690 | 336 |
| 131 | iso_pu_bacteria | 2874131515 | 2874134243 | 336 |
| 132 | iso_pu_bacteria | 2874162495 | 2874165313 | 336 |
| 133 | iso_pu_bacteria | 2874168670 | 2874175864 | 336 |
| 134 | iso_pu_bacteria | 2876386047 | 2876390771 | 336 |
| 135 | iso_pu_bacteria | 2876399893 | 2876400468 | 336 |
| 136 | iso_pu_bacteria | 2876406927 | 2876408502 | 336 |
| 137 | iso_pu_bacteria | 2876420981 | 2876421089 | 336 |
| 138 | iso_pu_bacteria | 2878730984 | 2878731206 | 336 |
| 139 | iso_pu_bacteria | 2878753008 | 2878754675 | 336 |
| 140 | iso_pu_bacteria | 2878774303 | 2878780415 | 336 |
| 141 | iso_pu_bacteria | 2881155292 | 2881160509 | 336 |
| 142 | iso_pu_bacteria | 2881845957 | 2881847036 | 336 |
| 143 | iso_pu_bacteria | 2881853255 | 2881858105 | 336 |
| 144 | iso_pu_bacteria | 2881861095 | 2881861956 | 336 |
| 145 | iso_pu_bacteria | 2882632389 | 2882638230 | 336 |
| 146 | iso_pu_bacteria | 2882912400 | 2882914970 | 336 |
| 147 | iso_pu_bacteria | 2885318864 | 2885321409 | 336 |
| 148 | iso_pu_bacteria | 2899259804 | 2899260534 | 336 |
| 149 | iso_pu_bacteria | 2903492973 | 2903495888 | 336 |
| 150 | iso_pu_bacteria | 2903513507 | 2903520702 | 336 |
| 151 | iso_pu_bacteria | 2906363423 | 2906368191 | 336 |
| 152 | iso_pu_bacteria | 2906370794 | 2906372883 | 336 |
| 153 | iso_pu_bacteria | 2906393657 | 2906397954 | 336 |
| 154 | iso_pu_bacteria | 2906401398 | 2906406048 | 336 |
| 155 | iso_pu_bacteria | 2906408224 | 2906410889 | 336 |
| 156 | iso_pu_bacteria | 2916699645 | 2916702669 | 336 |
| 157 | iso_pu_bacteria | 2919182534 | 2919183215 | 336 |
| 158 | iso_pu_bacteria | 2919506607 | 2919509432 | 336 |
| 159 | iso_pu_bacteria | 2919534386 | 2919536095 | 336 |
| 160 | iso_pu_bacteria | 2922151315 | 2922154757 | 336 |
| 161 | iso_pu_bacteria | 2922172374 | 2922174769 | 336 |
| 162 | iso_pu_bacteria | 2922178524 | 2922182551 | 336 |
| 163 | iso_pu_bacteria | 2924710171 | 2924716508 | 336 |
| 164 | iso_pu_bacteria | 2924733363 | 2924735646 | 336 |
| 165 | iso_pu_bacteria | 2924741084 | 2924746150 | 336 |
| 166 | iso_pu_bacteria | 2924762789 | 2924766433 | 336 |
| 167 | iso_pu_bacteria | 2924784321 | 2924790298 | 336 |
| 168 | iso_pu_bacteria | 2937822353 | 2937828255 | 336 |
| 169 | iso_pu_bacteria | 2937861824 | 2937865900 | 336 |
| 170 | iso_pu_bacteria | 2937980651 | 2937984907 | 336 |
| 171 | iso_pu_bacteria | 2958108152 | 2958109336 | 336 |
| 172 | iso_pu_bacteria | 2958122699 | 2958123110 | 336 |
| 173 | iso_pu_bacteria | 2961127735 | 2961134004 | 336 |
| 174 | iso_pu_bacteria | 2961170736 | 2961171231 | 336 |
| 175 | iso_pu_bacteria | 2961183825 | 2961184450 | 336 |
| 176 | iso_pu_bacteria | 2965025482 | 2965025555 | 336 |
| 177 | iso_pu_bacteria | 2965032056 | 2965034025 | 336 |
| 178 | iso_pu_bacteria | 2965040258 | 2965041588 | 336 |
| 179 | iso_pu_bacteria | 2965047637 | 2965050049 | 336 |
| 180 | iso_pu_bacteria | 2965089291 | 2965093591 | 336 |
| 181 | iso_pu_bacteria | 2965102966 | 2965105685 | 336 |
| 182 | iso_pu_bacteria | 2967996073 | 2967996264 | 336 |
| 183 | iso_pu_bacteria | 2968003550 | 2968004499 | 336 |
| 184 | iso_pu_bacteria | 2970489779 | 2970491266 | 336 |
| 185 | iso_pu_bacteria | 2970503327 | 2970503828 | 336 |
| 186 | iso_pu_bacteria | 2970510686 | 2970514479 | 336 |
| 187 | iso_pu_bacteria | 2970547951 | 2970551243 | 336 |
| 188 | iso_pu_bacteria | 2970619444 | 2970624734 | 336 |
| 189 | iso_pu_bacteria | 2970627176 | 2970629630 | 336 |
| 190 | iso_pu_bacteria | 2977821940 | 2977823892 | 336 |
| 191 | iso_pu_bacteria | 2977828996 | 2977831073 | 336 |
| 192 | iso_pu_bacteria | 2977851361 | 2977856327 | 336 |
| 193 | iso_pu_bacteria | 2977872689 | 2977874713 | 336 |
| 194 | iso_pu_bacteria | 2977907340 | 2977909937 | 336 |
| 195 | iso_pu_bacteria | 2977935797 | 2977935895 | 336 |
| 196 | iso_pu_bacteria | 2977950692 | 2977952727 | 336 |
| 197 | iso_pu_bacteria | 2977957713 | 2977959268 | 336 |
| 198 | iso_pu_bacteria | 2979772303 | 2979776805 | 336 |
| 199 | iso_pu_bacteria | 2979793036 | 2979795717 | 336 |
| 200 | iso_pu_bacteria | 2979808191 | 2979808461 | 336 |
| 201 | iso_pu_bacteria | 2984568884 | 2984569040 | 336 |
| 202 | iso_pu_bacteria | 2987645492 | 2987649627 | 336 |
| 203 | iso_pu_bacteria | 2987666974 | 2987671639 | 336 |
| 204 | iso_pu_bacteria | 2987673487 | 2987674708 | 336 |
| 205 | iso_pu_bacteria | 2996386984 | 2996390440 | 336 |
| 206 | iso_pu_bacteria | 3000135777 | 3000141480 | 336 |
| 207 | iso_pu_bacteria | 3004167301 | 3004174086 | 336 |
| 208 | iso_pu_bacteria | 3004232784 | 3004239544 | 336 |
| 209 | iso_pu_bacteria | 3004248173 | 3004254182 | 336 |
| 210 | iso_pu_bacteria | 3004268573 | 3004271328 | 336 |
| 211 | iso_pu_bacteria | 649633066 | 649871284 | 336 |
| 212 | iso_pu_bacteria | 8004361976 | 8004366282 | 336 |
| 213 | iso_pu_bacteria | 8004374579 | 8004376255 | 336 |
| 214 | iso_pu_bacteria | 8004695233 | 8004702314 | 336 |
| 215 | iso_pu_bacteria | 8004727605 | 8004732136 | 336 |
| 216 | iso_pu_bacteria | 8033232454 | 8033232966 | 336 |
| 217 | iso_pu_bacteria | 8054563764 | 8054565962 | 336 |
| 218 | iso_pu_bacteria | 8057132660 | 8057133352 | 336 |
| 219 | 3300049568 | Ga0501031_0022299 | Ga0501031_0022299_915_1955 | 337 |
| 220 | iso_pu_bacteria | 2510461069 | 2510839469 | 337 |
| 221 | iso_pu_bacteria | 2558860983 | 2561466742 | 337 |
| 222 | iso_pu_bacteria | 2643221643 | 2644242399 | 337 |
| 223 | iso_pu_bacteria | 2713897090 | 2715500104 | 337 |
| 224 | iso_pu_bacteria | 2775507049 | 2776911818 | 337 |
| 225 | iso_pu_bacteria | 2840878972 | 2840879858 | 337 |
| 226 | iso_pu_bacteria | 2855020534 | 2855021543 | 337 |
| 227 | iso_pu_bacteria | 8005658619 | 8005660132 | 337 |
| 228 | 3300049589 | Ga0501073_0106179 | Ga0501073_0106179_770_1795 | 338 |
| 229 | 3300049741 | Ga0501079_0078537 | Ga0501079_0078537_377_1405 | 338 |
| 230 | 3300049743 | Ga0501081_0344530 | Ga0501081_0344530_56_1084 | 338 |
| 231 | 3300060353 | Ga0501082_0125361 | Ga0501082_0125361_1156_2184 | 338 |
| 232 | iso_pu_bacteria | 2837678835 | 2837683491 | 338 |
| 233 | iso_pu_bacteria | 2894817345 | 2894818542 | 338 |
| 234 | 3300031824 | Ga0307413_10017491 | Ga0307413_100174911 | 339 |
| 235 | 3300036712 | Ga0316584_0064933 | Ga0316584_0064933_1142_2191 | 339 |
| 236 | 3300044684 | Ga0466966_0042662 | Ga0466966_0042662_1017_2036 | 339 |
| 237 | 3300044694 | Ga0466963_0004025 | Ga0466963_0004025_4315_5334 | 339 |
| 238 | 3300044765 | Ga0466970_0011014 | Ga0466970_0011014_505_1524 | 339 |
| 239 | 3300044842 | Ga0466957_0030293 | Ga0466957_0030293_1843_2862 | 339 |
| 240 | 3300045836 | Ga0466958_0074527 | Ga0466958_0074527_306_1325 | 339 |
| 241 | 3300048922 | Ga0496119_0016346 | Ga0496119_0016346_1035_2054 | 339 |
| 242 | 3300048923 | Ga0496120_0102129 | Ga0496120_0102129_192_1211 | 339 |
| 243 | 3300048925 | Ga0496122_0017248 | Ga0496122_0017248_3732_4751 | 339 |
| 244 | 3300048926 | Ga0496123_0027843 | Ga0496123_0027843_1287_2306 | 339 |
| 245 | 3300048927 | Ga0496124_0092622 | Ga0496124_0092622_1139_2158 | 339 |
| 246 | 3300049571 | Ga0501034_0019150 | Ga0501034_0019150_4741_5763 | 339 |
| 247 | 3300049823 | Ga0501044_0242241 | Ga0501044_0242241_198_1223 | 339 |
| 248 | 3300053139 | Ga0500568_0000035 | Ga0500568_0000035_2155_3180 | 339 |
| 249 | iso_pu_bacteria | 2513237146 | 2513926015 | 339 |
| 250 | iso_pu_bacteria | 2524023209 | 2524458211 | 339 |
| 251 | iso_pu_bacteria | 2599185170 | 2599417492 | 339 |
| 252 | iso_pu_bacteria | 2838035591 | 2838038297 | 339 |
| 253 | iso_pu_bacteria | 2838661181 | 2838661826 | 339 |
| 254 | iso_pu_bacteria | 2842298080 | 2842299604 | 339 |
| 255 | iso_pu_bacteria | 2995392953 | 2995395439 | 339 |
| 256 | 3300003203 | JGI25406J46586_10011996 | JGI25406J46586_100119964 | 340 |
| 257 | 3300005548 | Ga0070665_100105884 | Ga0070665_1001058842 | 340 |
| 258 | 3300005983 | Ga0081540_1043567 | Ga0081540_10435672 | 340 |
| 259 | 3300005985 | Ga0081539_10001304 | Ga0081539_1000130429 | 340 |
| 260 | 3300025926 | Ga0207659_10273323 | Ga0207659_102733232 | 340 |
| 261 | 3300025986 | Ga0207658_10072382 | Ga0207658_100723822 | 340 |
| 262 | 3300026121 | Ga0207683_10050590 | Ga0207683_100505901 | 340 |
| 263 | 3300028379 | Ga0268266_10233325 | Ga0268266_102333252 | 340 |
| 264 | 3300041460 | Ga0451802_1285483 | Ga0451802_1285483_385_1440 | 340 |
| 265 | 3300042012 | Ga0439455_0008427 | Ga0439455_0008427_685_1713 | 340 |
| 266 | 3300046519 | Ga0495632_0049160 | Ga0495632_0049160_370_1398 | 340 |
| 267 | 3300046524 | Ga0495648_0100031 | Ga0495648_0100031_179_1207 | 340 |
| 268 | 3300046660 | Ga0495625_0074576 | Ga0495625_0074576_436_1464 | 340 |
| 269 | 3300047443 | Ga0495687_032193 | Ga0495687_032193_776_1804 | 340 |
| 270 | 3300047472 | Ga0495686_0059943 | Ga0495686_0059943_257_1285 | 340 |
| 271 | 3300049823 | Ga0501044_0143836 | Ga0501044_0143836_741_1790 | 340 |
