F491329

General Info

Members Datasets Scaffolds Average Seq Length
1183 249 1183 219

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100307312|Ga0068868_1003073122
Length 245
Sequence MMASSRTINHWRGAVWRPRMGVPIASAVSKAAERREEILDRIARAAQLAKRDPAEVRLIAVSKGRSEAEIKALIEAGQRDFGENRMQEALAKWPSLLVRHAGVSLHGIGRLQSNKAADAVSLFDAIHSVDRHSLLDALAKEAAKSTRRPPVYVQVNIGEEQQKGGCAVAEVGELVEAVRASPLPLAGLMAIPPLALEPAPYFALLAKLARRHDVKGLSIGMSGDFEAAVMLGATAVRVGTALFEA

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
175 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
176 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
188 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
189 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
190 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
191 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
192 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
193 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
194 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
195 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
196 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
202 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
209 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
210 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
213 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
214 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
215 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
218 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
219 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
220 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
248 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
249 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.92
Metatranscriptomes 0.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 3.63
Rhizosphere 95.77
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1018046 3300001904 Bacteria 1118
2 JGI24741J21665_1000799 3300001915 Bacteria 9453
3 JGI24741J21665_1006384 3300001915 Bacteria 2370
4 JGI24752J21851_1008347 3300001976 Bacteria 1348
5 JGI24740J21852_10000953 3300001979 Bacteria 12862
6 JGI24740J21852_10002998 3300001979 Bacteria 7474
7 JGI24740J21852_10064552 3300001979 Bacteria 999
8 JGI24739J22299_10003826 3300001989 Bacteria 5744
9 JGI24739J22299_10009049 3300001989 Bacteria 3714
10 JGI24737J22298_10010275 3300001990 Bacteria 3094
11 JGI24737J22298_10015033 3300001990 Bacteria 2506
12 JGI24737J22298_10020974 3300001990 Bacteria 2083
13 JGI24735J21928_10005733 3300002067 Bacteria 4106
14 JGI24735J21928_10006929 3300002067 Bacteria 3708
15 JGI24735J21928_10013014 3300002067 Bacteria 2622
16 rootH1_10067802 3300003323 Bacteria 1423
17 Ga0070658_10000177 3300005327 Bacteria 56043
18 Ga0070658_10000256 3300005327 Bacteria 46854
19 Ga0070658_10005880 3300005327 Bacteria 9948
20 Ga0070658_10015902 3300005327 Bacteria 6017
21 Ga0070658_10030570 3300005327 Bacteria 4326
22 Ga0070658_10070153 3300005327 Bacteria 2868
23 Ga0070658_10077630 3300005327 Bacteria 2725
24 Ga0070658_10090745 3300005327 Unclassified 2517
25 Ga0070658_10250564 3300005327 Bacteria 1502
26 Ga0070658_10314768 3300005327 Bacteria 1336
27 Ga0070658_10388791 3300005327 Bacteria 1197
28 Ga0070658_10624600 3300005327 Bacteria 934
29 Ga0070676_10009410 3300005328 Bacteria 5278
30 Ga0070676_10084458 3300005328 Bacteria 1933
31 Ga0070676_10087977 3300005328 Bacteria 1897
32 Ga0070676_10170172 3300005328 Bacteria 1408
33 Ga0070683_100000686 3300005329 Bacteria 24502
34 Ga0070683_100001183 3300005329 Bacteria 19793
35 Ga0070683_100005397 3300005329 Bacteria 10668
36 Ga0070683_100008667 3300005329 Bacteria 8644
37 Ga0070683_100039165 3300005329 Bacteria 4350
38 Ga0070683_100259584 3300005329 Bacteria 1652
39 Ga0070683_100469592 3300005329 Bacteria 1201
40 Ga0070670_100001825 3300005331 Bacteria 17334
41 Ga0070670_100026971 3300005331 Bacteria 4941
42 Ga0070670_100046810 3300005331 Bacteria 3720
43 Ga0070670_100126985 3300005331 Bacteria 2202
44 Ga0070670_100455436 3300005331 Bacteria 1134
45 Ga0070670_100782452 3300005331 Bacteria 861
46 Ga0068869_100029885 3300005334 Bacteria 3821
47 Ga0068869_100056572 3300005334 Bacteria 2861
48 Ga0070666_10013662 3300005335 Bacteria 5155
49 Ga0070666_10053723 3300005335 Bacteria 2718
50 Ga0070666_10089819 3300005335 Bacteria 2109
51 Ga0070666_10118427 3300005335 Bacteria 1835
52 Ga0070680_100000105 3300005336 Bacteria 48515
53 Ga0070680_100001387 3300005336 Bacteria 17511
54 Ga0070680_100002431 3300005336 Bacteria 13798
55 Ga0070682_100149061 3300005337 Bacteria 1603
56 Ga0070682_100391871 3300005337 Bacteria 1048
57 Ga0068868_100022216 3300005338 Bacteria 4786
58 Ga0068868_100072424 3300005338 Bacteria 2749
59 Ga0068868_100076037 3300005338 Bacteria 2684
60 Ga0068868_100080116 3300005338 Bacteria 2616
61 Ga0068868_100202523 3300005338 Bacteria 1655
62 Ga0068868_100218594 3300005338 Bacteria 1594
63 Ga0068868_100307312 3300005338 Bacteria 1348
64 Ga0068868_100366338 3300005338 Bacteria 1237
65 Ga0068868_100449925 3300005338 Bacteria 1120
66 Ga0070660_100000064 3300005339 Bacteria 62554
67 Ga0070660_100000065 3300005339 Bacteria 61999
68 Ga0070660_100006285 3300005339 Bacteria 8228
69 Ga0070660_100007019 3300005339 Bacteria 7820
70 Ga0070660_100015669 3300005339 Bacteria 5480
71 Ga0070660_100031263 3300005339 Bacteria 3997
72 Ga0070660_100040270 3300005339 Bacteria 3555
73 Ga0070660_100043765 3300005339 Bacteria 3422
74 Ga0070660_100135043 3300005339 Bacteria 1976
75 Ga0070660_100197196 3300005339 Bacteria 1632
76 Ga0070660_100269900 3300005339 Bacteria 1390
77 Ga0070660_100406815 3300005339 Bacteria 1126
78 Ga0070660_100640525 3300005339 Bacteria 890
79 Ga0070691_10000496 3300005341 Bacteria 14783
80 Ga0070691_10173591 3300005341 Bacteria 1118
81 Ga0070687_100157580 3300005343 Bacteria 1339
82 Ga0070661_100001118 3300005344 Bacteria 18830
83 Ga0070661_100008218 3300005344 Bacteria 7201
84 Ga0070661_100008646 3300005344 Bacteria 7044
85 Ga0070661_100016702 3300005344 Bacteria 5194
86 Ga0070661_100022325 3300005344 Bacteria 4530
87 Ga0070661_100022375 3300005344 Bacteria 4526
88 Ga0070661_100023580 3300005344 Bacteria 4411
89 Ga0070661_100025998 3300005344 Bacteria 4207
90 Ga0070661_100033941 3300005344 Bacteria 3699
91 Ga0070661_100068634 3300005344 Bacteria 2605
92 Ga0070661_100181256 3300005344 Unclassified 1602
93 Ga0070661_100306040 3300005344 Bacteria 1238
94 Ga0070692_10007696 3300005345 Bacteria 4765
95 Ga0070692_10110986 3300005345 Bacteria 1517
96 Ga0070668_100019102 3300005347 Bacteria 5153
97 Ga0070668_100141412 3300005347 Bacteria 1939
98 Ga0070669_100038661 3300005353 Bacteria 3465
99 Ga0070669_100070402 3300005353 Bacteria 2585
100 Ga0070669_100162482 3300005353 Bacteria 1736
101 Ga0070669_100171613 3300005353 Bacteria 1691
102 Ga0070669_100256928 3300005353 Bacteria 1393
103 Ga0070675_100070518 3300005354 Bacteria 2896
104 Ga0070675_100123993 3300005354 Bacteria 2197
105 Ga0070675_100292059 3300005354 Bacteria 1435
106 Ga0070675_100313668 3300005354 Bacteria 1384
107 Ga0070671_100000918 3300005355 Bacteria 21508
108 Ga0070671_100003286 3300005355 Bacteria 12614
109 Ga0070671_100018172 3300005355 Bacteria 5708
110 Ga0070671_100022379 3300005355 Bacteria 5162
111 Ga0070671_100158720 3300005355 Bacteria 1911
112 Ga0070671_100485574 3300005355 Bacteria 1062
113 Ga0070671_100542431 3300005355 Bacteria 1002
114 Ga0070671_100591897 3300005355 Unclassified 958
115 Ga0070671_100666802 3300005355 Bacteria 901
116 Ga0070674_100007083 3300005356 Bacteria 6594
117 Ga0070674_100017382 3300005356 Bacteria 4524
118 Ga0070674_100022798 3300005356 Bacteria 4040
119 Ga0070674_100047680 3300005356 Bacteria 2937
120 Ga0070674_100272245 3300005356 Bacteria 1339
121 Ga0070674_100740742 3300005356 Bacteria 844
122 Ga0070673_100000158 3300005364 Bacteria 32576
123 Ga0070673_100001256 3300005364 Bacteria 14726
124 Ga0070673_100123294 3300005364 Bacteria 2165
125 Ga0070673_100251219 3300005364 Bacteria 1541
126 Ga0070673_100358722 3300005364 Bacteria 1295
127 Ga0070673_100376156 3300005364 Bacteria 1265
128 Ga0070659_100002462 3300005366 Bacteria 13162
129 Ga0070659_100010839 3300005366 Bacteria 6720
130 Ga0070659_100011332 3300005366 Bacteria 6593
131 Ga0070659_100016167 3300005366 Bacteria 5598
132 Ga0070659_100017548 3300005366 Bacteria 5391
133 Ga0070659_100019741 3300005366 Bacteria 5114
134 Ga0070659_100026730 3300005366 Bacteria 4442
135 Ga0070659_100042884 3300005366 Bacteria 3538
136 Ga0070659_100085013 3300005366 Bacteria 2530
137 Ga0070659_100179020 3300005366 Bacteria 1739
138 Ga0070659_100184284 3300005366 Bacteria 1714
139 Ga0070659_100251732 3300005366 Bacteria 1464
140 Ga0070659_100943469 3300005366 Bacteria 755
141 Ga0070667_100003487 3300005367 Bacteria 13401
142 Ga0070667_100004176 3300005367 Bacteria 12195
143 Ga0070667_100005701 3300005367 Bacteria 10401
144 Ga0070667_100007140 3300005367 Bacteria 9286
145 Ga0070667_100028404 3300005367 Bacteria 4657
146 Ga0070667_100040368 3300005367 Bacteria 3913
147 Ga0070667_100073251 3300005367 Bacteria 2920
148 Ga0070667_100087747 3300005367 Bacteria 2670
149 Ga0070667_100397850 3300005367 Bacteria 1253
150 Ga0070709_10214942 3300005434 Bacteria 1368
151 Ga0070714_100017172 3300005435 Bacteria 5860
152 Ga0070714_100023219 3300005435 Bacteria 5091
153 Ga0070714_100026273 3300005435 Bacteria 4811
154 Ga0070714_100031562 3300005435 Bacteria 4422
155 Ga0070713_100012866 3300005436 Bacteria 6155
156 Ga0070713_100015960 3300005436 Bacteria 5635
157 Ga0070713_100041432 3300005436 Bacteria 3751
158 Ga0070713_100415206 3300005436 Bacteria 1259
159 Ga0070694_100006539 3300005444 Bacteria 7078
160 Ga0070694_100154201 3300005444 Bacteria 1680
161 Ga0070663_100000033 3300005455 Bacteria 71453
162 Ga0070663_100000701 3300005455 Bacteria 18072
163 Ga0070663_100011822 3300005455 Bacteria 5498
164 Ga0070663_100017911 3300005455 Bacteria 4631
165 Ga0070663_100046441 3300005455 Bacteria 3073
166 Ga0070663_100064360 3300005455 Bacteria 2650
167 Ga0070663_100093664 3300005455 Bacteria 2229
168 Ga0070663_100181264 3300005455 Bacteria 1634
169 Ga0070663_100183247 3300005455 Bacteria 1626
170 Ga0070663_100349761 3300005455 Bacteria 1196
171 Ga0070678_100002162 3300005456 Bacteria 10666
172 Ga0070678_100008440 3300005456 Bacteria 6171
173 Ga0070678_100078236 3300005456 Bacteria 2498
174 Ga0070678_100213464 3300005456 Bacteria 1600
175 Ga0070678_100324279 3300005456 Bacteria 1316
176 Ga0070662_100000017 3300005457 Bacteria 105478
177 Ga0070662_100021686 3300005457 Bacteria 4390
178 Ga0070662_100022257 3300005457 Bacteria 4336
179 Ga0070662_100022394 3300005457 Bacteria 4326
180 Ga0070662_100022923 3300005457 Bacteria 4283
181 Ga0070662_100115286 3300005457 Bacteria 2052
182 Ga0070662_100127689 3300005457 Bacteria 1956
183 Ga0070662_100195091 3300005457 Bacteria 1603
184 Ga0070662_100258860 3300005457 Bacteria 1401
185 Ga0070662_100430877 3300005457 Bacteria 1092
186 Ga0070681_10020638 3300005458 Bacteria 6602
187 Ga0070681_10031303 3300005458 Bacteria 5341
188 Ga0070681_10067531 3300005458 Bacteria 3543
189 Ga0068867_100024507 3300005459 Bacteria 4324
190 Ga0068867_100029472 3300005459 Bacteria 3954
191 Ga0068867_100058767 3300005459 Bacteria 2849
192 Ga0068867_100120583 3300005459 Bacteria 2026
193 Ga0070679_100000125 3300005530 Bacteria 61348
194 Ga0070679_100024833 3300005530 Bacteria 5874
195 Ga0070679_100059142 3300005530 Bacteria 3820
196 Ga0070679_100198561 3300005530 Bacteria 1973
197 Ga0070679_100374239 3300005530 Bacteria 1371
198 Ga0070679_101001938 3300005530 Bacteria 779
199 Ga0070684_100004075 3300005535 Bacteria 11060
200 Ga0070684_100032649 3300005535 Bacteria 4438
201 Ga0070684_100044912 3300005535 Bacteria 3824
202 Ga0070684_100070971 3300005535 Bacteria 3066
203 Ga0070684_100255462 3300005535 Bacteria 1602
204 Ga0068853_100000703 3300005539 Bacteria 23188
205 Ga0068853_100001925 3300005539 Bacteria 15308
206 Ga0068853_100002108 3300005539 Bacteria 14761
207 Ga0068853_100019076 3300005539 Bacteria 5682
208 Ga0068853_100062890 3300005539 Bacteria 3213
209 Ga0068853_100073888 3300005539 Bacteria 2974
210 Ga0068853_100095088 3300005539 Bacteria 2627
211 Ga0068853_100103161 3300005539 Bacteria 2524
212 Ga0068853_100108952 3300005539 Bacteria 2458
213 Ga0068853_100109796 3300005539 Bacteria 2449
214 Ga0068853_100116527 3300005539 Bacteria 2378
215 Ga0068853_100170354 3300005539 Bacteria 1969
216 Ga0068853_100243154 3300005539 Bacteria 1650
217 Ga0070672_100001526 3300005543 Bacteria 14347
218 Ga0070672_100015057 3300005543 Bacteria 5496
219 Ga0070672_100072979 3300005543 Bacteria 2734
220 Ga0070672_100080345 3300005543 Bacteria 2612
221 Ga0070672_100129764 3300005543 Bacteria 2071
222 Ga0070686_100035950 3300005544 Bacteria 3062
223 Ga0070686_100098552 3300005544 Bacteria 1970
224 Ga0070686_100429455 3300005544 Bacteria 1011
225 Ga0070695_100119089 3300005545 Bacteria 1804
226 Ga0070695_100456012 3300005545 Bacteria 981
227 Ga0070696_100007107 3300005546 Bacteria 7474
228 Ga0070696_100028105 3300005546 Bacteria 3836
229 Ga0070693_100000820 3300005547 Bacteria 13801
230 Ga0070693_100040422 3300005547 Bacteria 2618
231 Ga0070693_100130176 3300005547 Bacteria 1572
232 Ga0070693_100408670 3300005547 Bacteria 943
233 Ga0070665_100001860 3300005548 Bacteria 23948
234 Ga0070665_100010457 3300005548 Bacteria 9390
235 Ga0070665_100011993 3300005548 Bacteria 8749
236 Ga0070665_100012945 3300005548 Bacteria 8402
237 Ga0070665_100047225 3300005548 Bacteria 4322
238 Ga0070665_100091965 3300005548 Bacteria 3038
239 Ga0070665_100121694 3300005548 Bacteria 2611
240 Ga0070665_100134896 3300005548 Bacteria 2470
241 Ga0070665_100200705 3300005548 Bacteria 1995
242 Ga0070665_100237146 3300005548 Bacteria 1824
243 Ga0070665_101260648 3300005548 Bacteria 749
244 Ga0070704_100053679 3300005549 Bacteria 2849
245 Ga0068855_100000194 3300005563 Bacteria 78505
246 Ga0068855_100000660 3300005563 Bacteria 42200
247 Ga0068855_100035406 3300005563 Bacteria 5947
248 Ga0068855_100045992 3300005563 Bacteria 5160
249 Ga0068855_100046928 3300005563 Bacteria 5105
250 Ga0068855_100134268 3300005563 Bacteria 2824
251 Ga0068855_100254660 3300005563 Bacteria 1957
252 Ga0068855_100394169 3300005563 Bacteria 1518
253 Ga0070664_100000098 3300005564 Bacteria 55907
254 Ga0070664_100001922 3300005564 Bacteria 16685
255 Ga0070664_100002156 3300005564 Bacteria 15787
256 Ga0070664_100029018 3300005564 Bacteria 4609
257 Ga0070664_100029619 3300005564 Bacteria 4564
258 Ga0070664_100029884 3300005564 Bacteria 4543
259 Ga0070664_100082842 3300005564 Bacteria 2766
260 Ga0070664_100135940 3300005564 Bacteria 2161
261 Ga0070664_100480990 3300005564 Bacteria 1143
262 Ga0070664_100958550 3300005564 Bacteria 803
263 Ga0068857_100006167 3300005577 Bacteria 10248
264 Ga0068857_100024206 3300005577 Bacteria 5344
265 Ga0068857_100062941 3300005577 Bacteria 3298
266 Ga0068857_100097225 3300005577 Bacteria 2639
267 Ga0068857_100117680 3300005577 Bacteria 2391
268 Ga0068857_100350293 3300005577 Bacteria 1367
269 Ga0068857_100374850 3300005577 Bacteria 1320
270 Ga0068857_100684415 3300005577 Bacteria 974
271 Ga0068854_100014644 3300005578 Bacteria 5173
272 Ga0068854_100016294 3300005578 Bacteria 4951
273 Ga0068854_100022085 3300005578 Bacteria 4328
274 Ga0068854_100046087 3300005578 Bacteria 3103
275 Ga0068854_100060693 3300005578 Bacteria 2737
276 Ga0068854_100073396 3300005578 Bacteria 2507
277 Ga0068854_100077975 3300005578 Bacteria 2439
278 Ga0068854_100168611 3300005578 Bacteria 1702
279 Ga0068854_100229564 3300005578 Bacteria 1472
280 Ga0068854_100356792 3300005578 Unclassified 1198
281 Ga0068854_100609196 3300005578 Bacteria 933
282 Ga0068856_100000098 3300005614 Bacteria 83221
283 Ga0068856_100015637 3300005614 Bacteria 7335
284 Ga0068856_100018917 3300005614 Bacteria 6681
285 Ga0068856_100052216 3300005614 Bacteria 4031
286 Ga0068856_100129246 3300005614 Bacteria 2530
287 Ga0068856_100199335 3300005614 Bacteria 2016
288 Ga0068856_100226604 3300005614 Unclassified 1885
289 Ga0068856_100273930 3300005614 Bacteria 1704
290 Ga0068856_100374832 3300005614 Bacteria 1442
291 Ga0068856_100462773 3300005614 Unclassified 1289
292 Ga0068856_100516397 3300005614 Bacteria 1216
293 Ga0068856_101267591 3300005614 Bacteria 753
294 Ga0068852_100000953 3300005616 Bacteria 19048