| 272 | 3300053158 | Ga0500627_0022208 | Ga0500627_0022208_1203_2303 | 340 |
| 273 | 3300059624 | Ga0587109_019549 | Ga0587109_019549_120_1148 | 340 |
| 274 | iso_pu_bacteria | 2508501122 | 2509109080 | 340 |
| 275 | iso_pu_bacteria | 2509276019 | 2509375188 | 340 |
| 276 | iso_pu_bacteria | 2509276021 | 2509388658 | 340 |
| 277 | iso_pu_bacteria | 2509276033 | 2509444240 | 340 |
| 278 | iso_pu_bacteria | 2510065019 | 2510131197 | 340 |
| 279 | iso_pu_bacteria | 2510065057 | 2510303461 | 340 |
| 280 | iso_pu_bacteria | 2510461076 | 2510897528 | 340 |
| 281 | iso_pu_bacteria | 2510917022 | 2511134724 | 340 |
| 282 | iso_pu_bacteria | 2510917026 | 2511172701 | 340 |
| 283 | iso_pu_bacteria | 2510917028 | 2511184584 | 340 |
| 284 | iso_pu_bacteria | 2510917030 | 2511197750 | 340 |
| 285 | iso_pu_bacteria | 2511231027 | 2511392452 | 340 |
| 286 | iso_pu_bacteria | 2511231052 | 2511500259 | 340 |
| 287 | iso_pu_bacteria | 2512047086 | 2512531792 | 340 |
| 288 | iso_pu_bacteria | 2512875026 | 2512972950 | 340 |
| 289 | iso_pu_bacteria | 2513237084 | 2513570401 | 340 |
| 290 | iso_pu_bacteria | 2513237085 | 2513574590 | 340 |
| 291 | iso_pu_bacteria | 2513237086 | 2513582329 | 340 |
| 292 | iso_pu_bacteria | 2513237088 | 2513597303 | 340 |
| 293 | iso_pu_bacteria | 2513237089 | 2513604469 | 340 |
| 294 | iso_pu_bacteria | 2513237091 | 2513616557 | 340 |
| 295 | iso_pu_bacteria | 2513237093 | 2513635929 | 340 |
| 296 | iso_pu_bacteria | 2513237103 | 2513707229 | 340 |
| 297 | iso_pu_bacteria | 2513237138 | 2513870895 | 340 |
| 298 | iso_pu_bacteria | 2513237140 | 2513885824 | 340 |
| 299 | iso_pu_bacteria | 2513237143 | 2513903895 | 340 |
| 300 | iso_pu_bacteria | 2513237144 | 2513911205 | 340 |
| 301 | iso_pu_bacteria | 2513237156 | 2513986803 | 340 |
| 302 | iso_pu_bacteria | 2513237159 | 2513996554 | 340 |
| 303 | iso_pu_bacteria | 2513237160 | 2514008908 | 340 |
| 304 | iso_pu_bacteria | 2513237162 | 2514020484 | 340 |
| 305 | iso_pu_bacteria | 2515075009 | 2515110134 | 340 |
| 306 | iso_pu_bacteria | 2515154107 | 2515607532 | 340 |
| 307 | iso_pu_bacteria | 2515154113 | 2515637517 | 340 |
| 308 | iso_pu_bacteria | 2515154114 | 2515646944 | 340 |
| 309 | iso_pu_bacteria | 2515154116 | 2515656962 | 340 |
| 310 | iso_pu_bacteria | 2515154134 | 2515740792 | 340 |
| 311 | iso_pu_bacteria | 2516143018 | 2516204523 | 340 |
| 312 | iso_pu_bacteria | 2516653046 | 2516891660 | 340 |
| 313 | iso_pu_bacteria | 2516653077 | 2517038819 | 340 |
| 314 | iso_pu_bacteria | 2516653085 | 2517079074 | 340 |
| 315 | iso_pu_bacteria | 2517093000 | 2517093008 | 340 |
| 316 | iso_pu_bacteria | 2517287029 | 2517409285 | 340 |
| 317 | iso_pu_bacteria | 2517487022 | 2517568433 | 340 |
| 318 | iso_pu_bacteria | 2519899620 | 2520379020 | 340 |
| 319 | iso_pu_bacteria | 2524023207 | 2524450735 | 340 |
| 320 | iso_pu_bacteria | 2529292951 | 2530648029 | 340 |
| 321 | iso_pu_bacteria | 2534681786 | 2535485576 | 340 |
| 322 | iso_pu_bacteria | 2534681796 | 2535514883 | 340 |
| 323 | iso_pu_bacteria | 2537561587 | 2537873293 | 340 |
| 324 | iso_pu_bacteria | 2551306084 | 2551674438 | 340 |
| 325 | iso_pu_bacteria | 2551306085 | 2551686515 | 340 |
| 326 | iso_pu_bacteria | 2551306086 | 2551693744 | 340 |
| 327 | iso_pu_bacteria | 2551306087 | 2551702938 | 340 |
| 328 | iso_pu_bacteria | 2551306089 | 2551708995 | 340 |
| 329 | iso_pu_bacteria | 2551306089 | 2551712737 | 340 |
| 330 | iso_pu_bacteria | 2551306090 | 2551716555 | 340 |
| 331 | iso_pu_bacteria | 2551306090 | 2551720254 | 340 |
| 332 | iso_pu_bacteria | 2551306091 | 2551730721 | 340 |
| 333 | iso_pu_bacteria | 2551306092 | 2551733576 | 340 |
| 334 | iso_pu_bacteria | 2551306093 | 2551746301 | 340 |
| 335 | iso_pu_bacteria | 2554235003 | 2554246494 | 340 |
| 336 | iso_pu_bacteria | 2558860100 | 2558866291 | 340 |
| 337 | iso_pu_bacteria | 2558860242 | 2559293669 | 340 |
| 338 | iso_pu_bacteria | 2582581283 | 2585164707 | 340 |
| 339 | iso_pu_bacteria | 2582581294 | 2585205620 | 340 |
| 340 | iso_pu_bacteria | 2582581298 | 2585223572 | 340 |
| 341 | iso_pu_bacteria | 2582581299 | 2585229633 | 340 |
| 342 | iso_pu_bacteria | 2582581304 | 2585256088 | 340 |
| 343 | iso_pu_bacteria | 2582581306 | 2585265052 | 340 |
| 344 | iso_pu_bacteria | 2582581307 | 2585273791 | 340 |
| 345 | iso_pu_bacteria | 2582581308 | 2585280090 | 340 |
| 346 | iso_pu_bacteria | 2582581315 | 2585326133 | 340 |
| 347 | iso_pu_bacteria | 2582581316 | 2585330299 | 340 |
| 348 | iso_pu_bacteria | 2582581865 | 2585385888 | 340 |
| 349 | iso_pu_bacteria | 2582581866 | 2585392123 | 340 |
| 350 | iso_pu_bacteria | 2582581867 | 2585398774 | 340 |
| 351 | iso_pu_bacteria | 2585427526 | 2585523589 | 340 |
| 352 | iso_pu_bacteria | 2585427527 | 2585533659 | 340 |
| 353 | iso_pu_bacteria | 2585427528 | 2585541988 | 340 |
| 354 | iso_pu_bacteria | 2585427529 | 2585545832 | 340 |
| 355 | iso_pu_bacteria | 2585427530 | 2585553250 | 340 |
| 356 | iso_pu_bacteria | 2585427590 | 2585819104 | 340 |
| 357 | iso_pu_bacteria | 2585427593 | 2585840364 | 340 |
| 358 | iso_pu_bacteria | 2585427594 | 2585844019 | 340 |
| 359 | iso_pu_bacteria | 2585427608 | 2585900642 | 340 |
| 360 | iso_pu_bacteria | 2585427609 | 2585905853 | 340 |
| 361 | iso_pu_bacteria | 2585427633 | 2585994213 | 340 |
| 362 | iso_pu_bacteria | 2585427634 | 2585998731 | 340 |
| 363 | iso_pu_bacteria | 2585428125 | 2587979031 | 340 |
| 364 | iso_pu_bacteria | 2599185156 | 2599332830 | 340 |
| 365 | iso_pu_bacteria | 2599185210 | 2599605757 | 340 |
| 366 | iso_pu_bacteria | 2599185236 | 2599719042 | 340 |
| 367 | iso_pu_bacteria | 2599185352 | 2600191205 | 340 |
| 368 | iso_pu_bacteria | 2600254933 | 2600376523 | 340 |
| 369 | iso_pu_bacteria | 2600255279 | 2601609310 | 340 |
| 370 | iso_pu_bacteria | 2600255308 | 2601746085 | 340 |
| 371 | iso_pu_bacteria | 2615840624 | 2616293642 | 340 |
| 372 | iso_pu_bacteria | 2615840626 | 2616309273 | 340 |
| 373 | iso_pu_bacteria | 2615840698 | 2616553255 | 340 |
| 374 | iso_pu_bacteria | 2643221550 | 2643770090 | 340 |
| 375 | iso_pu_bacteria | 2643221557 | 2643806092 | 340 |
| 376 | iso_pu_bacteria | 2643221558 | 2643812743 | 340 |
| 377 | iso_pu_bacteria | 2643221564 | 2643840258 | 340 |
| 378 | iso_pu_bacteria | 2643221568 | 2643857306 | 340 |
| 379 | iso_pu_bacteria | 2643221582 | 2643920833 | 340 |
| 380 | iso_pu_bacteria | 2643221599 | 2644004706 | 340 |
| 381 | iso_pu_bacteria | 2643221607 | 2644047423 | 340 |
| 382 | iso_pu_bacteria | 2643221610 | 2644070354 | 340 |
| 383 | iso_pu_bacteria | 2643221618 | 2644103492 | 340 |
| 384 | iso_pu_bacteria | 2643221623 | 2644131181 | 340 |
| 385 | iso_pu_bacteria | 2643221626 | 2644144371 | 340 |
| 386 | iso_pu_bacteria | 2643221634 | 2644190375 | 340 |
| 387 | iso_pu_bacteria | 2643221636 | 2644199841 | 340 |
| 388 | iso_pu_bacteria | 2643221637 | 2644207035 | 340 |
| 389 | iso_pu_bacteria | 2643221655 | 2644306422 | 340 |
| 390 | iso_pu_bacteria | 2643221659 | 2644330612 | 340 |
| 391 | iso_pu_bacteria | 2643221668 | 2644377353 | 340 |
| 392 | iso_pu_bacteria | 2643221675 | 2644421116 | 340 |
| 393 | iso_pu_bacteria | 2643221680 | 2644454639 | 340 |
| 394 | iso_pu_bacteria | 2643221686 | 2644480212 | 340 |
| 395 | iso_pu_bacteria | 2643221688 | 2644495644 | 340 |
| 396 | iso_pu_bacteria | 2643221689 | 2644497020 | 340 |
| 397 | iso_pu_bacteria | 2643221693 | 2644519364 | 340 |
| 398 | iso_pu_bacteria | 2643221698 | 2644542584 | 340 |
| 399 | iso_pu_bacteria | 2643221712 | 2644612033 | 340 |
| 400 | iso_pu_bacteria | 2643221718 | 2644650683 | 340 |
| 401 | iso_pu_bacteria | 2643221723 | 2644671779 | 340 |
| 402 | iso_pu_bacteria | 2643221726 | 2644692578 | 340 |
| 403 | iso_pu_bacteria | 2667528174 | 2671113814 | 340 |
| 404 | iso_pu_bacteria | 2690316117 | 2692317480 | 340 |
| 405 | iso_pu_bacteria | 2718217882 | 2719179334 | 340 |
| 406 | iso_pu_bacteria | 2718217927 | 2719383908 | 340 |
| 407 | iso_pu_bacteria | 2718217997 | 2719663699 | 340 |
| 408 | iso_pu_bacteria | 2718218009 | 2719730004 | 340 |
| 409 | iso_pu_bacteria | 2718218199 | 2720490118 | 340 |
| 410 | iso_pu_bacteria | 2718218232 | 2720611498 | 340 |
| 411 | iso_pu_bacteria | 2718218233 | 2720618348 | 340 |
| 412 | iso_pu_bacteria | 2718218235 | 2720629754 | 340 |
| 413 | iso_pu_bacteria | 2718218269 | 2720773450 | 340 |
| 414 | iso_pu_bacteria | 2718218363 | 2721145427 | 340 |
| 415 | iso_pu_bacteria | 2718218365 | 2721156958 | 340 |
| 416 | iso_pu_bacteria | 2718218366 | 2721162322 | 340 |
| 417 | iso_pu_bacteria | 2718218423 | 2721397678 | 340 |
| 418 | iso_pu_bacteria | 2721755514 | 2722838492 | 340 |
| 419 | iso_pu_bacteria | 2721755556 | 2723025120 | 340 |
| 420 | iso_pu_bacteria | 2721755684 | 2723558705 | 340 |
| 421 | iso_pu_bacteria | 2721755685 | 2723565276 | 340 |
| 422 | iso_pu_bacteria | 2721755809 | 2724036488 | 340 |