295 Ga0068852_100005309 3300005616 Bacteria 9198
296 Ga0068852_100008945 3300005616 Bacteria 7411
297 Ga0068852_100009153 3300005616 Bacteria 7335
298 Ga0068852_100013576 3300005616 Bacteria 6235
299 Ga0068852_100032966 3300005616 Bacteria 4296
300 Ga0068852_100107541 3300005616 Bacteria 2530
301 Ga0068852_100115637 3300005616 Bacteria 2446
302 Ga0068852_100142404 3300005616 Bacteria 2220
303 Ga0068852_100171423 3300005616 Bacteria 2034
304 Ga0068852_100312681 3300005616 Bacteria 1523
305 Ga0068852_100326855 3300005616 Bacteria 1491
306 Ga0068852_100373407 3300005616 Bacteria 1397
307 Ga0068859_100003037 3300005617 Bacteria 17020
308 Ga0068859_100009943 3300005617 Bacteria 9596
309 Ga0068859_100021936 3300005617 Bacteria 6403
310 Ga0068859_100047776 3300005617 Bacteria 4300
311 Ga0068859_100065640 3300005617 Bacteria 3663
312 Ga0068864_100000118 3300005618 Bacteria 77800
313 Ga0068864_100007806 3300005618 Bacteria 8814
314 Ga0068864_100009821 3300005618 Bacteria 7891
315 Ga0068864_100040839 3300005618 Bacteria 3967
316 Ga0068864_100607352 3300005618 Bacteria 1062
317 Ga0068861_100054228 3300005719 Bacteria 3053
318 Ga0068851_10009876 3300005834 Bacteria 4444
319 Ga0068851_10068150 3300005834 Bacteria 1836
320 Ga0068851_10117520 3300005834 Bacteria 1426
321 Ga0068851_10222512 3300005834 Bacteria 1061
322 Ga0068851_10245683 3300005834 Bacteria 1014
323 Ga0068851_10298467 3300005834 Bacteria 926
324 Ga0068870_10083110 3300005840 Bacteria 1775
325 Ga0068870_10088785 3300005840 Bacteria 1724
326 Ga0068863_100000948 3300005841 Bacteria 29123
327 Ga0068863_100009868 3300005841 Bacteria 9300
328 Ga0068863_100033463 3300005841 Bacteria 4897
329 Ga0068863_100042581 3300005841 Bacteria 4314
330 Ga0068863_100046820 3300005841 Bacteria 4105
331 Ga0068863_100164794 3300005841 Bacteria 2125
332 Ga0068863_100397159 3300005841 Bacteria 1348
333 Ga0068863_100550175 3300005841 Bacteria 1139
334 Ga0068858_100000561 3300005842 Bacteria 38777
335 Ga0068858_100014347 3300005842 Bacteria 7471
336 Ga0068858_100015008 3300005842 Bacteria 7289
337 Ga0068858_100020175 3300005842 Bacteria 6232
338 Ga0068858_100049547 3300005842 Bacteria 3889
339 Ga0068858_100142026 3300005842 Bacteria 2254
340 Ga0068858_100520494 3300005842 Bacteria 1150
341 Ga0068860_100008415 3300005843 Bacteria 10275
342 Ga0068860_100024302 3300005843 Bacteria 5857
343 Ga0068860_100041734 3300005843 Bacteria 4382
344 Ga0068860_100083785 3300005843 Bacteria 3033
345 Ga0068860_100139378 3300005843 Bacteria 2330
346 Ga0068860_100432204 3300005843 Bacteria 1306
347 Ga0068862_100004687 3300005844 Bacteria 11517
348 Ga0068862_100020001 3300005844 Bacteria 5588
349 Ga0068862_100030372 3300005844 Bacteria 4554
350 Ga0068862_100202193 3300005844 Bacteria 1792
351 Ga0068862_100901640 3300005844 Bacteria 869
352 Ga0070717_10000958 3300006028 Bacteria 19233
353 Ga0075364_10181296 3300006051 Bacteria 1425
354 Ga0070716_100020532 3300006173 Bacteria 3468
355 Ga0070712_100009798 3300006175 Bacteria 6036
356 Ga0075366_10130255 3300006195 Bacteria 1518
357 Ga0097621_100012478 3300006237 Bacteria 6302
358 Ga0097621_100017230 3300006237 Bacteria 5481
359 Ga0097621_100036421 3300006237 Bacteria 3937
360 Ga0097621_100718384 3300006237 Bacteria 921
361 Ga0068871_100003349 3300006358 Bacteria 11011
362 Ga0068871_100009200 3300006358 Bacteria 7143
363 Ga0068871_100015486 3300006358 Bacteria 5709
364 Ga0068871_100115828 3300006358 Bacteria 2259
365 Ga0068871_100386464 3300006358 Unclassified 1244
366 Ga0075428_100485230 3300006844 Bacteria 1323
367 Ga0075433_10007758 3300006852 Bacteria 8526
368 Ga0068865_100064921 3300006881 Bacteria 2570
369 Ga0068865_100082985 3300006881 Bacteria 2306
370 Ga0097620_100003037 3300006931 Bacteria 17020
371 Ga0097620_100009944 3300006931 Bacteria 9596
372 Ga0097620_100021936 3300006931 Bacteria 6403
373 Ga0097620_100047778 3300006931 Bacteria 4300
374 Ga0097620_100065638 3300006931 Bacteria 3663
375 Ga0105250_10079005 3300009092 Bacteria 1333
376 Ga0105240_10020205 3300009093 Bacteria 8890
377 Ga0105240_10140682 3300009093 Bacteria 2886
378 Ga0105240_10729233 3300009093 Bacteria 1079
379 Ga0111539_10282877 3300009094 Bacteria 1930
380 Ga0105245_10013631 3300009098 Bacteria 7080
381 Ga0105247_10142867 3300009101 Bacteria 1570
382 Ga0105243_10139915 3300009148 Bacteria 2064
383 Ga0105243_10956851 3300009148 Bacteria 856
384 Ga0105241_10258637 3300009174 Bacteria 1479
385 Ga0105241_10469093 3300009174 Bacteria 1117
386 Ga0105242_10226400 3300009176 Bacteria 1674
387 Ga0105248_10000184 3300009177 Bacteria 72728
388 Ga0105248_10000206 3300009177 Bacteria 67932
389 Ga0105248_10005596 3300009177 Bacteria 13805
390 Ga0105248_10006340 3300009177 Bacteria 12976
391 Ga0105248_10037274 3300009177 Bacteria 5440
392 Ga0105248_10066528 3300009177 Bacteria 4046
393 Ga0105248_10143245 3300009177 Bacteria 2697
394 Ga0105248_10198700 3300009177 Bacteria 2259
395 Ga0105248_10509378 3300009177 Bacteria 1357
396 Ga0105248_10861504 3300009177 Bacteria 1023
397 Ga0105237_10021979 3300009545 Bacteria 6549
398 Ga0105237_10435052 3300009545 Bacteria 1317
399 Ga0105238_10011287 3300009551 Bacteria 8989
400 Ga0105238_10032471 3300009551 Bacteria 5313
401 Ga0105249_10030844 3300009553 Bacteria 4846
402 Ga0105249_10047537 3300009553 Bacteria 3910
403 Ga0105249_10166705 3300009553 Bacteria 2133
404 Ga0105249_10523740 3300009553 Bacteria 1233
405 Ga0105239_10095083 3300010375 Bacteria 3292
406 Ga0105239_10174692 3300010375 Bacteria 2402
407 Ga0105239_10749181 3300010375 Bacteria 1118
408 Ga0105246_10058818 3300011119 Bacteria 2664
409 Ga0157373_10001618 3300013100 Bacteria 17180
410 Ga0157373_10039152 3300013100 Bacteria 3394
411 Ga0157373_10053636 3300013100 Bacteria 2867
412 Ga0157373_10064671 3300013100 Bacteria 2589
413 Ga0157373_10121236 3300013100 Bacteria 1838
414 Ga0157373_10136274 3300013100 Bacteria 1726
415 Ga0157373_10241012 3300013100 Bacteria 1278
416 Ga0157373_10260746 3300013100 Bacteria 1226
417 Ga0157371_10044173 3300013102 Bacteria 3173
418 Ga0157371_10071343 3300013102 Bacteria 2458
419 Ga0157371_10137425 3300013102 Bacteria 1740
420 Ga0157371_10225271 3300013102 Bacteria 1347
421 Ga0157370_10001780 3300013104 Bacteria 26574
422 Ga0157370_10004682 3300013104 Bacteria 15607
423 Ga0157370_10009396 3300013104 Bacteria 10454
424 Ga0157370_10018523 3300013104 Bacteria 7000
425 Ga0157370_10101433 3300013104 Bacteria 2696
426 Ga0157370_10539788 3300013104 Bacteria 1069
427 Ga0157369_10011507 3300013105 Bacteria 10050
428 Ga0157369_10031766 3300013105 Bacteria 5809
429 Ga0157369_10045685 3300013105 Bacteria 4761
430 Ga0157369_10049791 3300013105 Bacteria 4540
431 Ga0157369_10081409 3300013105 Bacteria 3465
432 Ga0157369_10171368 3300013105 Bacteria 2287
433 Ga0157369_10195506 3300013105 Bacteria 2124
434 Ga0157369_10233540 3300013105 Bacteria 1922
435 Ga0157369_10299097 3300013105 Bacteria 1674
436 Ga0157369_10757297 3300013105 Bacteria 999
437 Ga0157374_10016481 3300013296 Bacteria 6497
438 Ga0157374_10020625 3300013296 Bacteria 5852
439 Ga0157374_10390900 3300013296 Bacteria 1386
440 Ga0157378_10006347 3300013297 Bacteria 10344
441 Ga0157378_10052129 3300013297 Bacteria 3640
442 Ga0163162_10000299 3300013306 Bacteria 45521
443 Ga0163162_10073048 3300013306 Bacteria 3485
444 Ga0163162_10079088 3300013306 Bacteria 3354
445 Ga0163162_10413061 3300013306 Bacteria 1482
446 Ga0157372_10000935 3300013307 Bacteria 31869
447 Ga0157372_10058538 3300013307 Bacteria 4307
448 Ga0157372_10126056 3300013307 Bacteria 2944
449 Ga0157372_10266146 3300013307 Bacteria 1991
450 Ga0157372_11266299 3300013307 Bacteria 851
451 Ga0157375_10000899 3300013308 Bacteria 25856
452 Ga0157375_10006083 3300013308 Bacteria 10527
453 Ga0157375_10048110 3300013308 Bacteria 4169
454 Ga0157375_10195276 3300013308 Bacteria 2179
455 Ga0163163_10000131 3300014325 Bacteria 76809
456 Ga0163163_10000454 3300014325 Bacteria 37347
457 Ga0163163_10002078 3300014325 Bacteria 16904
458 Ga0163163_10015746 3300014325 Bacteria 7002
459 Ga0163163_10018039 3300014325 Bacteria 6593
460 Ga0157379_10004164 3300014968 Bacteria 12347
461 Ga0157379_10020058 3300014968 Bacteria 5908
462 Ga0157379_10127824 3300014968 Bacteria 2287