| 423 | iso_pu_bacteria | 2721755810 | 2724042760 | 340 |
| 424 | iso_pu_bacteria | 2721755819 | 2724088057 | 340 |
| 425 | iso_pu_bacteria | 2721755822 | 2724102541 | 340 |
| 426 | iso_pu_bacteria | 2721755823 | 2724108438 | 340 |
| 427 | iso_pu_bacteria | 2724679232 | 2725952044 | 340 |
| 428 | iso_pu_bacteria | 2728369352 | 2730106056 | 340 |
| 429 | iso_pu_bacteria | 2728369365 | 2730162571 | 340 |
| 430 | iso_pu_bacteria | 2728369397 | 2730296590 | 340 |
| 431 | iso_pu_bacteria | 2738541293 | 2738801424 | 340 |
| 432 | iso_pu_bacteria | 2738541333 | 2739036783 | 340 |
| 433 | iso_pu_bacteria | 2738543024 | 2739309692 | 340 |
| 434 | iso_pu_bacteria | 2751185800 | 2753360599 | 340 |
| 435 | iso_pu_bacteria | 2751185821 | 2753462641 | 340 |
| 436 | iso_pu_bacteria | 2757320392 | 2757570065 | 340 |
| 437 | iso_pu_bacteria | 2758568016 | 2758643040 | 340 |
| 438 | iso_pu_bacteria | 2765235802 | 2765467353 | 340 |
| 439 | iso_pu_bacteria | 2765235942 | 2766063514 | 340 |
| 440 | iso_pu_bacteria | 2767802442 | 2770198083 | 340 |
| 441 | iso_pu_bacteria | 2775506902 | 2776269932 | 340 |
| 442 | iso_pu_bacteria | 2775506904 | 2776281049 | 340 |
| 443 | iso_pu_bacteria | 2775507266 | 2778179564 | 340 |
| 444 | iso_pu_bacteria | 2791355091 | 2792621224 | 340 |
| 445 | iso_pu_bacteria | 2791355092 | 2792625439 | 340 |
| 446 | iso_pu_bacteria | 2791355094 | 2792637873 | 340 |
| 447 | iso_pu_bacteria | 2791355253 | 2793282210 | 340 |
| 448 | iso_pu_bacteria | 2791355256 | 2793299818 | 340 |
| 449 | iso_pu_bacteria | 2791355259 | 2793318513 | 340 |
| 450 | iso_pu_bacteria | 2791355260 | 2793325460 | 340 |
| 451 | iso_pu_bacteria | 2791355261 | 2793329995 | 340 |
| 452 | iso_pu_bacteria | 2791355262 | 2793338276 | 340 |
| 453 | iso_pu_bacteria | 2791355263 | 2793344187 | 340 |
| 454 | iso_pu_bacteria | 2791355264 | 2793348364 | 340 |
| 455 | iso_pu_bacteria | 2791355265 | 2793352805 | 340 |
| 456 | iso_pu_bacteria | 2791355266 | 2793363763 | 340 |
| 457 | iso_pu_bacteria | 2791355267 | 2793365666 | 340 |
| 458 | iso_pu_bacteria | 2802428858 | 2802718518 | 340 |
| 459 | iso_pu_bacteria | 2802428859 | 2802724199 | 340 |
| 460 | iso_pu_bacteria | 2802428860 | 2802730140 | 340 |
| 461 | iso_pu_bacteria | 2802428861 | 2802737482 | 340 |
| 462 | iso_pu_bacteria | 2802428862 | 2802742398 | 340 |
| 463 | iso_pu_bacteria | 2802428863 | 2802749105 | 340 |
| 464 | iso_pu_bacteria | 2802429605 | 2805931690 | 340 |
| 465 | iso_pu_bacteria | 2802429606 | 2805932572 | 340 |
| 466 | iso_pu_bacteria | 2802429633 | 2806049769 | 340 |
| 467 | iso_pu_bacteria | 2802429634 | 2806055956 | 340 |
| 468 | iso_pu_bacteria | 2802429635 | 2806062716 | 340 |
| 469 | iso_pu_bacteria | 2802429636 | 2806066476 | 340 |
| 470 | iso_pu_bacteria | 2802429637 | 2806073539 | 340 |
| 471 | iso_pu_bacteria | 2808606387 | 2808986560 | 340 |
| 472 | iso_pu_bacteria | 2818991439 | 2819556631 | 340 |
| 473 | iso_pu_bacteria | 2818991448 | 2819608561 | 340 |
| 474 | iso_pu_bacteria | 2818991453 | 2819640667 | 340 |
| 475 | iso_pu_bacteria | 2821123053 | 2821123462 | 340 |
| 476 | iso_pu_bacteria | 2837651117 | 2837651795 | 340 |
| 477 | iso_pu_bacteria | 2838016132 | 2838022283 | 340 |
| 478 | iso_pu_bacteria | 2838022645 | 2838027700 | 340 |
| 479 | iso_pu_bacteria | 2838042994 | 2838048637 | 340 |
| 480 | iso_pu_bacteria | 2838048938 | 2838054594 | 340 |
| 481 | iso_pu_bacteria | 2838061910 | 2838064286 | 340 |
| 482 | iso_pu_bacteria | 2838068647 | 2838070892 | 340 |
| 483 | iso_pu_bacteria | 2838074704 | 2838075155 | 340 |
| 484 | iso_pu_bacteria | 2838668709 | 2838673328 | 340 |
| 485 | iso_pu_bacteria | 2838675328 | 2838677363 | 340 |
| 486 | iso_pu_bacteria | 2838680041 | 2838680368 | 340 |
| 487 | iso_pu_bacteria | 2838686498 | 2838693694 | 340 |
| 488 | iso_pu_bacteria | 2838694306 | 2838695600 | 340 |
| 489 | iso_pu_bacteria | 2838701080 | 2838706075 | 340 |
| 490 | iso_pu_bacteria | 2838707686 | 2838708976 | 340 |
| 491 | iso_pu_bacteria | 2838714209 | 2838716251 | 340 |
| 492 | iso_pu_bacteria | 2838719591 | 2838719949 | 340 |
| 493 | iso_pu_bacteria | 2838724970 | 2838727003 | 340 |
| 494 | iso_pu_bacteria | 2838729681 | 2838736370 | 340 |
| 495 | iso_pu_bacteria | 2838736955 | 2838739515 | 340 |
| 496 | iso_pu_bacteria | 2838742623 | 2838749189 | 340 |
| 497 | iso_pu_bacteria | 2839993093 | 2839998099 | 340 |
| 498 | iso_pu_bacteria | 2841840854 | 2841844361 | 340 |
| 499 | iso_pu_bacteria | 2841846520 | 2841846880 | 340 |
| 500 | iso_pu_bacteria | 2841851746 | 2841858486 | 340 |
| 501 | iso_pu_bacteria | 2841859092 | 2841860592 | 340 |
| 502 | iso_pu_bacteria | 2841864319 | 2841870843 | 340 |
| 503 | iso_pu_bacteria | 2842077413 | 2842079789 | 340 |
| 504 | iso_pu_bacteria | 2842110456 | 2842111966 | 340 |
| 505 | iso_pu_bacteria | 2842118031 | 2842120407 | 340 |
| 506 | iso_pu_bacteria | 2842124991 | 2842127091 | 340 |
| 507 | iso_pu_bacteria | 2842130223 | 2842132256 | 340 |
| 508 | iso_pu_bacteria | 2842140634 | 2842144082 | 340 |
| 509 | iso_pu_bacteria | 2842146304 | 2842150582 | 340 |
| 510 | iso_pu_bacteria | 2842152218 | 2842152575 | 340 |
| 511 | iso_pu_bacteria | 2842156927 | 2842163304 | 340 |
| 512 | iso_pu_bacteria | 2842163707 | 2842165394 | 340 |
| 513 | iso_pu_bacteria | 2842170452 | 2842172496 | 340 |
| 514 | iso_pu_bacteria | 2842175837 | 2842176194 | 340 |
| 515 | iso_pu_bacteria | 2842180545 | 2842186931 | 340 |
| 516 | iso_pu_bacteria | 2842187318 | 2842189358 | 340 |
| 517 | iso_pu_bacteria | 2842192696 | 2842198037 | 340 |
| 518 | iso_pu_bacteria | 2842198810 | 2842204257 | 340 |
| 519 | iso_pu_bacteria | 2842205361 | 2842207159 | 340 |
| 520 | iso_pu_bacteria | 2842211629 | 2842213672 | 340 |
| 521 | iso_pu_bacteria | 2842217011 | 2842219067 | 340 |
| 522 | iso_pu_bacteria | 2842224351 | 2842224710 | 340 |
| 523 | iso_pu_bacteria | 2842229732 | 2842236509 | 340 |
| 524 | iso_pu_bacteria | 2842237096 | 2842238387 | 340 |
| 525 | iso_pu_bacteria | 2842243621 | 2842250088 | 340 |
| 526 | iso_pu_bacteria | 2842250916 | 2842255539 | 340 |
| 527 | iso_pu_bacteria | 2842257432 | 2842264099 | 340 |
| 528 | iso_pu_bacteria | 2842264693 | 2842270651 | 340 |
| 529 | iso_pu_bacteria | 2842271015 | 2842278232 | 340 |
| 530 | iso_pu_bacteria | 2842278818 | 2842280148 | 340 |
| 531 | iso_pu_bacteria | 2842285085 | 2842286607 | 340 |
| 532 | iso_pu_bacteria | 2842291075 | 2842293450 | 340 |
| 533 | iso_pu_bacteria | 2842304105 | 2842310480 | 340 |
| 534 | iso_pu_bacteria | 2842311132 | 2842317549 | 340 |
| 535 | iso_pu_bacteria | 2842317721 | 2842323782 | 340 |
| 536 | iso_pu_bacteria | 2842341865 | 2842343296 | 340 |
| 537 | iso_pu_bacteria | 2842363717 | 2842367348 | 340 |
| 538 | iso_pu_bacteria | 2842370503 | 2842370831 | 340 |
| 539 | iso_pu_bacteria | 2842377471 | 2842379847 | 340 |
| 540 | iso_pu_bacteria | 2842384541 | 2842386918 | 340 |
| 541 | iso_pu_bacteria | 2842395702 | 2842399007 | 340 |
| 542 | iso_pu_bacteria | 2842402390 | 2842403840 | 340 |
| 543 | iso_pu_bacteria | 2842409023 | 2842410458 | 340 |
| 544 | iso_pu_bacteria | 2842415677 | 2842417105 | 340 |
| 545 | iso_pu_bacteria | 2842422224 | 2842424507 | 340 |
| 546 | iso_pu_bacteria | 2842428310 | 2842434521 | 340 |
| 547 | iso_pu_bacteria | 2842434925 | 2842440906 | 340 |
| 548 | iso_pu_bacteria | 2842441272 | 2842447508 | 340 |
| 549 | iso_pu_bacteria | 2842447887 | 2842454311 | 340 |
| 550 | iso_pu_bacteria | 2842462802 | 2842468927 | 340 |
| 551 | iso_pu_bacteria | 2842469257 | 2842475471 | 340 |
| 552 | iso_pu_bacteria | 2842482326 | 2842486214 | 340 |
| 553 | iso_pu_bacteria | 2842489311 | 2842492665 | 340 |
| 554 | iso_pu_bacteria | 2842509118 | 2842512821 | 340 |
| 555 | iso_pu_bacteria | 2842515876 | 2842517377 | 340 |
| 556 | iso_pu_bacteria | 2842521101 | 2842521481 | 340 |
| 557 | iso_pu_bacteria | 2842871566 | 2842874818 | 340 |
| 558 | iso_pu_bacteria | 2842922631 | 2842923119 | 340 |
| 559 | iso_pu_bacteria | 2844163670 | 2844165056 | 340 |
| 560 | iso_pu_bacteria | 2844454524 | 2844456238 | 340 |
| 561 | iso_pu_bacteria | 2847417321 | 2847417450 | 340 |
| 562 | iso_pu_bacteria | 2848992105 | 2848992286 | 340 |
| 563 | iso_pu_bacteria | 2850079185 | 2850079789 | 340 |
| 564 | iso_pu_bacteria | 2852387548 | 2852388313 | 340 |
| 565 | iso_pu_bacteria | 2854896431 | 2854898046 | 340 |
| 566 | iso_pu_bacteria | 2854911287 | 2854913790 | 340 |
| 567 | iso_pu_bacteria | 2854916844 | 2854919742 | 340 |
| 568 | iso_pu_bacteria | 2855825444 | 2855828027 | 340 |
| 569 | iso_pu_bacteria | 2855839649 | 2855839797 | 340 |
| 570 | iso_pu_bacteria | 2855872281 | 2855873574 | 340 |
| 571 | iso_pu_bacteria | 2857516855 | 2857524092 | 340 |
| 572 | iso_pu_bacteria | 2857531043 | 2857533588 | 340 |
| 573 | iso_pu_bacteria | 2858800743 | 2858803772 | 340 |
| 574 | iso_pu_bacteria | 2891373044 | 2891375163 | 340 |
| 575 | iso_pu_bacteria | 2894652903 | 2894656374 | 340 |
| 576 | iso_pu_bacteria | 2896384573 | 2896388572 | 340 |
| 577 | iso_pu_bacteria | 2899792073 | 2899794619 | 340 |
| 578 | iso_pu_bacteria | 2899845264 | 2899845959 | 340 |
| 579 | iso_pu_bacteria | 2904578770 | 2904580264 | 340 |
| 580 | iso_pu_bacteria | 2915650412 | 2915650671 | 340 |
| 581 | iso_pu_bacteria | 2915980308 | 2915986441 | 340 |
| 582 | iso_pu_bacteria | 2915986958 | 2915990656 | 340 |
| 583 | iso_pu_bacteria | 2915993759 | 2915997196 | 340 |
| 584 | iso_pu_bacteria | 2916000859 | 2916000898 | 340 |
| 585 | iso_pu_bacteria | 2916007675 | 2916011207 | 340 |
| 586 | iso_pu_bacteria | 2916014648 | 2916021259 | 340 |
| 587 | iso_pu_bacteria | 2916021584 | 2916021954 | 340 |
| 588 | iso_pu_bacteria | 2916028427 | 2916034112 | 340 |
| 589 | iso_pu_bacteria | 2916035215 | 2916036315 | 340 |
| 590 | iso_pu_bacteria | 2916041962 | 2916048377 | 340 |
| 591 | iso_pu_bacteria | 2916048683 | 2916053629 | 340 |
| 592 | iso_pu_bacteria | 2916055098 | 2916056971 | 340 |
| 593 | iso_pu_bacteria | 2916061851 | 2916065181 | 340 |
| 594 | iso_pu_bacteria | 2916068649 | 2916071426 | 340 |
| 595 | iso_pu_bacteria | 2916076590 | 2916076890 | 340 |
| 596 | iso_pu_bacteria | 2919100787 | 2919101542 | 340 |
| 597 | iso_pu_bacteria | 2919114240 | 2919116455 | 340 |
| 598 | iso_pu_bacteria | 2919119836 | 2919120062 | 340 |
| 599 | iso_pu_bacteria | 2919166419 | 2919166717 | 340 |
| 600 | iso_pu_bacteria | 2919171160 | 2919172223 | 340 |
| 601 | iso_pu_bacteria | 2919408235 | 2919408646 | 340 |
| 602 | iso_pu_bacteria | 2920760137 | 2920763591 | 340 |
| 603 | iso_pu_bacteria | 2920822456 | 2920823185 | 340 |
| 604 | iso_pu_bacteria | 2921201388 | 2921206126 | 340 |
| 605 | iso_pu_bacteria | 2921208531 | 2921213729 | 340 |
| 606 | iso_pu_bacteria | 2921237296 | 2921241490 | 340 |
| 607 | iso_pu_bacteria | 2921244191 | 2921247069 | 340 |
| 608 | iso_pu_bacteria | 2921250672 | 2921252712 | 340 |
| 609 | iso_pu_bacteria | 2921257292 | 2921262803 | 340 |
| 610 | iso_pu_bacteria | 2921263974 | 2921268717 | 340 |
| 611 | iso_pu_bacteria | 2921282425 | 2921288198 | 340 |
| 612 | iso_pu_bacteria | 2921289301 | 2921293762 | 340 |
| 613 | iso_pu_bacteria | 2921296804 | 2921300825 | 340 |
| 614 | iso_pu_bacteria | 2923556063 | 2923556504 | 340 |
| 615 | iso_pu_bacteria | 2924144063 | 2924150734 | 340 |
| 616 | iso_pu_bacteria | 2924150972 | 2924156701 | 340 |
| 617 | iso_pu_bacteria | 2924158325 | 2924160287 | 340 |
| 618 | iso_pu_bacteria | 2924165586 | 2924170762 | 340 |
| 619 | iso_pu_bacteria | 2924172951 | 2924176879 | 340 |
| 620 | iso_pu_bacteria | 2924179722 | 2924183675 | 340 |
| 621 | iso_pu_bacteria | 2924186466 | 2924190408 | 340 |
| 622 | iso_pu_bacteria | 2924193448 | 2924198961 | 340 |
| 623 | iso_pu_bacteria | 2924200457 | 2924200829 | 340 |
| 624 | iso_pu_bacteria | 2924207177 | 2924209247 | 340 |
| 625 | iso_pu_bacteria | 2924214083 | 2924220996 | 340 |
| 626 | iso_pu_bacteria | 2924221636 | 2924222240 | 340 |
| 627 | iso_pu_bacteria | 2924228884 | 2924232721 | 340 |
| 628 | iso_pu_bacteria | 2926754445 | 2926754447 | 340 |
| 629 | iso_pu_bacteria | 2926760298 | 2926761651 | 340 |
| 630 | iso_pu_bacteria | 2929138655 | 2929142198 | 340 |
| 631 | iso_pu_bacteria | 2933006813 | 2933007221 | 340 |
| 632 | iso_pu_bacteria | 2933011516 | 2933015189 | 340 |
| 633 | iso_pu_bacteria | 2933570622 | 2933576918 | 340 |
| 634 | iso_pu_bacteria | 2933586486 | 2933587296 | 340 |
| 635 | iso_pu_bacteria | 2933594066 | 2933594422 | 340 |
| 636 | iso_pu_bacteria | 2933599457 | 2933601693 | 340 |
| 637 | iso_pu_bacteria | 2935894831 | 2935896122 | 340 |
| 638 | iso_pu_bacteria | 2935901341 | 2935902686 | 340 |
| 639 | iso_pu_bacteria | 2936367885 | 2936369171 | 340 |
| 640 | iso_pu_bacteria | 2936375103 | 2936377485 | 340 |
| 641 | iso_pu_bacteria | 2936381700 | 2936387204 | 340 |
| 642 | iso_pu_bacteria | 2936996657 | 2936998453 | 340 |
| 643 | iso_pu_bacteria | 2937002841 | 2937007733 | 340 |
| 644 | iso_pu_bacteria | 2937009748 | 2937014982 | 340 |
| 645 | iso_pu_bacteria | 2937016420 | 2937022274 | 340 |
| 646 | iso_pu_bacteria | 2937023124 | 2937023402 | 340 |
| 647 | iso_pu_bacteria | 2937029754 | 2937031533 | 340 |
| 648 | iso_pu_bacteria | 2937036028 | 2937040532 | 340 |
| 649 | iso_pu_bacteria | 2937042894 | 2937044829 | 340 |
| 650 | iso_pu_bacteria | 2937049772 | 2937053338 | 340 |
| 651 | iso_pu_bacteria | 2937056579 | 2937061573 | 340 |
| 652 | iso_pu_bacteria | 2937063883 | 2937064266 | 340 |
| 653 | iso_pu_bacteria | 2937071275 | 2937074918 | 340 |
| 654 | iso_pu_bacteria | 2937078374 | 2937083256 | 340 |
| 655 | iso_pu_bacteria | 2937084907 | 2937089017 | 340 |
| 656 | iso_pu_bacteria | 2937091812 | 2937092075 | 340 |
| 657 | iso_pu_bacteria | 2937098957 | 2937099912 | 340 |
| 658 | iso_pu_bacteria | 2937106411 | 2937106442 | 340 |
| 659 | iso_pu_bacteria | 2937113482 | 2937119446 | 340 |
| 660 | iso_pu_bacteria | 2937119839 | 2937126216 | 340 |
| 661 | iso_pu_bacteria | 2937126314 | 2937131639 | 340 |
| 662 | iso_pu_bacteria | 2941499720 | 2941500916 | 340 |
| 663 | iso_pu_bacteria | 2957375807 | 2957377732 | 340 |
| 664 | iso_pu_bacteria | 2957382221 | 2957388703 | 340 |
| 665 | iso_pu_bacteria | 2957388812 | 2957393353 | 340 |
| 666 | iso_pu_bacteria | 2957395598 | 2957397799 | 340 |
| 667 | iso_pu_bacteria | 2957402308 | 2957403918 | 340 |
| 668 | iso_pu_bacteria | 2957408893 | 2957413348 | 340 |
| 669 | iso_pu_bacteria | 2957415311 | 2957417702 | 340 |
| 670 | iso_pu_bacteria | 2957422303 | 2957427019 | 340 |
| 671 | iso_pu_bacteria | 2957430029 | 2957436861 | 340 |
| 672 | iso_pu_bacteria | 2957437181 | 2957438865 | 340 |
| 673 | iso_pu_bacteria | 2957443900 | 2957447324 | 340 |
| 674 | iso_pu_bacteria | 2957450854 | 2957451246 | 340 |
| 675 | iso_pu_bacteria | 2957457609 | 2957460153 | 340 |
| 676 | iso_pu_bacteria | 2957464669 | 2957469549 | 340 |
| 677 | iso_pu_bacteria | 2957471148 | 2957473497 | 340 |
| 678 | iso_pu_bacteria | 2957478035 | 2957481978 | 340 |
| 679 | iso_pu_bacteria | 2957484790 | 2957484804 | 340 |
| 680 | iso_pu_bacteria | 2957491536 | 2957492079 | 340 |
| 681 | iso_pu_bacteria | 2957498199 | 2957500695 | 340 |
| 682 | iso_pu_bacteria | 2957505466 | 2957508097 | 340 |
| 683 | iso_pu_bacteria | 2960584000 | 2960590224 | 340 |
| 684 | iso_pu_bacteria | 2960591022 | 2960594567 | 340 |
| 685 | iso_pu_bacteria | 2960597568 | 2960603357 | 340 |
| 686 | iso_pu_bacteria | 2960603979 | 2960607835 | 340 |
| 687 | iso_pu_bacteria | 2960610863 | 2960611697 | 340 |
| 688 | iso_pu_bacteria | 2960617483 | 2960620053 | 340 |
| 689 | iso_pu_bacteria | 2960624210 | 2960626744 | 340 |
| 690 | iso_pu_bacteria | 2960631154 | 2960637207 | 340 |
| 691 | iso_pu_bacteria | 2960637947 | 2960641508 | 340 |
| 692 | iso_pu_bacteria | 2960645483 | 2960648112 | 340 |
| 693 | iso_pu_bacteria | 2960652885 | 2960654449 | 340 |
| 694 | iso_pu_bacteria | 2960660292 | 2960660608 | 340 |
| 695 | iso_pu_bacteria | 2960667422 | 2960672157 | 340 |
| 696 | iso_pu_bacteria | 2960674078 | 2960679631 | 340 |
| 697 | iso_pu_bacteria | 2960680706 | 2960684457 | 340 |
| 698 | iso_pu_bacteria | 2960687367 | 2960687477 | 340 |
| 699 | iso_pu_bacteria | 2960693952 | 2960698569 | 340 |
| 700 | iso_pu_bacteria | 2964607997 | 2964610507 | 340 |
| 701 | iso_pu_bacteria | 2964615318 | 2964618399 | 340 |
| 702 | iso_pu_bacteria | 2964621998 | 2964625466 | 340 |
| 703 | iso_pu_bacteria | 2964628898 | 2964633758 | 340 |
| 704 | iso_pu_bacteria | 2964636051 | 2964639493 | 340 |
| 705 | iso_pu_bacteria | 2964643177 | 2964649410 | 340 |
| 706 | iso_pu_bacteria | 2964649959 | 2964650136 | 340 |
| 707 | iso_pu_bacteria | 2964656573 | 2964663108 | 340 |
| 708 | iso_pu_bacteria | 2964663802 | 2964668066 | 340 |
| 709 | iso_pu_bacteria | 2964670856 | 2964671098 | 340 |
| 710 | iso_pu_bacteria | 2964678106 | 2964682492 | 340 |
| 711 | iso_pu_bacteria | 2964685014 | 2964687599 | 340 |
| 712 | iso_pu_bacteria | 2964691889 | 2964696596 | 340 |
| 713 | iso_pu_bacteria | 2964698721 | 2964703385 | 340 |
| 714 | iso_pu_bacteria | 2964705432 | 2964710232 | 340 |
| 715 | iso_pu_bacteria | 2964712639 | 2964717192 | 340 |
| 716 | iso_pu_bacteria | 2964719344 | 2964722004 | 340 |
| 717 | iso_pu_bacteria | 2967664464 | 2967670495 | 340 |
| 718 | iso_pu_bacteria | 2967671571 | 2967671828 | 340 |
| 719 | iso_pu_bacteria | 2967678726 | 2967680961 | 340 |
| 720 | iso_pu_bacteria | 2967686174 | 2967690393 | 340 |
| 721 | iso_pu_bacteria | 2967693043 | 2967694874 | 340 |
| 722 | iso_pu_bacteria | 2967699805 | 2967703564 | 340 |
| 723 | iso_pu_bacteria | 2967706974 | 2967712329 | 340 |
| 724 | iso_pu_bacteria | 2967714385 | 2967714468 | 340 |
| 725 | iso_pu_bacteria | 2967721400 | 2967723415 | 340 |