463 Ga0157379_10248075 3300014968 Bacteria 1616
464 Ga0157379_10382250 3300014968 Bacteria 1292
465 Ga0157376_10049329 3300014969 Bacteria 3486
466 Ga0157376_10371368 3300014969 Bacteria 1375
467 Ga0206353_10924596 3300020082 Bacteria 2975
468 Ga0213876_10015334 3300021384 Bacteria 4057
469 Ga0207656_10008136 3300025321 Bacteria 3850
470 Ga0207656_10032454 3300025321 Bacteria 2169
471 Ga0207656_10073320 3300025321 Bacteria 1526
472 Ga0207642_10048829 3300025899 Bacteria 1899
473 Ga0207688_10083065 3300025901 Bacteria 1831
474 Ga0207688_10108255 3300025901 Bacteria 1611
475 Ga0207680_10000414 3300025903 Bacteria 20344
476 Ga0207680_10002206 3300025903 Bacteria 9097
477 Ga0207680_10002981 3300025903 Bacteria 7936
478 Ga0207680_10084040 3300025903 Bacteria 2007
479 Ga0207680_10234540 3300025903 Bacteria 1262
480 Ga0207680_10318108 3300025903 Bacteria 1088
481 Ga0207647_10001021 3300025904 Bacteria 21752
482 Ga0207647_10001917 3300025904 Bacteria 15905
483 Ga0207647_10009229 3300025904 Bacteria 7015
484 Ga0207647_10013750 3300025904 Bacteria 5604
485 Ga0207647_10018310 3300025904 Bacteria 4741
486 Ga0207647_10047441 3300025904 Bacteria 2672
487 Ga0207647_10086655 3300025904 Bacteria 1871
488 Ga0207699_10594291 3300025906 Bacteria 806
489 Ga0207645_10018254 3300025907 Bacteria 4620
490 Ga0207645_10020201 3300025907 Bacteria 4362
491 Ga0207645_10316344 3300025907 Bacteria 1041
492 Ga0207705_10000067 3300025909 Bacteria 136004
493 Ga0207705_10000137 3300025909 Bacteria 79174
494 Ga0207705_10005814 3300025909 Bacteria 9186
495 Ga0207705_10012658 3300025909 Bacteria 6088
496 Ga0207705_10023252 3300025909 Bacteria 4423
497 Ga0207705_10025067 3300025909 Bacteria 4257
498 Ga0207705_10025984 3300025909 Bacteria 4178
499 Ga0207705_10040426 3300025909 Bacteria 3345
500 Ga0207705_10059582 3300025909 Bacteria 2756
501 Ga0207705_10123817 3300025909 Bacteria 1920
502 Ga0207705_10324451 3300025909 Bacteria 1183
503 Ga0207705_10564440 3300025909 Bacteria 885
504 Ga0207654_10206123 3300025911 Bacteria 1297
505 Ga0207654_10220681 3300025911 Bacteria 1257
506 Ga0207654_10285523 3300025911 Bacteria 1117
507 Ga0207707_10006775 3300025912 Bacteria 9998
508 Ga0207707_10010860 3300025912 Bacteria 7915
509 Ga0207707_10019444 3300025912 Bacteria 5929
510 Ga0207707_10108742 3300025912 Bacteria 2424
511 Ga0207707_10837181 3300025912 Bacteria 764
512 Ga0207695_10009541 3300025913 Bacteria 12001
513 Ga0207695_10526519 3300025913 Bacteria 1064
514 Ga0207671_10054587 3300025914 Bacteria 2960
515 Ga0207693_10211480 3300025915 Bacteria 1524
516 Ga0207660_10001083 3300025917 Bacteria 18137
517 Ga0207660_10005519 3300025917 Bacteria 8214
518 Ga0207660_10011564 3300025917 Bacteria 5751
519 Ga0207660_10377031 3300025917 Bacteria 1140
520 Ga0207662_10108208 3300025918 Bacteria 1730
521 Ga0207657_10000508 3300025919 Bacteria 41139
522 Ga0207657_10000552 3300025919 Bacteria 39920
523 Ga0207657_10005670 3300025919 Bacteria 13029
524 Ga0207657_10007657 3300025919 Bacteria 11050
525 Ga0207657_10008334 3300025919 Bacteria 10536
526 Ga0207657_10008510 3300025919 Bacteria 10406
527 Ga0207657_10011257 3300025919 Bacteria 8889
528 Ga0207657_10012422 3300025919 Bacteria 8413
529 Ga0207657_10015848 3300025919 Bacteria 7283
530 Ga0207657_10016686 3300025919 Bacteria 7077
531 Ga0207657_10040350 3300025919 Bacteria 4136
532 Ga0207657_10062963 3300025919 Bacteria 3174
533 Ga0207657_10083267 3300025919 Bacteria 2684
534 Ga0207657_10084786 3300025919 Bacteria 2655
535 Ga0207657_10126264 3300025919 Bacteria 2101
536 Ga0207657_10171175 3300025919 Bacteria 1759
537 Ga0207657_10365349 3300025919 Bacteria 1137
538 Ga0207649_10000186 3300025920 Bacteria 50868
539 Ga0207649_10002647 3300025920 Bacteria 9940
540 Ga0207649_10003998 3300025920 Bacteria 8033
541 Ga0207649_10012646 3300025920 Bacteria 4689
542 Ga0207649_10028135 3300025920 Bacteria 3308
543 Ga0207649_10029033 3300025920 Bacteria 3263
544 Ga0207649_10038861 3300025920 Bacteria 2883
545 Ga0207649_10084190 3300025920 Bacteria 2067
546 Ga0207649_10136349 3300025920 Bacteria 1674
547 Ga0207649_10236108 3300025920 Unclassified 1310
548 Ga0207649_10297436 3300025920 Bacteria 1179
549 Ga0207649_10300511 3300025920 Bacteria 1173
550 Ga0207649_10307540 3300025920 Bacteria 1161
551 Ga0207652_10000058 3300025921 Bacteria 113620
552 Ga0207652_10019707 3300025921 Bacteria 5549
553 Ga0207652_10035429 3300025921 Bacteria 4212
554 Ga0207652_10047689 3300025921 Bacteria 3660
555 Ga0207652_10053467 3300025921 Bacteria 3469
556 Ga0207652_10328066 3300025921 Bacteria 1382
557 Ga0207681_10008567 3300025923 Bacteria 6245
558 Ga0207681_10015190 3300025923 Bacteria 4801
559 Ga0207681_10097374 3300025923 Bacteria 2114
560 Ga0207681_10106372 3300025923 Bacteria 2033
561 Ga0207681_10106767 3300025923 Bacteria 2030
562 Ga0207681_10255683 3300025923 Unclassified 1369
563 Ga0207681_10316270 3300025923 Bacteria 1240
564 Ga0207681_10576014 3300025923 Unclassified 928
565 Ga0207694_10001654 3300025924 Bacteria 18731
566 Ga0207694_10012683 3300025924 Bacteria 6350
567 Ga0207650_10007663 3300025925 Bacteria 7354
568 Ga0207650_10033138 3300025925 Bacteria 3739
569 Ga0207650_10062488 3300025925 Bacteria 2782
570 Ga0207650_10068384 3300025925 Bacteria 2667
571 Ga0207650_10073837 3300025925 Bacteria 2570
572 Ga0207650_10485875 3300025925 Bacteria 1031
573 Ga0207650_10549435 3300025925 Bacteria 968
574 Ga0207659_10021746 3300025926 Bacteria 4263
575 Ga0207659_10117761 3300025926 Bacteria 2030
576 Ga0207659_10171437 3300025926 Bacteria 1712
577 Ga0207659_10339815 3300025926 Bacteria 1243
578 Ga0207700_10029985 3300025928 Bacteria 3846
579 Ga0207700_10056423 3300025928 Bacteria 2957
580 Ga0207700_10553957 3300025928 Bacteria 1021
581 Ga0207664_10016664 3300025929 Bacteria 5366
582 Ga0207664_10035002 3300025929 Bacteria 3872
583 Ga0207664_10060954 3300025929 Bacteria 3009
584 Ga0207664_10272385 3300025929 Bacteria 1483
585 Ga0207644_10000484 3300025931 Bacteria 25592
586 Ga0207644_10007648 3300025931 Bacteria 7046
587 Ga0207644_10014676 3300025931 Bacteria 5248
588 Ga0207644_10030209 3300025931 Bacteria 3765
589 Ga0207644_10275900 3300025931 Bacteria 1349
590 Ga0207644_10587686 3300025931 Unclassified 924
591 Ga0207644_10816753 3300025931 Bacteria 780
592 Ga0207690_10000573 3300025932 Bacteria 24058
593 Ga0207690_10002248 3300025932 Bacteria 11780
594 Ga0207690_10006556 3300025932 Bacteria 6903
595 Ga0207690_10012443 3300025932 Bacteria 5089
596 Ga0207690_10031417 3300025932 Bacteria 3397
597 Ga0207690_10057663 3300025932 Bacteria 2624
598 Ga0207690_10115297 3300025932 Bacteria 1941
599 Ga0207690_10152614 3300025932 Bacteria 1714
600 Ga0207690_10287579 3300025932 Bacteria 1282
601 Ga0207690_10660007 3300025932 Bacteria 857
602 Ga0207690_10884466 3300025932 Bacteria 740
603 Ga0207706_10000514 3300025933 Bacteria 41167
604 Ga0207706_10002779 3300025933 Bacteria 17021
605 Ga0207706_10004258 3300025933 Bacteria 13468
606 Ga0207706_10010427 3300025933 Bacteria 8490
607 Ga0207706_10022035 3300025933 Bacteria 5718
608 Ga0207706_10026954 3300025933 Bacteria 5141
609 Ga0207706_10040824 3300025933 Bacteria 4113
610 Ga0207706_10056403 3300025933 Bacteria 3464
611 Ga0207706_10069353 3300025933 Bacteria 3101
612 Ga0207706_10075941 3300025933 Bacteria 2956
613 Ga0207706_10103739 3300025933 Bacteria 2502
614 Ga0207706_10113753 3300025933 Bacteria 2380
615 Ga0207706_10119061 3300025933 Bacteria 2322
616 Ga0207706_10202299 3300025933 Bacteria 1742
617 Ga0207686_10026306 3300025934 Bacteria 3393
618 Ga0207686_10204828 3300025934 Bacteria 1415
619 Ga0207709_10215973 3300025935 Bacteria 1380
620 Ga0207669_10012758 3300025937 Bacteria 4144
621 Ga0207669_10013281 3300025937 Bacteria 4084
622 Ga0207669_10186020 3300025937 Bacteria 1494
623 Ga0207669_10334802 3300025937 Bacteria 1163
624 Ga0207704_10114291 3300025938 Bacteria 1832
625 Ga0207704_10458614 3300025938 Bacteria 1019
626 Ga0207704_10800165 3300025938 Bacteria 787
627 Ga0207665_10055571 3300025939 Bacteria 2671
628 Ga0207691_10002265 3300025940 Bacteria 18850
629 Ga0207691_10048094 3300025940 Bacteria 3912
630 Ga0207691_10072556 3300025940 Bacteria 3105
631 Ga0207691_10089768 3300025940 Bacteria 2755
632 Ga0207691_10157228 3300025940 Bacteria 1996
633 Ga0207711_10000153 3300025941 Bacteria 73814
634 Ga0207711_10000413 3300025941 Bacteria 45274
635 Ga0207711_10002223 3300025941 Bacteria 17419
636 Ga0207711_10003216 3300025941 Bacteria 14231
637 Ga0207711_10070657 3300025941 Bacteria 3028
638 Ga0207711_10081762 3300025941 Bacteria 2823
639 Ga0207711_10163025 3300025941 Bacteria 2019
640 Ga0207711_10672398 3300025941 Bacteria 966
641 Ga0207689_10026321 3300025942 Bacteria 4870
642 Ga0207689_10041871 3300025942 Bacteria 3789
643 Ga0207689_10088205 3300025942 Bacteria 2548
644 Ga0207689_10332480 3300025942 Bacteria 1262
645 Ga0207689_10353851 3300025942 Bacteria 1221
646 Ga0207661_10000315 3300025944 Bacteria 30884
647 Ga0207661_10002683 3300025944 Bacteria 12245
648 Ga0207661_10004639 3300025944 Bacteria 9629
649 Ga0207661_10064809 3300025944 Bacteria 2964
650 Ga0207661_10561757 3300025944 Bacteria 1046
651 Ga0207661_11008335 3300025944 Bacteria 767
652 Ga0207679_10000114 3300025945 Bacteria 64628
653 Ga0207679_10014472 3300025945 Bacteria 5190
654 Ga0207679_10017044 3300025945 Bacteria 4834
655 Ga0207679_10021743 3300025945 Bacteria 4355
656 Ga0207679_10029274 3300025945 Bacteria 3833
657 Ga0207679_10031468 3300025945 Bacteria 3713
658 Ga0207679_10056267 3300025945 Bacteria 2903
659 Ga0207679_10269798 3300025945 Bacteria 1455
660 Ga0207679_10643824 3300025945 Bacteria 958
661 Ga0207667_10003951 3300025949 Bacteria 18243
662 Ga0207667_10009848 3300025949 Bacteria 11229
663 Ga0207667_10020116 3300025949 Bacteria 7432
664 Ga0207667_10038174 3300025949 Bacteria 5130
665 Ga0207667_10041796 3300025949 Bacteria 4874
666 Ga0207667_10049290 3300025949 Bacteria 4448
667 Ga0207667_10100751 3300025949 Bacteria 2980
668 Ga0207667_10100903 3300025949 Bacteria 2977
669 Ga0207667_10226131 3300025949 Bacteria 1917
670 Ga0207667_10737788 3300025949 Bacteria 985
671 Ga0207651_10001046 3300025960 Bacteria 12258
672 Ga0207651_10027155 3300025960 Bacteria 3591
673 Ga0207651_10034642 3300025960 Bacteria 3272
674 Ga0207651_10043936 3300025960 Bacteria 2986
675 Ga0207651_10067734 3300025960 Bacteria 2513
676 Ga0207651_10113790 3300025960 Bacteria 2037
677 Ga0207651_10122520 3300025960 Bacteria 1974
678 Ga0207651_10206137 3300025960 Bacteria 1579
679 Ga0207651_10268786 3300025960 Bacteria 1403
680 Ga0207651_10323651 3300025960 Bacteria 1289
681 Ga0207651_10395100 3300025960 Bacteria 1175
682 Ga0207712_10000783 3300025961 Bacteria 23699
683 Ga0207712_10021438 3300025961 Bacteria 4242
684 Ga0207712_10055413 3300025961 Bacteria 2789
685 Ga0207668_10000321 3300025972 Bacteria 31112
686 Ga0207668_10031756 3300025972 Bacteria 3483
687 Ga0207668_10078198 3300025972 Bacteria 2388
688 Ga0207668_10189717 3300025972 Bacteria 1628
689 Ga0207668_10276449 3300025972 Bacteria 1375
690 Ga0207668_10467844 3300025972 Bacteria 1079
691 Ga0207640_10005516 3300025981 Bacteria 6895
692 Ga0207640_10006787 3300025981 Bacteria 6296
693 Ga0207640_10017516 3300025981 Bacteria 4194
694 Ga0207640_10033972 3300025981 Bacteria 3179
695 Ga0207640_10040456 3300025981 Bacteria 2957
696 Ga0207640_10041470 3300025981 Bacteria 2928
697 Ga0207640_10061654 3300025981 Bacteria 2485
698 Ga0207640_10130605 3300025981 Bacteria 1815
699 Ga0207640_10194925 3300025981 Bacteria 1530
700 Ga0207640_10222762 3300025981 Bacteria 1445
701 Ga0207640_10261340 3300025981 Bacteria 1349
702 Ga0207640_10415517 3300025981 Bacteria 1099
703 Ga0207640_10782857 3300025981 Bacteria 825
704 Ga0207658_10001832 3300025986 Bacteria 15917
705 Ga0207658_10004856 3300025986 Bacteria 9286
706 Ga0207658_10005868 3300025986 Bacteria 8396
707 Ga0207658_10008440 3300025986 Bacteria 7012
708 Ga0207658_10012599 3300025986 Bacteria 5773
709 Ga0207658_10018055 3300025986 Bacteria 4865
710 Ga0207658_10049529 3300025986 Bacteria 3087
711 Ga0207658_10217295 3300025986 Bacteria 1606
712 Ga0207658_10486010 3300025986 Bacteria 1098
713 Ga0207677_10058044 3300026023 Bacteria 2662
714 Ga0207677_10153343 3300026023 Bacteria 1781
715 Ga0207677_10208581 3300026023 Bacteria 1558
716 Ga0207677_10704192 3300026023 Bacteria 896
717 Ga0207677_10706992 3300026023 Bacteria 895
718 Ga0207677_10984770 3300026023 Bacteria 764
719 Ga0207703_10006321 3300026035 Bacteria 9470
720 Ga0207703_10009327 3300026035 Bacteria 7711
721 Ga0207703_10036759 3300026035 Bacteria 3899
722 Ga0207703_10200644 3300026035 Bacteria 1773
723 Ga0207703_10533017 3300026035 Bacteria 1106
724 Ga0207639_10000139 3300026041 Bacteria 54240
725 Ga0207639_10001196 3300026041 Bacteria 17619
726 Ga0207639_10001867 3300026041 Bacteria 14169
727 Ga0207639_10027955 3300026041 Bacteria 4113
728 Ga0207639_10037135 3300026041 Bacteria 3616
729 Ga0207639_10057265 3300026041 Bacteria 2992
730 Ga0207639_10057992 3300026041 Bacteria 2976
731 Ga0207639_10058008 3300026041 Bacteria 2976
732 Ga0207639_10107184 3300026041 Bacteria 2269
733 Ga0207639_10139423 3300026041 Bacteria 2018
734 Ga0207639_10162335 3300026041 Bacteria 1884
735 Ga0207639_10291528 3300026041 Bacteria 1439
736 Ga0207639_10412519 3300026041 Bacteria 1219
737 Ga0207639_10947836 3300026041 Bacteria 805
738 Ga0207678_10000278 3300026067 Bacteria 46335
739 Ga0207678_10002094 3300026067 Bacteria 18070
740 Ga0207678_10005457 3300026067 Bacteria 11373
741 Ga0207678_10007933 3300026067 Bacteria 9361
742 Ga0207678_10008682 3300026067 Bacteria 8948
743 Ga0207678_10022613 3300026067 Bacteria 5506
744 Ga0207678_10097558 3300026067 Bacteria 2512
745 Ga0207678_10159456 3300026067 Bacteria 1927
746 Ga0207678_10217580 3300026067 Bacteria 1635
747 Ga0207678_10222814 3300026067 Bacteria 1615
748 Ga0207678_10319388 3300026067 Bacteria 1336
749 Ga0207678_10440328 3300026067 Bacteria 1132
750 Ga0207702_10004645 3300026078 Bacteria 12143
751 Ga0207702_10037724 3300026078 Bacteria 4046
752 Ga0207702_10302149 3300026078 Bacteria 1519
753 Ga0207702_10362829 3300026078 Bacteria 1389
754 Ga0207702_10369590 3300026078 Bacteria 1376
755 Ga0207702_10428897 3300026078 Bacteria 1280
756 Ga0207702_10444013 3300026078 Bacteria 1258
757 Ga0207702_10449232 3300026078 Bacteria 1250
758 Ga0207641_10000205 3300026088 Bacteria 78692
759 Ga0207641_10011259 3300026088 Bacteria 7336
760 Ga0207641_10013936 3300026088 Bacteria 6593
761 Ga0207641_10025660 3300026088 Bacteria 4858
762 Ga0207641_10027415 3300026088 Bacteria 4704
763 Ga0207641_10429437 3300026088 Bacteria 1273
764 Ga0207641_11123964 3300026088 Bacteria 784
765 Ga0207648_10004221 3300026089 Bacteria 14847
766 Ga0207648_10011323 3300026089 Bacteria 8405
767 Ga0207648_10032415 3300026089 Bacteria 4614
768 Ga0207648_10070048 3300026089 Bacteria 3057
769 Ga0207648_10432414 3300026089 Bacteria 1196
770 Ga0207676_10012769 3300026095 Bacteria 6027
771 Ga0207676_10031329 3300026095 Bacteria 3999
772 Ga0207676_10238815 3300026095 Bacteria 1629
773 Ga0207676_10460416 3300026095 Bacteria 1201
774 Ga0207674_10002900 3300026116 Bacteria 21307
775 Ga0207674_10005766 3300026116 Bacteria 14688
776 Ga0207674_10022143 3300026116 Bacteria 6830
777 Ga0207674_10023506 3300026116 Bacteria 6600
778 Ga0207674_10028640 3300026116 Bacteria 5875
779 Ga0207674_10041206 3300026116 Bacteria 4777
780 Ga0207674_10069348 3300026116 Bacteria 3546
781 Ga0207674_10090135 3300026116 Bacteria 3058
782 Ga0207674_10120062 3300026116 Bacteria 2597
783 Ga0207674_10457004 3300026116 Bacteria 1234
784 Ga0207674_10547299 3300026116 Bacteria 1118
785 Ga0207674_10895525 3300026116 Bacteria 855
786 Ga0207675_100026668 3300026118 Bacteria 5378
787 Ga0207683_10000721 3300026121 Bacteria 30084
788 Ga0207683_10003627 3300026121 Bacteria 13435
789 Ga0207683_10075932 3300026121 Bacteria 2975
790 Ga0207683_10339743 3300026121 Bacteria 1377
791 Ga0207683_10771481 3300026121 Bacteria 892
792 Ga0207698_10000921 3300026142 Bacteria 17113
793 Ga0207698_10004194 3300026142 Bacteria 8768
794 Ga0207698_10004557 3300026142 Bacteria 8460
795 Ga0207698_10049487 3300026142 Bacteria 3199
796 Ga0207698_10057016 3300026142 Bacteria 3019
797 Ga0207698_10082333 3300026142 Bacteria 2601
798 Ga0207698_10141595 3300026142 Bacteria 2073
799 Ga0207698_10271694 3300026142 Bacteria 1563
800 Ga0207698_10288834 3300026142 Bacteria 1521