| 726 | iso_pu_bacteria | 2967728569 | 2967730359 | 340 |
| 727 | iso_pu_bacteria | 2967735183 | 2967739218 | 340 |
| 728 | iso_pu_bacteria | 2967742019 | 2967743254 | 340 |
| 729 | iso_pu_bacteria | 2967748971 | 2967754856 | 340 |
| 730 | iso_pu_bacteria | 2967755722 | 2967758221 | 340 |
| 731 | iso_pu_bacteria | 2967762386 | 2967766585 | 340 |
| 732 | iso_pu_bacteria | 2967769361 | 2967769910 | 340 |
| 733 | iso_pu_bacteria | 2967775926 | 2967778034 | 340 |
| 734 | iso_pu_bacteria | 2970019648 | 2970023257 | 340 |
| 735 | iso_pu_bacteria | 2970026789 | 2970031867 | 340 |
| 736 | iso_pu_bacteria | 2970033650 | 2970037141 | 340 |
| 737 | iso_pu_bacteria | 2970040964 | 2970041085 | 340 |
| 738 | iso_pu_bacteria | 2970047711 | 2970050663 | 340 |
| 739 | iso_pu_bacteria | 2970054988 | 2970056879 | 340 |
| 740 | iso_pu_bacteria | 2970061556 | 2970062869 | 340 |
| 741 | iso_pu_bacteria | 2970068827 | 2970075424 | 340 |
| 742 | iso_pu_bacteria | 2970076120 | 2970081813 | 340 |
| 743 | iso_pu_bacteria | 2970082768 | 2970088354 | 340 |
| 744 | iso_pu_bacteria | 2970088815 | 2970089471 | 340 |
| 745 | iso_pu_bacteria | 2970095765 | 2970098821 | 340 |
| 746 | iso_pu_bacteria | 2970102677 | 2970106014 | 340 |
| 747 | iso_pu_bacteria | 2970109326 | 2970110890 | 340 |
| 748 | iso_pu_bacteria | 2970116247 | 2970118233 | 340 |
| 749 | iso_pu_bacteria | 2970122695 | 2970128168 | 340 |
| 750 | iso_pu_bacteria | 2970129317 | 2970131372 | 340 |
| 751 | iso_pu_bacteria | 2970136068 | 2970138938 | 340 |
| 752 | iso_pu_bacteria | 2970143518 | 2970144249 | 340 |
| 753 | iso_pu_bacteria | 2970149975 | 2970154502 | 340 |
| 754 | iso_pu_bacteria | 2970156795 | 2970162035 | 340 |
| 755 | iso_pu_bacteria | 2970164137 | 2970170147 | 340 |
| 756 | iso_pu_bacteria | 2970170962 | 2970175856 | 340 |
| 757 | iso_pu_bacteria | 2970177841 | 2970183650 | 340 |
| 758 | iso_pu_bacteria | 2970184632 | 2970188812 | 340 |
| 759 | iso_pu_bacteria | 2970191845 | 2970197483 | 340 |
| 760 | iso_pu_bacteria | 2977516862 | 2977521085 | 340 |
| 761 | iso_pu_bacteria | 2977523885 | 2977528516 | 340 |
| 762 | iso_pu_bacteria | 2977530762 | 2977532646 | 340 |
| 763 | iso_pu_bacteria | 2977537788 | 2977543770 | 340 |
| 764 | iso_pu_bacteria | 2977544691 | 2977550728 | 340 |
| 765 | iso_pu_bacteria | 2977551784 | 2977553491 | 340 |
| 766 | iso_pu_bacteria | 2977558990 | 2977563756 | 340 |
| 767 | iso_pu_bacteria | 2977565890 | 2977571706 | 340 |
| 768 | iso_pu_bacteria | 2977572785 | 2977574713 | 340 |
| 769 | iso_pu_bacteria | 2977579622 | 2977584409 | 340 |
| 770 | iso_pu_bacteria | 2978969890 | 2978973116 | 340 |
| 771 | iso_pu_bacteria | 2979089926 | 2979093087 | 340 |
| 772 | iso_pu_bacteria | 2979095461 | 2979099525 | 340 |
| 773 | iso_pu_bacteria | 2979100975 | 2979105055 | 340 |
| 774 | iso_pu_bacteria | 2984509177 | 2984513131 | 340 |
| 775 | iso_pu_bacteria | 2984518228 | 2984520502 | 340 |
| 776 | iso_pu_bacteria | 2984537506 | 2984539797 | 340 |
| 777 | iso_pu_bacteria | 2984587000 | 2984591386 | 340 |
| 778 | iso_pu_bacteria | 2984601300 | 2984602010 | 340 |
| 779 | iso_pu_bacteria | 2989349275 | 2989351676 | 340 |
| 780 | iso_pu_bacteria | 2996310559 | 2996315625 | 340 |
| 781 | iso_pu_bacteria | 2996887358 | 2996888299 | 340 |
| 782 | iso_pu_bacteria | 3002141150 | 3002141398 | 340 |
| 783 | iso_pu_bacteria | 3003930520 | 3003931723 | 340 |
| 784 | iso_pu_bacteria | 3005409236 | 3005410959 | 340 |
| 785 | iso_pu_bacteria | 3005416602 | 3005422964 | 340 |
| 786 | iso_pu_bacteria | 3005445848 | 3005445994 | 340 |
| 787 | iso_pu_bacteria | 3005452660 | 3005456667 | 340 |
| 788 | iso_pu_bacteria | 639633055 | 639646417 | 340 |
| 789 | iso_pu_bacteria | 643692032 | 643824353 | 340 |
| 790 | iso_pu_bacteria | 648276728 | 648738424 | 340 |
| 791 | iso_pu_bacteria | 650716007 | 650738911 | 340 |
| 792 | iso_pu_bacteria | 8002285264 | 8002290344 | 340 |
| 793 | iso_pu_bacteria | 8003570095 | 8003572467 | 340 |
| 794 | iso_pu_bacteria | 8003992118 | 8003992251 | 340 |
| 795 | iso_pu_bacteria | 8003999396 | 8003999514 | 340 |
| 796 | iso_pu_bacteria | 8005258706 | 8005261144 | 340 |
| 797 | iso_pu_bacteria | 8005275841 | 8005278618 | 340 |
| 798 | iso_pu_bacteria | 8005282627 | 8005287690 | 340 |
| 799 | iso_pu_bacteria | 8005289223 | 8005291303 | 340 |
| 800 | iso_pu_bacteria | 8005301065 | 8005301329 | 340 |
| 801 | iso_pu_bacteria | 8005307578 | 8005310612 | 340 |
| 802 | iso_pu_bacteria | 8005314921 | 8005315291 | 340 |
| 803 | iso_pu_bacteria | 8005321885 | 8005322826 | 340 |
| 804 | iso_pu_bacteria | 8005376324 | 8005377664 | 340 |
| 805 | iso_pu_bacteria | 8005382845 | 8005386437 | 340 |
| 806 | iso_pu_bacteria | 8005395548 | 8005399901 | 340 |
| 807 | iso_pu_bacteria | 8005430974 | 8005432711 | 340 |
| 808 | iso_pu_bacteria | 8005460587 | 8005460770 | 340 |
| 809 | iso_pu_bacteria | 8005484373 | 8005484793 | 340 |
| 810 | iso_pu_bacteria | 8005497431 | 8005498441 | 340 |
| 811 | iso_pu_bacteria | 8005542996 | 8005543555 | 340 |
| 812 | iso_pu_bacteria | 8005556819 | 8005560374 | 340 |
| 813 | iso_pu_bacteria | 8005563573 | 8005564166 | 340 |
| 814 | iso_pu_bacteria | 8005570704 | 8005573731 | 340 |
| 815 | iso_pu_bacteria | 8005619151 | 8005619633 | 340 |
| 816 | iso_pu_bacteria | 8005626139 | 8005628203 | 340 |
| 817 | iso_pu_bacteria | 8005645114 | 8005649486 | 340 |
| 818 | iso_pu_bacteria | 8005668836 | 8005669850 | 340 |
| 819 | iso_pu_bacteria | 8005682033 | 8005685268 | 340 |
| 820 | iso_pu_bacteria | 8005688590 | 8005692464 | 340 |
| 821 | iso_pu_bacteria | 8005695170 | 8005699504 | 340 |
| 822 | iso_pu_bacteria | 8018127388 | 8018132876 | 340 |
| 823 | iso_pu_bacteria | 8018163183 | 8018163831 | 340 |
| 824 | iso_pu_bacteria | 8018176218 | 8018181161 | 340 |
| 825 | iso_pu_bacteria | 8023680758 | 8023684473 | 340 |
| 826 | iso_pu_bacteria | 8024479707 | 8024480060 | 340 |
| 827 | iso_pu_bacteria | 8024501048 | 8024502316 | 340 |
| 828 | iso_pu_bacteria | 8046767195 | 8046770857 | 340 |
| 829 | iso_pu_bacteria | 8054460903 | 8054461171 | 340 |
| 830 | iso_pu_bacteria | 8056375014 | 8056376259 | 340 |
| 831 | iso_pu_bacteria | 8056382006 | 8056385556 | 340 |
| 832 | iso_pu_bacteria | 8057575449 | 8057580534 | 340 |
| 833 | iso_pu_bacteria | 8057874678 | 8057879685 | 340 |
| 834 | 3300039062 | Ga0400483_164349 | Ga0400483_164349_2602_3657 | 341 |
| 835 | 3300028794 | Ga0307515_10000198 | Ga0307515_100001982 | 343 |
| 836 | 3300031456 | Ga0307513_10006546 | Ga0307513_100065462 | 343 |
| 837 | 3300002075 | JGI24738J21930_10024076 | JGI24738J21930_100240761 | 344 |
| 838 | 3300002704 | JGI25155J39150_1000013 | JGI25155J39150_100001366 | 344 |
| 839 | 3300002705 | JGI25156J39149_1000011 | JGI25156J39149_100001166 | 344 |
| 840 | 3300002737 | JGI25162J39368_1000773 | JGI25162J39368_100077321 | 344 |
| 841 | 3300002737 | JGI25162J39368_1001043 | JGI25162J39368_10010434 | 344 |
| 842 | 3300002738 | JGI25154J39366_1000030 | JGI25154J39366_100003066 | 344 |
| 843 | 3300002741 | JGI25157J39369_1000013 | JGI25157J39369_100001366 | 344 |
| 844 | 3300002773 | JGI25152J39213_1003141 | JGI25152J39213_10031412 | 344 |
| 845 | 3300002773 | JGI25152J39213_1005083 | JGI25152J39213_10050832 | 344 |
| 846 | 3300002773 | JGI25152J39213_1008236 | JGI25152J39213_10082361 | 344 |
| 847 | 3300002774 | JGI25150J39212_1000276 | JGI25150J39212_10002769 | 344 |
| 848 | 3300002774 | JGI25150J39212_1013325 | JGI25150J39212_10133251 | 344 |
| 849 | 3300002987 | JGI25159J45721_1000003 | JGI25159J45721_1000003161 | 344 |
| 850 | 3300002987 | JGI25159J45721_1000320 | JGI25159J45721_10003205 | 344 |
| 851 | 3300002987 | JGI25159J45721_1000553 | JGI25159J45721_100055312 | 344 |
| 852 | 3300003162 | Ga0006778J45830_1028201 | Ga0006778J45830_10282011 | 344 |
| 853 | 3300003187 | JGI25151J46595_10000110 | JGI25151J46595_1000011065 | 344 |
| 854 | 3300003187 | JGI25151J46595_10000425 | JGI25151J46595_1000042523 | 344 |
| 855 | 3300003187 | JGI25151J46595_10017623 | JGI25151J46595_100176232 | 344 |
| 856 | 3300003187 | JGI25151J46595_10024082 | JGI25151J46595_100240822 | 344 |
| 857 | 3300003214 | JGI25165J46597_1000602 | JGI25165J46597_10006024 | 344 |
| 858 | 3300003214 | JGI25165J46597_1001279 | JGI25165J46597_100127914 | 344 |
| 859 | 3300003215 | JGI25153J46596_10019417 | JGI25153J46596_100194171 | 344 |
| 860 | 3300003215 | JGI25153J46596_10034665 | JGI25153J46596_100346652 | 344 |
| 861 | 3300003354 | JGI25160J50197_1000003 | JGI25160J50197_1000003342 | 344 |
| 862 | 3300003354 | JGI25160J50197_1000041 | JGI25160J50197_1000041133 | 344 |
| 863 | 3300003354 | JGI25160J50197_1002266 | JGI25160J50197_10022666 | 344 |
| 864 | 3300003354 | JGI25160J50197_1002665 | JGI25160J50197_10026653 | 344 |
| 865 | 3300003354 | JGI25160J50197_1003367 | JGI25160J50197_10033675 | 344 |