801 Ga0207698_10349038 3300026142 Bacteria 1397
802 Ga0207698_10508649 3300026142 Bacteria 1173
803 Ga0268266_10000200 3300028379 Bacteria 104456
804 Ga0268266_10010037 3300028379 Bacteria 8306
805 Ga0268266_10020207 3300028379 Bacteria 5677
806 Ga0268266_10082753 3300028379 Bacteria 2800
807 Ga0268266_10117276 3300028379 Bacteria 2365
808 Ga0268266_10119878 3300028379 Bacteria 2340
809 Ga0268266_10124985 3300028379 Bacteria 2294
810 Ga0268266_10248552 3300028379 Bacteria 1644
811 Ga0268266_10849660 3300028379 Bacteria 882
812 Ga0268265_10003672 3300028380 Bacteria 10945
813 Ga0268265_10012876 3300028380 Bacteria 5677
814 Ga0268265_10035629 3300028380 Bacteria 3638
815 Ga0268265_10063339 3300028380 Bacteria 2844
816 Ga0268265_10067819 3300028380 Bacteria 2763
817 Ga0268265_10614335 3300028380 Unclassified 1040
818 Ga0268264_10000268 3300028381 Bacteria 91477
819 Ga0268264_10001019 3300028381 Bacteria 28201
820 Ga0268264_10009700 3300028381 Bacteria 7974
821 Ga0268264_10046258 3300028381 Bacteria 3614
822 Ga0268264_10097653 3300028381 Bacteria 2546
823 Ga0268264_10154044 3300028381 Bacteria 2063
824 Ga0268264_10215273 3300028381 Bacteria 1766
825 Ga0268264_10675521 3300028381 Bacteria 1024
826 Ga0307408_100008024 3300031548 Bacteria 6980
827 Ga0307408_100107366 3300031548 Bacteria 2137
828 Ga0307408_100436288 3300031548 Bacteria 1133
829 Ga0307408_100509764 3300031548 Bacteria 1055
830 Ga0307408_100619995 3300031548 Bacteria 963
831 Ga0307405_10010914 3300031731 Bacteria 4736
832 Ga0307405_10039098 3300031731 Bacteria 2865
833 Ga0307405_10137435 3300031731 Bacteria 1698
834 Ga0307405_10211065 3300031731 Bacteria 1417
835 Ga0307405_10225911 3300031731 Bacteria 1377
836 Ga0307405_10323284 3300031731 Bacteria 1179
837 Ga0307413_10004386 3300031824 Bacteria 6134
838 Ga0307413_10055299 3300031824 Bacteria 2414
839 Ga0307413_10083204 3300031824 Bacteria 2058
840 Ga0307413_10190698 3300031824 Bacteria 1471
841 Ga0307413_10317463 3300031824 Bacteria 1189
842 Ga0307410_10001234 3300031852 Bacteria 11363
843 Ga0307410_10003285 3300031852 Bacteria 8077
844 Ga0307410_10017685 3300031852 Bacteria 4289
845 Ga0307410_10022720 3300031852 Bacteria 3883
846 Ga0307410_10075059 3300031852 Bacteria 2356
847 Ga0307410_10114774 3300031852 Bacteria 1954
848 Ga0307410_10274096 3300031852 Bacteria 1321
849 Ga0307410_10356375 3300031852 Bacteria 1170
850 Ga0307410_10466246 3300031852 Bacteria 1033
851 Ga0307410_10537495 3300031852 Bacteria 967
852 Ga0307410_10689413 3300031852 Bacteria 860
853 Ga0307406_10092100 3300031901 Bacteria 2043
854 Ga0307406_10099830 3300031901 Bacteria 1974
855 Ga0307406_10102773 3300031901 Bacteria 1950
856 Ga0307406_10228204 3300031901 Unclassified 1389
857 Ga0307407_10000601 3300031903 Bacteria 11445
858 Ga0307407_10047365 3300031903 Bacteria 2439
859 Ga0307407_10066499 3300031903 Bacteria 2126
860 Ga0307407_10066863 3300031903 Bacteria 2122
861 Ga0307407_10390887 3300031903 Bacteria 995
862 Ga0307412_10053139 3300031911 Bacteria 2684
863 Ga0307412_10152429 3300031911 Bacteria 1707
864 Ga0307412_10204448 3300031911 Bacteria 1502
865 Ga0307412_10296002 3300031911 Bacteria 1277
866 Ga0307412_10305428 3300031911 Bacteria 1259
867 Ga0307412_10539273 3300031911 Bacteria 978
868 Ga0307409_100007302 3300031995 Bacteria 6599
869 Ga0307409_100008220 3300031995 Bacteria 6314
870 Ga0307409_100011973 3300031995 Bacteria 5502
871 Ga0307409_100028940 3300031995 Bacteria 3956
872 Ga0307409_100038514 3300031995 Bacteria 3537
873 Ga0307409_100039079 3300031995 Bacteria 3517
874 Ga0307409_100079958 3300031995 Bacteria 2636
875 Ga0307409_100250575 3300031995 Bacteria 1619
876 Ga0307416_100001982 3300032002 Bacteria 11481
877 Ga0307416_100004831 3300032002 Bacteria 8197
878 Ga0307416_100014946 3300032002 Bacteria 5341
879 Ga0307416_100035122 3300032002 Bacteria 3824
880 Ga0307416_100200149 3300032002 Bacteria 1894
881 Ga0307414_10003009 3300032004 Bacteria 8937
882 Ga0307414_10012388 3300032004 Bacteria 5040
883 Ga0307414_10015959 3300032004 Bacteria 4551
884 Ga0307414_10054411 3300032004 Bacteria 2797
885 Ga0307414_10074174 3300032004 Bacteria 2464
886 Ga0307414_10135153 3300032004 Bacteria 1921
887 Ga0307414_10156175 3300032004 Bacteria 1806
888 Ga0307414_10295292 3300032004 Bacteria 1368
889 Ga0307411_10019133 3300032005 Bacteria 3947
890 Ga0307411_10130092 3300032005 Bacteria 1838
891 Ga0307411_10151190 3300032005 Bacteria 1725
892 Ga0307411_10173703 3300032005 Bacteria 1628
893 Ga0307411_10354081 3300032005 Bacteria 1198
894 Ga0307415_100001273 3300032126 Bacteria 11868
895 Ga0307415_100019700 3300032126 Bacteria 4102
896 Ga0307415_100038314 3300032126 Bacteria 3158
897 Ga0307415_100285945 3300032126 Bacteria 1358
898 Ga0307415_100360177 3300032126 Bacteria 1228
899 Ga0307415_100398591 3300032126 Bacteria 1174
900 Ga0307415_100735484 3300032126 Bacteria 894
901 Ga0373958_0055702 3300034819 Bacteria 845
902 Ga0373959_0011664 3300034820 Bacteria 1556
903 Ga0373951_0073753 3300035091 Unclassified 873
904 Ga0373936_0213475 3300035113 Unclassified 854
905 Ga0373931_0024953 3300035691 Bacteria 3034
906 Ga0373937_0377847 3300036401 Bacteria 1344
907 Ga0395899_0000157 3300037312 Bacteria 103574
908 Ga0395899_0003036 3300037312 Bacteria 13401
909 Ga0395899_0004121 3300037312 Bacteria 11440
910 Ga0395899_0007337 3300037312 Bacteria 8526
911 Ga0395899_0025562 3300037312 Bacteria 4456
912 Ga0395899_0032658 3300037312 Bacteria 3911
913 Ga0395899_0035493 3300037312 Bacteria 3743
914 Ga0395899_0056928 3300037312 Bacteria 2888
915 Ga0395899_0058051 3300037312 Bacteria 2855
916 Ga0395899_0063664 3300037312 Bacteria 2712
917 Ga0395899_0065097 3300037312 Bacteria 2679
918 Ga0395899_0077458 3300037312 Bacteria 2425
919 Ga0395899_0082360 3300037312 Bacteria 2340
920 Ga0395899_0114710 3300037312 Bacteria 1934
921 Ga0395899_0115117 3300037312 Bacteria 1930
922 Ga0395899_0145837 3300037312 Bacteria 1681
923 Ga0395899_0253571 3300037312 Bacteria 1206
924 Ga0395899_0336264 3300037312 Bacteria 1013
925 Ga0395899_0411297 3300037312 Bacteria 893
926 Ga0395899_0426775 3300037312 Bacteria 872
927 Ga0395900_0000296 3300037418 Bacteria 74995
928 Ga0395900_0004777 3300037418 Bacteria 14277
929 Ga0395900_0006365 3300037418 Bacteria 12310
930 Ga0395900_0011590 3300037418 Bacteria 9022
931 Ga0395900_0015667 3300037418 Bacteria 7728
932 Ga0395900_0034052 3300037418 Bacteria 5243
933 Ga0395900_0034133 3300037418 Bacteria 5237
934 Ga0395900_0044771 3300037418 Bacteria 4559
935 Ga0395900_0046619 3300037418 Bacteria 4464
936 Ga0395900_0059434 3300037418 Bacteria 3935
937 Ga0395900_0066274 3300037418 Bacteria 3711
938 Ga0395900_0067966 3300037418 Bacteria 3661
939 Ga0395900_0088609 3300037418 Bacteria 3181
940 Ga0395900_0096098 3300037418 Bacteria 3044
941 Ga0395900_0105480 3300037418 Bacteria 2895
942 Ga0395900_0112079 3300037418 Bacteria 2801
943 Ga0395900_0132851 3300037418 Bacteria 2550
944 Ga0395900_0154330 3300037418 Bacteria 2345
945 Ga0395900_0158363 3300037418 Bacteria 2311
946 Ga0395900_0162554 3300037418 Bacteria 2277
947 Ga0395900_0181648 3300037418 Bacteria 2137
948 Ga0395900_0189088 3300037418 Bacteria 2089
949 Ga0395900_0204009 3300037418 Bacteria 1999
950 Ga0395900_0252884 3300037418 Bacteria 1763
951 Ga0395900_0388346 3300037418 Bacteria 1362
952 Ga0395900_0588928 3300037418 Bacteria 1054
953 Ga0395900_0703862 3300037418 Bacteria 943
954 Ga0395900_0892721 3300037418 Bacteria 812
955 Ga0395898_0000054 3300037466 Bacteria 279561
956 Ga0395898_0011440 3300037466 Bacteria 9216
957 Ga0395898_0014366 3300037466 Bacteria 8138
958 Ga0395898_0028332 3300037466 Bacteria 5613
959 Ga0395898_0032325 3300037466 Bacteria 5223
960 Ga0395898_0055783 3300037466 Bacteria 3854
961 Ga0395898_0070627 3300037466 Bacteria 3375
962 Ga0395898_0085318 3300037466 Bacteria 3043
963 Ga0395898_0161291 3300037466 Bacteria 2144
964 Ga0395898_0170518 3300037466 Bacteria 2080
965 Ga0395898_0196305 3300037466 Bacteria 1927
966 Ga0395898_0259402 3300037466 Bacteria 1658
967 Ga0395898_0276829 3300037466 Bacteria 1600
968 Ga0395898_0304393 3300037466 Bacteria 1520
969 Ga0395898_0552557 3300037466 Bacteria 1094
970 Ga0395905_0000046 3300037471 Bacteria 240463
971 Ga0395905_0000232 3300037471 Bacteria 84233
972 Ga0395905_0000464 3300037471 Bacteria 56406
973 Ga0395905_0000606 3300037471 Bacteria 48007
974 Ga0395905_0000897 3300037471 Bacteria 38814
975 Ga0395905_0011107 3300037471 Bacteria 8711
976 Ga0395905_0012624 3300037471 Bacteria 8126
977 Ga0395905_0015124 3300037471 Bacteria 7343
978 Ga0395905_0016443 3300037471 Bacteria 7032
979 Ga0395905_0017293 3300037471 Bacteria 6848
980 Ga0395905_0020751 3300037471 Bacteria 6221
981 Ga0395905_0021204 3300037471 Bacteria 6149
982 Ga0395905_0027028 3300037471 Bacteria 5411
983 Ga0395905_0032995 3300037471 Bacteria 4868
984 Ga0395905_0035133 3300037471 Bacteria 4706
985 Ga0395905_0041151 3300037471 Bacteria 4336
986 Ga0395905_0042840 3300037471 Bacteria 4246
987 Ga0395905_0051450 3300037471 Bacteria 3858
988 Ga0395905_0071488 3300037471 Bacteria 3252
989 Ga0395905_0072133 3300037471 Bacteria 3237
990 Ga0395905_0073338 3300037471 Bacteria 3208
991 Ga0395905_0080076 3300037471 Bacteria 3061
992 Ga0395905_0080391 3300037471 Bacteria 3054
993 Ga0395905_0091475 3300037471 Bacteria 2852
994 Ga0395905_0093487 3300037471 Bacteria 2820
995 Ga0395905_0098818 3300037471 Bacteria 2741
996 Ga0395905_0107993 3300037471 Bacteria 2613
997 Ga0395905_0110235 3300037471 Bacteria 2584
998 Ga0395905_0117167 3300037471 Bacteria 2503
999 Ga0395905_0146564 3300037471 Bacteria 2221
1000 Ga0395905_0195607 3300037471 Bacteria 1896
1001 Ga0395905_0202580 3300037471 Bacteria 1860
1002 Ga0395905_0221289 3300037471 Bacteria 1771
1003 Ga0395905_0227292 3300037471 Unclassified 1745
1004 Ga0395905_0262979 3300037471 Bacteria 1610
1005 Ga0395905_0275673 3300037471 Bacteria 1568
1006 Ga0395905_0279922 3300037471 Unclassified 1554
1007 Ga0395905_0347806 3300037471 Bacteria 1374
1008 Ga0395905_0398835 3300037471 Bacteria 1270
1009 Ga0395905_0415972 3300037471 Bacteria 1240
1010 Ga0395901_0000086 3300038443 Bacteria 125359
1011 Ga0395901_0000102 3300038443 Bacteria 115611
1012 Ga0395901_0001796 3300038443 Bacteria 22137
1013 Ga0395901_0003125 3300038443 Bacteria 16632
1014 Ga0395901_0008849 3300038443 Bacteria 10191
1015 Ga0395901_0018555 3300038443 Bacteria 7103
1016 Ga0395901_0027975 3300038443 Bacteria 5797
1017 Ga0395901_0028003 3300038443 Bacteria 5795
1018 Ga0395901_0036764 3300038443 Bacteria 5062
1019 Ga0395901_0037647 3300038443 Bacteria 5002
1020 Ga0395901_0046931 3300038443 Bacteria 4487
1021 Ga0395901_0056516 3300038443 Bacteria 4082
1022 Ga0395901_0057431 3300038443 Bacteria 4047
1023 Ga0395901_0062667 3300038443 Bacteria 3869
1024 Ga0395901_0066141 3300038443 Bacteria 3765
1025 Ga0395901_0070112 3300038443 Bacteria 3651
1026 Ga0395901_0076752 3300038443 Bacteria 3486
1027 Ga0395901_0111298 3300038443 Bacteria 2875
1028 Ga0395901_0282130 3300038443 Bacteria 1725
1029 Ga0395901_0311156 3300038443 Bacteria 1631
1030 Ga0395901_0315571 3300038443 Bacteria 1618
1031 Ga0395901_0455028 3300038443 Bacteria 1308
1032 Ga0395901_0462022 3300038443 Unclassified 1297
1033 Ga0395901_0476910 3300038443 Bacteria 1273
1034 Ga0395901_0503469 3300038443 Bacteria 1233
1035 Ga0395901_0581923 3300038443 Bacteria 1131
1036 Ga0395901_0872548 3300038443 Bacteria 883
1037 Ga0395901_0900542 3300038443 Bacteria 867
1038 Ga0436365_1796941 3300039437 Bacteria 5092
1039 Ga0436363_1607284 3300039450 Bacteria 3083
1040 Ga0439437_004915 3300042000 Bacteria 1465
1041 Ga0439432_030078 3300042006 Bacteria 1763
1042 Ga0439449_0011911 3300042007 Bacteria 3270
1043 Ga0450890_001948 3300042127 Bacteria 2917
1044 Ga0450889_000276 3300042144 Bacteria 5729
1045 Ga0439458_0000054 3300042157 Bacteria 19456
1046 Ga0439458_0046373 3300042157 Bacteria 1064
1047 Ga0439459_0047598 3300042438 Bacteria 932
1048 Ga0439464_0000134 3300042439 Bacteria 11888
1049 Ga0466969_0018980 3300044656 Bacteria 3579
1050 Ga0466969_0078060 3300044656 Bacteria 1584
1051 Ga0466965_0024613 3300044683 Bacteria 2913
1052 Ga0466966_0028795 3300044684 Bacteria 3616
1053 Ga0466961_0009140 3300044693 Bacteria 6311
1054 Ga0466961_0069930 3300044693 Bacteria 2228
1055 Ga0466961_0084487 3300044693 Bacteria 2007
1056 Ga0466961_0101201 3300044693 Bacteria 1815
1057 Ga0466961_0151606 3300044693 Bacteria 1447
1058 Ga0466961_0161164 3300044693 Bacteria 1398
1059 Ga0466963_0007523 3300044694 Bacteria 6498
1060 Ga0466963_0014690 3300044694 Bacteria 4832
1061 Ga0466963_0029599 3300044694 Bacteria 3526
1062 Ga0466963_0035498 3300044694 Bacteria 3248
1063 Ga0466963_0078373 3300044694 Bacteria 2233
1064 Ga0466963_0118625 3300044694 Bacteria 1820
1065 Ga0466963_0319679 3300044694 Bacteria 1092
1066 Ga0466963_0521682 3300044694 Bacteria 839
1067 Ga0466971_0006052 3300044719 Bacteria 5265
1068 Ga0466971_0077658 3300044719 Bacteria 1512
1069 Ga0466968_0025697 3300044735 Bacteria 2413
1070 Ga0466970_0022401 3300044765 Bacteria 3297
1071 Ga0466970_0213217 3300044765 Bacteria 1076
1072 Ga0466970_0303016 3300044765 Bacteria 901
1073 Ga0466957_0033575 3300044842 Bacteria 3078
1074 Ga0466957_0041073 3300044842 Bacteria 2797
1075 Ga0466957_0115418 3300044842 Bacteria 1707
1076 Ga0466960_0505717 3300044901 Bacteria 708
1077 Ga0466959_0027112 3300045049 Bacteria 4250
1078 Ga0466959_0038100 3300045049 Bacteria 3553
1079 Ga0466959_0221085 3300045049 Bacteria 1313
1080 Ga0466958_0051402 3300045836 Bacteria 2495
1081 Ga0466958_0157115 3300045836 Bacteria 1435
1082 Ga0466958_0238222 3300045836 Bacteria 1162
1083 Ga0466958_0277577 3300045836 Bacteria 1074
1084 Ga0466967_0001162 3300045976 Bacteria 14754
1085 Ga0466967_0004261 3300045976 Bacteria 9609
1086 Ga0466967_0036384 3300045976 Bacteria 4202
1087 Ga0466967_0050584 3300045976 Bacteria 3639
1088 Ga0466967_0061319 3300045976 Bacteria 3336
1089 Ga0466967_0062045 3300045976 Bacteria 3317
1090 Ga0466967_0067555 3300045976 Bacteria 3189
1091 Ga0466967_0072532 3300045976 Bacteria 3086
1092 Ga0466967_0079516 3300045976 Bacteria 2956
1093 Ga0466967_0188674 3300045976 Bacteria 1947
1094 Ga0466967_0192475 3300045976 Bacteria 1928
1095 Ga0466967_0206439 3300045976 Bacteria 1862
1096 Ga0466967_0218390 3300045976 Bacteria 1811
1097 Ga0466967_0366063 3300045976 Bacteria 1398
1098 Ga0466967_0567968 3300045976 Bacteria 1117
1099 Ga0466967_0586513 3300045976 Bacteria 1099
1100 Ga0495620_0055457 3300046515 Bacteria 1670
1101 Ga0495632_0096070 3300046519 Bacteria 1400
1102 Ga0495663_0007592 3300046525 Bacteria 3001
1103 Ga0495663_0009428 3300046525 Bacteria 2707
1104 Ga0495663_0012320 3300046525 Bacteria 2383
1105 Ga0495665_0379383 3300046531 Unclassified 718
1106 Ga0495598_0000126 3300046537 Bacteria 12859
1107 Ga0495598_0000656 3300046537 Bacteria 6539
1108 Ga0495621_0000263 3300046539 Bacteria 12532
1109 Ga0495621_0002183 3300046539 Bacteria 5209
1110 Ga0495633_0010443 3300046558 Bacteria 5065
1111 Ga0495668_0005317 3300046616 Bacteria 8795
1112 Ga0495668_0005930 3300046616 Bacteria 8121
1113 Ga0495625_0145210 3300046660 Bacteria 1598
1114 Ga0495661_0093076 3300046665 Bacteria 1711
1115 Ga0495669_0000648 3300046684 Bacteria 15172
1116 Ga0495669_0002450 3300046684 Bacteria 7578
1117 Ga0495669_0002758 3300046684 Bacteria 7208
1118 Ga0495669_0014555 3300046684 Bacteria 3362
1119 Ga0495669_0051824 3300046684 Bacteria 1842
1120 Ga0495669_0083743 3300046684 Bacteria 1466
1121 Ga0495670_0000419 3300046691 Bacteria 20409
1122 Ga0495670_0012796 3300046691 Bacteria 4125
1123 Ga0495677_0013546 3300047445 Bacteria 2968
1124 Ga0495677_0026987 3300047445 Bacteria 2083
1125 Ga0495677_0118573 3300047445 Bacteria 1008
1126 Ga0495686_0238050 3300047472 Bacteria 1028
1127 Ga0496100_0065909 3300048903 Bacteria 2401
1128 Ga0496100_0091671 3300048903 Bacteria 2074
1129 Ga0496100_0234176 3300048903 Bacteria 1352
1130 Ga0496101_0028347 3300048904 Bacteria 3908
1131 Ga0496101_0085300 3300048904 Bacteria 2340
1132 Ga0496102_0198371 3300048905 Bacteria 1892
1133 Ga0496102_0256078 3300048905 Bacteria 1650
1134 Ga0496103_0516647 3300048906 Bacteria 763
1135 Ga0496104_0036159 3300048907 Bacteria 4615
1136 Ga0496105_0018981 3300048908 Bacteria 5541
1137 Ga0496106_0080761 3300048909 Bacteria 2497
1138 Ga0496106_0189717 3300048909 Bacteria 1634
1139 Ga0496106_0209461 3300048909 Bacteria 1553
1140 Ga0496107_0009582 3300048910 Bacteria 6717