| 866 | 3300003374 | JGI25161J50226_1000002 | JGI25161J50226_1000002133 | 344 |
| 867 | 3300003374 | JGI25161J50226_1000315 | JGI25161J50226_100031526 | 344 |
| 868 | 3300003374 | JGI25161J50226_1000318 | JGI25161J50226_100031819 | 344 |
| 869 | 3300003559 | Ga0007427J51700_108555 | Ga0007427J51700_1085551 | 344 |
| 870 | 3300003578 | Ga0006562J51391_1021039 | Ga0006562J51391_10210391 | 344 |
| 871 | 3300003693 | Ga0032354_1026823 | Ga0032354_10268231 | 344 |
| 872 | 3300003735 | Ga0006780_1022426 | Ga0006780_10224261 | 344 |
| 873 | 3300003771 | Ga0055526_1000550 | Ga0055526_100055019 | 344 |
| 874 | 3300003771 | Ga0055526_1002545 | Ga0055526_10025454 | 344 |
| 875 | 3300003771 | Ga0055526_1013939 | Ga0055526_10139392 | 344 |
| 876 | 3300003771 | Ga0055526_1018148 | Ga0055526_10181482 | 344 |
| 877 | 3300003775 | Ga0055524_1002964 | Ga0055524_10029645 | 344 |
| 878 | 3300003775 | Ga0055524_1003575 | Ga0055524_10035758 | 344 |
| 879 | 3300003775 | Ga0055524_1015989 | Ga0055524_10159891 | 344 |
| 880 | 3300003775 | Ga0055524_1025467 | Ga0055524_10254671 | 344 |
| 881 | 3300003781 | Ga0055536_1007402 | Ga0055536_10074022 | 344 |
| 882 | 3300003790 | Ga0055528_1000095 | Ga0055528_100009549 | 344 |
| 883 | 3300003790 | Ga0055528_1001482 | Ga0055528_10014825 | 344 |
| 884 | 3300003790 | Ga0055528_1008657 | Ga0055528_10086572 | 344 |
| 885 | 3300003791 | Ga0055530_10032093 | Ga0055530_100320932 | 344 |
| 886 | 3300003792 | Ga0055540_1001140 | Ga0055540_10011403 | 344 |
| 887 | 3300003792 | Ga0055540_1002617 | Ga0055540_10026175 | 344 |
| 888 | 3300003794 | Ga0055531_10002234 | Ga0055531_100022346 | 344 |
| 889 | 3300003794 | Ga0055531_10005165 | Ga0055531_100051656 | 344 |
| 890 | 3300003794 | Ga0055531_10025343 | Ga0055531_100253431 | 344 |
| 891 | 3300004625 | Ga0055543_1000037 | Ga0055543_100003715 | 344 |
| 892 | 3300004625 | Ga0055543_1000203 | Ga0055543_100020323 | 344 |
| 893 | 3300004625 | Ga0055543_1000466 | Ga0055543_100046619 | 344 |
| 894 | 3300005262 | Ga0065165_1000031 | Ga0065165_1000031146 | 344 |
| 895 | 3300005262 | Ga0065165_1000084 | Ga0065165_100008418 | 344 |
| 896 | 3300005262 | Ga0065165_1004130 | Ga0065165_10041303 | 344 |
| 897 | 3300005337 | Ga0070682_100210418 | Ga0070682_1002104181 | 344 |
| 898 | 3300005355 | Ga0070671_100045810 | Ga0070671_1000458102 | 344 |
| 899 | 3300005548 | Ga0070665_100154271 | Ga0070665_1001542714 | 344 |
| 900 | 3300005578 | Ga0068854_100028036 | Ga0068854_1000280362 | 344 |
| 901 | 3300005614 | Ga0068856_100056858 | Ga0068856_1000568582 | 344 |
| 902 | 3300005614 | Ga0068856_100105944 | Ga0068856_1001059442 | 344 |
| 903 | 3300005616 | Ga0068852_100051558 | Ga0068852_1000515583 | 344 |
| 904 | 3300005937 | Ga0081455_10001548 | Ga0081455_100015485 | 344 |
| 905 | 3300006038 | Ga0075365_10000298 | Ga0075365_100002988 | 344 |
| 906 | 3300006038 | Ga0075365_10005677 | Ga0075365_100056772 | 344 |
| 907 | 3300006038 | Ga0075365_10159211 | Ga0075365_101592111 | 344 |
| 908 | 3300006042 | Ga0075368_10003333 | Ga0075368_100033331 | 344 |
| 909 | 3300006051 | Ga0075364_10022919 | Ga0075364_100229192 | 344 |
| 910 | 3300006177 | Ga0075362_10002602 | Ga0075362_100026025 | 344 |
| 911 | 3300006177 | Ga0075362_10010718 | Ga0075362_100107182 | 344 |
| 912 | 3300006178 | Ga0075367_10000382 | Ga0075367_100003825 | 344 |
| 913 | 3300006178 | Ga0075367_10007489 | Ga0075367_100074895 | 344 |
| 914 | 3300006186 | Ga0075369_10001075 | Ga0075369_100010752 | 344 |
| 915 | 3300006186 | Ga0075369_10055639 | Ga0075369_100556391 | 344 |
| 916 | 3300006195 | Ga0075366_10069909 | Ga0075366_100699091 | 344 |
| 917 | 3300006353 | Ga0075370_10061903 | Ga0075370_100619032 | 344 |
| 918 | 3300006946 | Ga0079104_1011186 | Ga0079104_10111862 | 344 |
| 919 | 3300006946 | Ga0079104_1012844 | Ga0079104_10128441 | 344 |
| 920 | 3300006948 | Ga0099826_10019370 | Ga0099826_100193705 | 344 |
| 921 | 3300009093 | Ga0105240_10000024 | Ga0105240_1000002434 | 344 |
| 922 | 3300009148 | Ga0105243_10004039 | Ga0105243_1000403912 | 344 |
| 923 | 3300009148 | Ga0105243_10055476 | Ga0105243_100554763 | 344 |
| 924 | 3300009177 | Ga0105248_10147694 | Ga0105248_101476942 | 344 |
| 925 | 3300009545 | Ga0105237_10000836 | Ga0105237_100008363 | 344 |
| 926 | 3300009765 | Ga0123341_1000103 | Ga0123341_100010330 | 344 |
| 927 | 3300009765 | Ga0123341_1062925 | Ga0123341_10629252 | 344 |
| 928 | 3300009766 | Ga0123342_1012202 | Ga0123342_10122026 | 344 |
| 929 | 3300010375 | Ga0105239_10003536 | Ga0105239_100035364 | 344 |
| 930 | 3300011119 | Ga0105246_10149590 | Ga0105246_101495902 | 344 |
| 931 | 3300012490 | Ga0157322_1000529 | Ga0157322_10005291 | 344 |
| 932 | 3300013102 | Ga0157371_10000004 | Ga0157371_10000004351 | 344 |
| 933 | 3300013102 | Ga0157371_10010262 | Ga0157371_100102626 | 344 |
| 934 | 3300013104 | Ga0157370_10003256 | Ga0157370_1000325612 | 344 |
| 935 | 3300013104 | Ga0157370_10003765 | Ga0157370_1000376512 | 344 |
| 936 | 3300013104 | Ga0157370_10058687 | Ga0157370_100586872 | 344 |
| 937 | 3300013105 | Ga0157369_10047578 | Ga0157369_100475783 | 344 |
| 938 | 3300013105 | Ga0157369_10523787 | Ga0157369_105237872 | 344 |
| 939 | 3300013249 | Ga0171463_1001 | Ga0171463_1001946 | 344 |
| 940 | 3300014497 | Ga0182008_10034276 | Ga0182008_100342762 | 344 |
| 941 | 3300015262 | Ga0182007_10001106 | Ga0182007_1000110610 | 344 |
| 942 | 3300015690 | Ga0183363_1140 | Ga0183363_114013 | 344 |
| 943 | 3300021321 | Ga0214542_1004397 | Ga0214542_100439721 | 344 |
| 944 | 3300021327 | Ga0214543_1000027 | Ga0214543_1000027135 | 344 |
| 945 | 3300022739 | Ga0228711_1001182 | Ga0228711_100118224 | 344 |
| 946 | 3300022740 | Ga0228710_1000008 | Ga0228710_1000008150 | 344 |
| 947 | 3300025206 | Ga0209435_100026 | Ga0209435_10002665 | 344 |
| 948 | 3300025208 | Ga0209436_100006 | Ga0209436_100006144 | 344 |
| 949 | 3300025208 | Ga0209436_102997 | Ga0209436_1029973 | 344 |
| 950 | 3300025233 | Ga0209437_100050 | Ga0209437_100050393 | 344 |
| 951 | 3300025233 | Ga0209437_100056 | Ga0209437_100056124 | 344 |
| 952 | 3300025245 | Ga0207425_1000012 | Ga0207425_1000012101 | 344 |
| 953 | 3300025245 | Ga0207425_1004096 | Ga0207425_10040964 | 344 |
| 954 | 3300025245 | Ga0207425_1016448 | Ga0207425_10164482 | 344 |
| 955 | 3300025245 | Ga0207425_1026807 | Ga0207425_10268071 | 344 |
| 956 | 3300025246 | Ga0209646_1000084 | Ga0209646_100008465 | 344 |
| 957 | 3300025246 | Ga0209646_1002915 | Ga0209646_10029152 | 344 |
| 958 | 3300025250 | Ga0209026_1000080 | Ga0209026_100008065 | 344 |
| 959 | 3300025253 | Ga0209677_101825 | Ga0209677_1018259 | 344 |
| 960 | 3300025254 | Ga0209148_1006421 | Ga0209148_10064212 | 344 |
| 961 | 3300025256 | Ga0209759_1000061 | Ga0209759_100006165 | 344 |
| 962 | 3300025258 | Ga0209129_1000110 | Ga0209129_1000110101 | 344 |
| 963 | 3300025258 | Ga0209129_1000206 | Ga0209129_100020620 | 344 |
| 964 | 3300025258 | Ga0209129_1000985 | Ga0209129_10009859 | 344 |
| 965 | 3300025258 | Ga0209129_1001015 | Ga0209129_100101511 | 344 |
| 966 | 3300025258 | Ga0209129_1001804 | Ga0209129_10018048 | 344 |
| 967 | 3300025261 | Ga0209233_1000037 | Ga0209233_1000037435 | 344 |
| 968 | 3300025261 | Ga0209233_1000071 | Ga0209233_1000071124 | 344 |
| 969 | 3300025261 | Ga0209233_1000327 | Ga0209233_10003277 | 344 |
| 970 | 3300025273 | Ga0209673_1000024 | Ga0209673_1000024397 | 344 |
| 971 | 3300025273 | Ga0209673_1000063 | Ga0209673_1000063112 | 344 |
| 972 | 3300025273 | Ga0209673_1002553 | Ga0209673_10025532 | 344 |
| 973 | 3300025273 | Ga0209673_1002642 | Ga0209673_10026422 | 344 |
| 974 | 3300025273 | Ga0209673_1004535 | Ga0209673_10045355 | 344 |
| 975 | 3300025273 | Ga0209673_1027734 | Ga0209673_10277342 | 344 |
| 976 | 3300025284 | Ga0209130_1000002 | Ga0209130_1000002280 | 344 |
| 977 | 3300025284 | Ga0209130_1000005 | Ga0209130_1000005136 | 344 |
| 978 | 3300025284 | Ga0209130_1000028 | Ga0209130_1000028315 | 344 |
| 979 | 3300025284 | Ga0209130_1024193 | Ga0209130_10241931 | 344 |
| 980 | 3300025284 | Ga0209130_1027156 | Ga0209130_10271561 | 344 |
| 981 | 3300025292 | Ga0209676_1005679 | Ga0209676_10056792 | 344 |
| 982 | 3300025292 | Ga0209676_1022122 | Ga0209676_10221222 | 344 |
| 983 | 3300025294 | Ga0209025_1000024 | Ga0209025_1000024101 | 344 |
| 984 | 3300025294 | Ga0209025_1000037 | Ga0209025_1000037168 | 344 |
| 985 | 3300025294 | Ga0209025_1000060 | Ga0209025_1000060213 | 344 |
| 986 | 3300025294 | Ga0209025_1000479 | Ga0209025_100047930 | 344 |
| 987 | 3300025294 | Ga0209025_1001805 | Ga0209025_100180518 | 344 |
| 988 | 3300025294 | Ga0209025_1001859 | Ga0209025_100185919 | 344 |
| 989 | 3300025294 | Ga0209025_1007478 | Ga0209025_10074784 | 344 |
| 990 | 3300025294 | Ga0209025_1007820 | Ga0209025_10078202 | 344 |
| 991 | 3300025295 | Ga0209564_1000093 | Ga0209564_1000093139 | 344 |
| 992 | 3300025295 | Ga0209564_1000316 | Ga0209564_100031654 | 344 |
| 993 | 3300025295 | Ga0209564_1000977 | Ga0209564_100097739 | 344 |
| 994 | 3300025295 | Ga0209564_1001013 | Ga0209564_100101315 | 344 |
| 995 | 3300025295 | Ga0209564_1011493 | Ga0209564_10114931 | 344 |
| 996 | 3300025297 | Ga0209758_1000150 | Ga0209758_100015064 | 344 |
| 997 | 3300025297 | Ga0209758_1000170 | Ga0209758_10001702 | 344 |
| 998 | 3300025297 | Ga0209758_1001467 | Ga0209758_100146719 | 344 |
| 999 | 3300025297 | Ga0209758_1001806 | Ga0209758_10018069 | 344 |
| 1000 | 3300025297 | Ga0209758_1007099 | Ga0209758_10070997 | 344 |
| 1001 | 3300025298 | Ga0209050_1004464 | Ga0209050_100446410 | 344 |
| 1002 | 3300025298 | Ga0209050_1018151 | Ga0209050_10181512 | 344 |
| 1003 | 3300025298 | Ga0209050_1018305 | Ga0209050_10183052 | 344 |
| 1004 | 3300025299 | Ga0209256_1000027 | Ga0209256_1000027272 | 344 |
| 1005 | 3300025299 | Ga0209256_1000996 | Ga0209256_10009961 | 344 |
| 1006 | 3300025299 | Ga0209256_1001570 | Ga0209256_100157019 | 344 |
| 1007 | 3300025299 | Ga0209256_1002960 | Ga0209256_10029601 | 344 |
| 1008 | 3300025299 | Ga0209256_1004495 | Ga0209256_10044955 | 344 |
| 1009 | 3300025302 | Ga0207426_1000012 | Ga0207426_1000012267 | 344 |
| 1010 | 3300025302 | Ga0207426_1000013 | Ga0207426_1000013280 | 344 |
| 1011 | 3300025302 | Ga0207426_1000015 | Ga0207426_1000015463 | 344 |
| 1012 | 3300025302 | Ga0207426_1000070 | Ga0207426_1000070159 | 344 |
| 1013 | 3300025302 | Ga0207426_1000638 | Ga0207426_10006389 | 344 |
| 1014 | 3300025303 | Ga0209051_1000135 | Ga0209051_100013535 | 344 |
| 1015 | 3300025303 | Ga0209051_1004038 | Ga0209051_10040388 | 344 |
| 1016 | 3300025303 | Ga0209051_1009326 | Ga0209051_10093262 | 344 |
| 1017 | 3300025304 | Ga0209257_1009998 | Ga0209257_10099984 | 344 |
| 1018 | 3300025304 | Ga0209257_1016029 | Ga0209257_10160292 | 344 |
| 1019 | 3300025913 | Ga0207695_10000036 | Ga0207695_10000036105 | 344 |
| 1020 | 3300025914 | Ga0207671_10000153 | Ga0207671_1000015344 | 344 |
| 1021 | 3300025931 | Ga0207644_10216111 | Ga0207644_102161112 | 344 |
| 1022 | 3300025941 | Ga0207711_10097502 | Ga0207711_100975022 | 344 |
| 1023 | 3300025961 | Ga0207712_10109929 | Ga0207712_101099292 | 344 |
| 1024 | 3300025972 | Ga0207668_10235290 | Ga0207668_102352901 | 344 |
| 1025 | 3300026078 | Ga0207702_10167066 | Ga0207702_101670662 | 344 |
| 1026 | 3300026142 | Ga0207698_10038068 | Ga0207698_100380683 | 344 |
| 1027 | 3300026142 | Ga0207698_10402129 | Ga0207698_104021291 | 344 |
| 1028 | 3300027111 | Ga0209281_1000043 | Ga0209281_1000043326 | 344 |
| 1029 | 3300027111 | Ga0209281_1000306 | Ga0209281_100030613 | 344 |
| 1030 | 3300027111 | Ga0209281_1000520 | Ga0209281_100052044 | 344 |
| 1031 | 3300027312 | Ga0209371_1000009 | Ga0209371_1000009646 | 344 |
| 1032 | 3300027312 | Ga0209371_1001826 | Ga0209371_10018266 | 344 |
| 1033 | 3300027312 | Ga0209371_1002409 | Ga0209371_10024099 | 344 |
| 1034 | 3300027666 | Ga0209282_1000121 | Ga0209282_100012137 | 344 |
| 1035 | 3300027666 | Ga0209282_1002108 | Ga0209282_10021086 | 344 |
| 1036 | 3300027666 | Ga0209282_1083474 | Ga0209282_10834742 | 344 |
| 1037 | 3300028379 | Ga0268266_10016408 | Ga0268266_100164082 | 344 |
| 1038 | 3300028379 | Ga0268266_10038736 | Ga0268266_100387362 | 344 |
| 1039 | 3300028794 | Ga0307515_10001776 | Ga0307515_1000177615 | 344 |
| 1040 | 3300030500 | Ga0268256_1000010 | Ga0268256_1000010645 | 344 |
| 1041 | 3300030500 | Ga0268256_1002677 | Ga0268256_10026774 | 344 |
| 1042 | 3300030744 | Ga0316181_1260635 | Ga0316181_12606352 | 344 |
| 1043 | 3300031456 | Ga0307513_10243493 | Ga0307513_102434932 | 344 |
| 1044 | 3300031548 | Ga0307408_100020322 | Ga0307408_1000203223 | 344 |
| 1045 | 3300031616 | Ga0307508_10302293 | Ga0307508_103022931 | 344 |
| 1046 | 3300031731 | Ga0307405_10001435 | Ga0307405_100014355 | 344 |
| 1047 | 3300031901 | Ga0307406_10033463 | Ga0307406_100334632 | 344 |
| 1048 | 3300031901 | Ga0307406_10209597 | Ga0307406_102095971 | 344 |
| 1049 | 3300031901 | Ga0307406_10300568 | Ga0307406_103005681 | 344 |
| 1050 | 3300031911 | Ga0307412_10072680 | Ga0307412_100726802 | 344 |
| 1051 | 3300031967 | Ga0315914_1000754 | Ga0315914_10007546 | 344 |
| 1052 | 3300032002 | Ga0307416_100234803 | Ga0307416_1002348031 | 344 |
| 1053 | 3300033430 | Ga0315913_1000195 | Ga0315913_100019537 | 344 |
| 1054 | 3300033464 | Ga0315915_1000247 | Ga0315915_100024713 | 344 |
| 1055 | 3300035692 | Ga0373935_0020800 | Ga0373935_0020800_2060_3100 | 344 |
| 1056 | 3300035695 | Ga0373927_0000053 | Ga0373927_0000053_57641_58681 | 344 |
| 1057 | 3300037068 | Ga0373925_0012359 | Ga0373925_0012359_4429_5469 | 344 |
| 1058 | 3300037312 | Ga0395899_0000058 | Ga0395899_0000058_68483_69520 | 344 |
| 1059 | 3300037418 | Ga0395900_0000056 | Ga0395900_0000056_68511_69548 | 344 |
| 1060 | 3300037466 | Ga0395898_0000114 | Ga0395898_0000114_68502_69539 | 344 |
| 1061 | 3300037466 | Ga0395898_0425316 | Ga0395898_0425316_213_1247 | 344 |
| 1062 | 3300037471 | Ga0395905_0000053 | Ga0395905_0000053_143530_144567 | 344 |
| 1063 | 3300038443 | Ga0395901_0000037 | Ga0395901_0000037_68511_69548 | 344 |
| 1064 | 3300041413 | Ga0439465_0041163 | Ga0439465_0041163_254_1288 | 344 |
| 1065 | 3300041441 | Ga0451787_844771 | Ga0451787_844771_337_1371 | 344 |
| 1066 | 3300041451 | Ga0451791_0335165 | Ga0451791_0335165_337_1371 | 344 |
| 1067 | 3300041458 | Ga0451798_0653057 | Ga0451798_0653057_416_1450 | 344 |
| 1068 | 3300045976 | Ga0466967_0134359 | Ga0466967_0134359_374_1408 | 344 |
| 1069 | 3300046460 | Ga0495638_0042269 | Ga0495638_0042269_1355_2389 | 344 |
| 1070 | 3300046507 | Ga0495606_0006045 | Ga0495606_0006045_4828_5862 | 344 |
| 1071 | 3300046507 | Ga0495606_0159121 | Ga0495606_0159121_172_1206 | 344 |
| 1072 | 3300046512 | Ga0495610_0058992 | Ga0495610_0058992_268_1302 | 344 |
| 1073 | 3300046515 | Ga0495620_0018822 | Ga0495620_0018822_311_1345 | 344 |
| 1074 | 3300046518 | Ga0495631_0045617 | Ga0495631_0045617_541_1575 | 344 |
| 1075 | 3300046530 | Ga0495654_0001320 | Ga0495654_0001320_4579_5613 | 344 |
| 1076 | 3300046558 | Ga0495633_0025401 | Ga0495633_0025401_1318_2352 | 344 |
| 1077 | 3300046660 | Ga0495625_0030670 | Ga0495625_0030670_2539_3573 | 344 |
| 1078 | 3300046674 | Ga0495588_0000697 | Ga0495588_0000697_6678_7712 | 344 |
| 1079 | 3300046674 | Ga0495588_0045977 | Ga0495588_0045977_182_1216 | 344 |
| 1080 | 3300046692 | Ga0495671_0018240 | Ga0495671_0018240_1500_2534 | 344 |
| 1081 | 3300047470 | Ga0495681_0022350 | Ga0495681_0022350_632_1666 | 344 |
| 1082 | 3300047472 | Ga0495686_0002953 | Ga0495686_0002953_9809_10909 | 344 |
| 1083 | 3300047472 | Ga0495686_0054250 | Ga0495686_0054250_321_1355 | 344 |
| 1084 | 3300048903 | Ga0496100_0042919 | Ga0496100_0042919_1494_2528 | 344 |
| 1085 | 3300048904 | Ga0496101_0084608 | Ga0496101_0084608_260_1294 | 344 |
| 1086 | 3300048905 | Ga0496102_0016809 | Ga0496102_0016809_4523_5557 | 344 |
| 1087 | 3300048906 | Ga0496103_0013692 | Ga0496103_0013692_1272_2306 | 344 |
| 1088 | 3300048909 | Ga0496106_0079772 | Ga0496106_0079772_444_1478 | 344 |
| 1089 | 3300048913 | Ga0496110_0145413 | Ga0496110_0145413_652_1686 | 344 |
| 1090 | 3300048914 | Ga0496111_0003716 | Ga0496111_0003716_5846_6880 | 344 |
| 1091 | 3300048916 | Ga0496113_0023658 | Ga0496113_0023658_1827_2861 | 344 |
| 1092 | 3300048919 | Ga0496116_0000100 | Ga0496116_0000100_24851_25885 | 344 |
| 1093 | 3300048919 | Ga0496116_0008443 | Ga0496116_0008443_2944_3978 | 344 |
| 1094 | 3300048919 | Ga0496116_0011001 | Ga0496116_0011001_2710_3744 | 344 |
| 1095 | 3300048919 | Ga0496116_0081067 | Ga0496116_0081067_779_1813 | 344 |
| 1096 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_2106474_2107508 | 344 |
| 1097 | 3300048920 | Ga0496117_0003751 | Ga0496117_0003751_16300_17334 | 344 |
| 1098 | 3300048920 | Ga0496117_0009021 | Ga0496117_0009021_4343_5377 | 344 |
| 1099 | 3300048921 | Ga0496118_0000776 | Ga0496118_0000776_17367_18401 | 344 |
| 1100 | 3300048921 | Ga0496118_0012211 | Ga0496118_0012211_3802_4836 | 344 |
| 1101 | 3300048921 | Ga0496118_0016123 | Ga0496118_0016123_5783_6817 | 344 |
| 1102 | 3300048921 | Ga0496118_0051791 | Ga0496118_0051791_990_2024 | 344 |
| 1103 | 3300048921 | Ga0496118_0074369 | Ga0496118_0074369_944_1978 | 344 |
| 1104 | 3300048922 | Ga0496119_0001813 | Ga0496119_0001813_10864_11940 | 344 |
| 1105 | 3300048922 | Ga0496119_0016196 | Ga0496119_0016196_1318_2352 | 344 |
| 1106 | 3300048922 | Ga0496119_0020462 | Ga0496119_0020462_1314_2348 | 344 |
| 1107 | 3300048922 | Ga0496119_0022254 | Ga0496119_0022254_2493_3527 | 344 |
| 1108 | 3300048922 | Ga0496119_0065582 | Ga0496119_0065582_1105_2139 | 344 |
| 1109 | 3300048923 | Ga0496120_0000034 | Ga0496120_0000034_39775_40809 | 344 |
| 1110 | 3300048923 | Ga0496120_0017769 | Ga0496120_0017769_2010_3044 | 344 |