1141 Ga0496108_0001931 3300048911 Bacteria 16611
1142 Ga0496108_0003913 3300048911 Bacteria 11961
1143 Ga0496108_0011249 3300048911 Bacteria 7270
1144 Ga0496108_0055807 3300048911 Bacteria 3317
1145 Ga0496109_0008971 3300048912 Bacteria 8517
1146 Ga0496109_0011973 3300048912 Bacteria 7469
1147 Ga0496109_0122451 3300048912 Bacteria 2423
1148 Ga0496109_0255294 3300048912 Bacteria 1651
1149 Ga0496109_0366784 3300048912 Bacteria 1360
1150 Ga0496109_0661468 3300048912 Bacteria 982
1151 Ga0496109_0675370 3300048912 Bacteria 970
1152 Ga0496110_0182515 3300048913 Bacteria 1905
1153 Ga0496110_0238633 3300048913 Bacteria 1654
1154 Ga0496111_0003393 3300048914 Bacteria 9849
1155 Ga0496111_0021271 3300048914 Bacteria 4527
1156 Ga0496111_0382372 3300048914 Bacteria 1041
1157 Ga0496112_0014957 3300048915 Bacteria 7221
1158 Ga0496112_0027081 3300048915 Bacteria 5525
1159 Ga0496112_0058862 3300048915 Bacteria 3784
1160 Ga0496112_0059733 3300048915 Bacteria 3757
1161 Ga0496112_0065572 3300048915 Bacteria 3584
1162 Ga0496112_0143772 3300048915 Bacteria 2354
1163 Ga0496113_0004989 3300048916 Bacteria 8226
1164 Ga0496113_0007376 3300048916 Bacteria 7069
1165 Ga0496113_0777669 3300048916 Bacteria 761
1166 Ga0496114_0069099 3300048917 Bacteria 2966
1167 Ga0496114_0072442 3300048917 Bacteria 2898
1168 Ga0496115_0009603 3300048918 Bacteria 7193
1169 Ga0496115_0319383 3300048918 Bacteria 1270
1170 Ga0501067_0053315 3300049583 Bacteria 2241
1171 Ga0501068_0397539 3300049584 Bacteria 888
1172 Ga0501069_0419893 3300049585 Bacteria 793
1173 Ga0501080_0542700 3300049742 Bacteria 1036
1174 Ga0501270_011966 3300049767 Bacteria 1175
1175 nmdc:mga08y16_258887_c1 3300050511 Bacteria 1797
1176 nmdc:mga0n895_182265_c1 3300050512 Bacteria 2131
1177 nmdc:mga0rr50_254481_c1 3300050513 Bacteria 1459
1178 nmdc:mga0a205_4289_c1 3300050515 Bacteria 12798
1179 Ga0495655_0014309 3300053083 Bacteria 1661
1180 Ga0500658_0000032 3300053134 Bacteria 90863
1181 Ga0466962_0006718 3300061719 Bacteria 5515
1182 Ga0466962_0023990 3300061719 Bacteria 2932
1183 Ga0466962_0161841 3300061719 Bacteria 1088

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042157 Ga0439458_0046373 Ga0439458_0046373_13_612 199
2 3300044694 Ga0466963_0521682 Ga0466963_0521682_159_815 199
3 3300045976 Ga0466967_0004261 Ga0466967_0004261_2230_2886 199
4 3300045836 Ga0466958_0277577 Ga0466958_0277577_128_784 201
5 3300005334 Ga0068869_100056572 Ga0068869_1000565722 203
6 3300005548 Ga0070665_100011993 Ga0070665_1000119935 203
7 3300025901 Ga0207688_10108255 Ga0207688_101082552 203
8 3300025942 Ga0207689_10332480 Ga0207689_103324801 203
9 3300025972 Ga0207668_10467844 Ga0207668_104678441 203
10 3300025986 Ga0207658_10217295 Ga0207658_102172953 203
11 3300028379 Ga0268266_10010037 Ga0268266_100100375 203
12 3300009177 Ga0105248_10005596 Ga0105248_100055965 204
13 3300048906 Ga0496103_0516647 Ga0496103_0516647_27_641 204
14 3300005614 Ga0068856_100199335 Ga0068856_1001993353 208
15 3300005616 Ga0068852_100009153 Ga0068852_1000091536 208
16 3300013102 Ga0157371_10044173 Ga0157371_100441735 208
17 3300013104 Ga0157370_10101433 Ga0157370_101014333 208
18 3300013105 Ga0157369_10031766 Ga0157369_100317663 208
19 3300026142 Ga0207698_10049487 Ga0207698_100494871 208
20 3300025903 Ga0207680_10000414 Ga0207680_1000041415 210
21 3300044765 Ga0466970_0303016 Ga0466970_0303016_107_769 211
22 3300046519 Ga0495632_0096070 Ga0495632_0096070_678_1319 213
23 3300046616 Ga0495668_0005317 Ga0495668_0005317_5873_6514 213
24 3300046660 Ga0495625_0145210 Ga0495625_0145210_38_679 213
25 3300046684 Ga0495669_0002450 Ga0495669_0002450_5534_6175 213
26 3300047472 Ga0495686_0238050 Ga0495686_0238050_232_873 213
27 3300053083 Ga0495655_0014309 Ga0495655_0014309_462_1103 213
28 3300005367 Ga0070667_100003487 Ga0070667_1000034878 214
29 3300005842 Ga0068858_100520494 Ga0068858_1005204942 214
30 3300009148 Ga0105243_10956851 Ga0105243_109568512 214
31 3300025941 Ga0207711_10003216 Ga0207711_1000321611 214
32 3300025986 Ga0207658_10008440 Ga0207658_100084406 214
33 3300026035 Ga0207703_10533017 Ga0207703_105330172 214
34 3300028381 Ga0268264_10675521 Ga0268264_106755212 214
35 3300047445 Ga0495677_0013546 Ga0495677_0013546_1301_1945 214
36 3300048909 Ga0496106_0209461 Ga0496106_0209461_293_937 214
37 3300048911 Ga0496108_0003913 Ga0496108_0003913_3504_4148 214
38 3300005328 Ga0070676_10170172 Ga0070676_101701722 216
39 3300005343 Ga0070687_100157580 Ga0070687_1001575802 216
40 3300005344 Ga0070661_100022375 Ga0070661_1000223754 216
41 3300005353 Ga0070669_100070402 Ga0070669_1000704022 216
42 3300005364 Ga0070673_100376156 Ga0070673_1003761561 216
43 3300005455 Ga0070663_100017911 Ga0070663_1000179114 216
44 3300005546 Ga0070696_100007107 Ga0070696_1000071071 216
45 3300005547 Ga0070693_100130176 Ga0070693_1001301761 216
46 3300005577 Ga0068857_100006167 Ga0068857_1000061672 216
47 3300005577 Ga0068857_100684415 Ga0068857_1006844151 216
48 3300005578 Ga0068854_100014644 Ga0068854_1000146445 216
49 3300005617 Ga0068859_100009943 Ga0068859_1000099436 216
50 3300005842 Ga0068858_100049547 Ga0068858_1000495474 216
51 3300005843 Ga0068860_100024302 Ga0068860_1000243024 216
52 3300005844 Ga0068862_100020001 Ga0068862_1000200016 216
53 3300005844 Ga0068862_100901640 Ga0068862_1009016402 216
54 3300006931 Ga0097620_100009944 Ga0097620_1000099446 216
55 3300009174 Ga0105241_10469093 Ga0105241_104690932 216
56 3300009177 Ga0105248_10143245 Ga0105248_101432453 216
57 3300009553 Ga0105249_10047537 Ga0105249_100475374 216
58 3300013100 Ga0157373_10039152 Ga0157373_100391523 216
59 3300025907 Ga0207645_10020201 Ga0207645_100202014 216
60 3300025911 Ga0207654_10285523 Ga0207654_102855232 216
61 3300025918 Ga0207662_10108208 Ga0207662_101082082 216
62 3300025920 Ga0207649_10084190 Ga0207649_100841903 216
63 3300025923 Ga0207681_10106372 Ga0207681_101063723 216
64 3300025925 Ga0207650_10068384 Ga0207650_100683844 216
65 3300025933 Ga0207706_10040824 Ga0207706_100408244 216
66 3300025935 Ga0207709_10215973 Ga0207709_102159732 216
67 3300025945 Ga0207679_10017044 Ga0207679_100170444 216
68 3300025960 Ga0207651_10395100 Ga0207651_103951001 216
69 3300025961 Ga0207712_10055413 Ga0207712_100554134 216
70 3300025981 Ga0207640_10006787 Ga0207640_100067872 216
71 3300025981 Ga0207640_10261340 Ga0207640_102613402 216
72 3300026035 Ga0207703_10200644 Ga0207703_102006442 216
73 3300026041 Ga0207639_10412519 Ga0207639_104125192 216
74 3300026067 Ga0207678_10008682 Ga0207678_100086824 216
75 3300026088 Ga0207641_10429437 Ga0207641_104294372 216
76 3300026095 Ga0207676_10012769 Ga0207676_100127694 216
77 3300026116 Ga0207674_10005766 Ga0207674_100057664 216
78 3300026116 Ga0207674_10069348 Ga0207674_100693484 216
79 3300026118 Ga0207675_100026668 Ga0207675_1000266684 216
80 3300028380 Ga0268265_10063339 Ga0268265_100633394 216
81 3300045976 Ga0466967_0067555 Ga0466967_0067555_1838_2488 216
82 3300005327 Ga0070658_10030570 Ga0070658_100305705 217
83 3300005337 Ga0070682_100391871 Ga0070682_1003918712 217
84 3300005339 Ga0070660_100040270 Ga0070660_1000402702 217
85 3300005339 Ga0070660_100269900 Ga0070660_1002699002 217
86 3300005344 Ga0070661_100068634 Ga0070661_1000686342 217
87 3300005366 Ga0070659_100026730 Ga0070659_1000267302 217
88 3300005459 Ga0068867_100058767 Ga0068867_1000587674 217
89 3300005539 Ga0068853_100116527 Ga0068853_1001165272 217
90 3300005548 Ga0070665_100047225 Ga0070665_1000472255 217
91 3300005564 Ga0070664_100958550 Ga0070664_1009585502 217
92 3300005578 Ga0068854_100060693 Ga0068854_1000606933 217
93 3300005578 Ga0068854_100073396 Ga0068854_1000733962 217
94 3300005614 Ga0068856_100273930 Ga0068856_1002739303 217
95 3300005616 Ga0068852_100115637 Ga0068852_1001156373 217
96 3300005616 Ga0068852_100171423 Ga0068852_1001714232 217
97 3300005618 Ga0068864_100607352 Ga0068864_1006073521 217
98 3300005834 Ga0068851_10009876 Ga0068851_100098764 217
99 3300005834 Ga0068851_10298467 Ga0068851_102984672 217
100 3300025321 Ga0207656_10008136 Ga0207656_100081362 217
101 3300025909 Ga0207705_10564440 Ga0207705_105644401 217
102 3300025919 Ga0207657_10016686 Ga0207657_100166863 217
103 3300025919 Ga0207657_10084786 Ga0