| 1111 | 3300048924 | Ga0496121_0000220 | Ga0496121_0000220_121186_122220 | 344 |
| 1112 | 3300048924 | Ga0496121_0002488 | Ga0496121_0002488_25591_26625 | 344 |
| 1113 | 3300048924 | Ga0496121_0005480 | Ga0496121_0005480_11777_12811 | 344 |
| 1114 | 3300048924 | Ga0496121_0012849 | Ga0496121_0012849_4649_5683 | 344 |
| 1115 | 3300048924 | Ga0496121_0146856 | Ga0496121_0146856_367_1401 | 344 |
| 1116 | 3300048925 | Ga0496122_0000001 | Ga0496122_0000001_1477264_1478298 | 344 |
| 1117 | 3300048925 | Ga0496122_0001480 | Ga0496122_0001480_15581_16615 | 344 |
| 1118 | 3300048925 | Ga0496122_0004948 | Ga0496122_0004948_11311_12345 | 344 |
| 1119 | 3300048925 | Ga0496122_0007958 | Ga0496122_0007958_1889_2923 | 344 |
| 1120 | 3300048925 | Ga0496122_0013812 | Ga0496122_0013812_879_1913 | 344 |
| 1121 | 3300048925 | Ga0496122_0088715 | Ga0496122_0088715_950_1984 | 344 |
| 1122 | 3300048925 | Ga0496122_0135007 | Ga0496122_0135007_119_1195 | 344 |
| 1123 | 3300048925 | Ga0496122_0224450 | Ga0496122_0224450_14_1048 | 344 |
| 1124 | 3300048926 | Ga0496123_0000001 | Ga0496123_0000001_1480995_1482029 | 344 |
| 1125 | 3300048926 | Ga0496123_0000238 | Ga0496123_0000238_89090_90124 | 344 |
| 1126 | 3300048926 | Ga0496123_0009385 | Ga0496123_0009385_41_1075 | 344 |
| 1127 | 3300048926 | Ga0496123_0012845 | Ga0496123_0012845_4517_5551 | 344 |
| 1128 | 3300048926 | Ga0496123_0043341 | Ga0496123_0043341_422_1498 | 344 |
| 1129 | 3300048927 | Ga0496124_0000083 | Ga0496124_0000083_190786_191820 | 344 |
| 1130 | 3300048927 | Ga0496124_0001450 | Ga0496124_0001450_1749_2783 | 344 |
| 1131 | 3300048927 | Ga0496124_0004345 | Ga0496124_0004345_11718_12752 | 344 |
| 1132 | 3300048927 | Ga0496124_0007026 | Ga0496124_0007026_9792_10826 | 344 |
| 1133 | 3300048927 | Ga0496124_0023874 | Ga0496124_0023874_3448_4560 | 344 |
| 1134 | 3300048927 | Ga0496124_0079046 | Ga0496124_0079046_1476_2510 | 344 |
| 1135 | 3300048927 | Ga0496124_0150064 | Ga0496124_0150064_14_1048 | 344 |
| 1136 | 3300048928 | Ga0496125_0000001 | Ga0496125_0000001_121326_122360 | 344 |
| 1137 | 3300048928 | Ga0496125_0000633 | Ga0496125_0000633_4819_5853 | 344 |
| 1138 | 3300048928 | Ga0496125_0009600 | Ga0496125_0009600_345_1379 | 344 |
| 1139 | 3300048928 | Ga0496125_0015127 | Ga0496125_0015127_3264_4298 | 344 |
| 1140 | 3300048928 | Ga0496125_0098066 | Ga0496125_0098066_250_1284 | 344 |
| 1141 | 3300048929 | Ga0496126_0000311 | Ga0496126_0000311_80088_81122 | 344 |
| 1142 | 3300048929 | Ga0496126_0000971 | Ga0496126_0000971_62_1096 | 344 |
| 1143 | 3300048929 | Ga0496126_0019003 | Ga0496126_0019003_3780_4814 | 344 |
| 1144 | 3300048929 | Ga0496126_0067815 | Ga0496126_0067815_41_1075 | 344 |
| 1145 | 3300048929 | Ga0496126_0068539 | Ga0496126_0068539_108_1142 | 344 |
| 1146 | 3300048929 | Ga0496126_0100613 | Ga0496126_0100613_1183_2259 | 344 |
| 1147 | 3300049459 | Ga0495678_019359 | Ga0495678_019359_437_1471 | 344 |
| 1148 | 3300049568 | Ga0501031_0087598 | Ga0501031_0087598_683_1717 | 344 |
| 1149 | 3300049569 | Ga0501032_0015869 | Ga0501032_0015869_1074_2108 | 344 |
| 1150 | 3300049570 | Ga0501033_0116255 | Ga0501033_0116255_413_1447 | 344 |
| 1151 | 3300049571 | Ga0501034_0134887 | Ga0501034_0134887_494_1528 | 344 |
| 1152 | 3300049571 | Ga0501034_0308564 | Ga0501034_0308564_331_1365 | 344 |
| 1153 | 3300049572 | Ga0501036_0104009 | Ga0501036_0104009_751_1785 | 344 |
| 1154 | 3300049574 | Ga0501038_0120609 | Ga0501038_0120609_710_1744 | 344 |
| 1155 | 3300049579 | Ga0501043_0031725 | Ga0501043_0031725_2697_3731 | 344 |
| 1156 | 3300049583 | Ga0501067_0084102 | Ga0501067_0084102_417_1454 | 344 |
| 1157 | 3300049589 | Ga0501073_0092668 | Ga0501073_0092668_238_1272 | 344 |
| 1158 | 3300049592 | Ga0501076_0175281 | Ga0501076_0175281_523_1569 | 344 |
| 1159 | 3300049741 | Ga0501079_0266024 | Ga0501079_0266024_30_1118 | 344 |
| 1160 | 3300049743 | Ga0501081_0237343 | Ga0501081_0237343_149_1237 | 344 |
| 1161 | 3300049744 | Ga0501083_0055845 | Ga0501083_0055845_1435_2469 | 344 |
| 1162 | 3300050489 | nmdc:mga03683_14096_c1 | nmdc:mga03683_14096_c1_1303_2337 | 344 |
| 1163 | 3300050491 | nmdc:mga00v17_270_c1 | nmdc:mga00v17_270_c1_2448_3482 | 344 |
| 1164 | 3300050491 | nmdc:mga00v17_6830_c1 | nmdc:mga00v17_6830_c1_149_1183 | 344 |
| 1165 | 3300050492 | nmdc:mga0yw44_185_c2 | nmdc:mga0yw44_185_c2_6163_7197 | 344 |
| 1166 | 3300050496 | nmdc:mga07m45_11621_c1 | nmdc:mga07m45_11621_c1_1420_2454 | 344 |
| 1167 | 3300050496 | nmdc:mga07m45_52305_c1 | nmdc:mga07m45_52305_c1_928_1962 | 344 |
| 1168 | 3300050516 | nmdc:mga0sz30_1697_c1 | nmdc:mga0sz30_1697_c1_4913_5947 | 344 |
| 1169 | 3300050516 | nmdc:mga0sz30_18668_c1 | nmdc:mga0sz30_18668_c1_641_1675 | 344 |
| 1170 | 3300050516 | nmdc:mga0sz30_61547_c1 | nmdc:mga0sz30_61547_c1_175_1209 | 344 |
| 1171 | 3300053099 | Ga0500654_104648 | Ga0500654_104648_122_1156 | 344 |
| 1172 | 3300053107 | Ga0500560_003440 | Ga0500560_003440_1900_2934 | 344 |
| 1173 | 3300053111 | Ga0500572_013955 | Ga0500572_013955_235_1269 | 344 |
| 1174 | 3300053125 | Ga0500618_009865 | Ga0500618_009865_1132_2166 | 344 |
| 1175 | 3300053140 | Ga0500573_0005911 | Ga0500573_0005911_2633_3667 | 344 |
| 1176 | 3300053153 | Ga0500616_0001195 | Ga0500616_0001195_1832_2866 | 344 |
| 1177 | 3300053153 | Ga0500616_0121879 | Ga0500616_0121879_64_1098 | 344 |
| 1178 | 3300053156 | Ga0500622_0000117 | Ga0500622_0000117_60304_61338 | 344 |
| 1179 | 3300053157 | Ga0500624_000960 | Ga0500624_000960_1345_2379 | 344 |
| 1180 | 3300053161 | Ga0500634_0010532 | Ga0500634_0010532_956_1990 | 344 |
| 1181 | 3300053161 | Ga0500634_0010597 | Ga0500634_0010597_3479_4513 | 344 |
| 1182 | 3300053177 | Ga0500636_0000006 | Ga0500636_0000006_37755_38789 | 344 |
| 1183 | 3300053177 | Ga0500636_0006086 | Ga0500636_0006086_4672_5706 | 344 |
| 1184 | 3300059493 | Ga0587077_020742 | Ga0587077_020742_64_1098 | 344 |
| 1185 | 3300059504 | Ga0587082_007053 | Ga0587082_007053_84_1118 | 344 |
| 1186 | 3300059505 | Ga0587083_0022550 | Ga0587083_0022550_58_1092 | 344 |
| 1187 | 3300059510 | Ga0587090_005104 | Ga0587090_005104_504_1538 | 344 |
| 1188 | 3300059511 | Ga0587091_003098 | Ga0587091_003098_78_1112 | 344 |
| 1189 | 3300059605 | Ga0587106_002790 | Ga0587106_002790_91_1125 | 344 |
| 1190 | 3300059623 | Ga0587101_002817 | Ga0587101_002817_239_1273 | 344 |
| 1191 | 3300059639 | Ga0587062_009354 | Ga0587062_009354_78_1112 | 344 |
| 1192 | 3300059640 | Ga0587067_017373 | Ga0587067_017373_80_1114 | 344 |
| 1193 | 3300059643 | Ga0587072_017600 | Ga0587072_017600_120_1154 | 344 |
| 1194 | 3300059645 | Ga0587076_017439 | Ga0587076_017439_31_1065 | 344 |
| 1195 | 3300059647 | Ga0587079_006543 | Ga0587079_006543_76_1110 | 344 |
| 1196 | 3300059647 | Ga0587079_022219 | Ga0587079_022219_49_1083 | 344 |
| 1197 | 3300060344 | Ga0587071_002877 | Ga0587071_002877_1277_2311 | 344 |
| 1198 | 3300060346 | Ga0587111_0024026 | Ga0587111_0024026_89_1123 | 344 |
| 1199 | iso_pu_bacteria | 2585427531 | 2585559967 | 344 |
| 1200 | iso_pu_bacteria | 2996893221 | 2996893231 | 344 |
| 1201 | 3300001979 | JGI24740J21852_10000265 | JGI24740J21852_100002659 | 345 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4jwo-assembly1.cif.gz_A | the crystal structure of a possible phosphate binding protein from planctomyces limnophilus dsm 3776 | 0.8554 | 26 | 343 |
| 4jwo-assembly1.cif.gz_A | the crystal structure of a possible phosphate binding protein from planctomyces limnophilus dsm 3776 | 0.8386 | 26 | 343 |
| 1twy-assembly10.cif.gz_B | crystal structure of an abc-type phosphate transport receptor from vibrio cholerae | 0.8129 | 26 | 328 |
| 1twy-assembly10.cif.gz_B | crystal structure of an abc-type phosphate transport receptor from vibrio cholerae | 0.81 | 26 | 328 |
| 1twy-assembly1.cif.gz_A | crystal structure of an abc-type phosphate transport receptor from vibrio cholerae | 0.803 | 26 | 328 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4jwoA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9306 | 26 | 110 | 3.40.190.10 |
| 1twyF01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9014 | 26 | 110 | 3.40.190.10 |
| 1pc3B01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8865 | 26 | 110 | 3.40.190.10 |
| 4lvqB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8521 | 26 | 110 | 3.40.190.10 |
| 4gd5B01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8475 | 26 | 110 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S6BBB0-F1-model_v4 | deleted | 0.9955 | 23 | 105 |
|
| AF-A0A259DCA8-F1-model_v4 | Phosphonate ABC transporter substrate-binding protein | 0.9822 | 27 | 345 |
|
| AF-A0A3B9UK91-F1-model_v4 | deleted | 0.9801 | 24 | 92 |
|
| AF-A0A4Q2YS71-F1-model_v4 | Phosphate ABC transporter substrate-binding protein | 0.9762 | 23 | 103 |
|
| AF-A0A357RWG2-F1-model_v4 | deleted | 0.972 | 93 | 345 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar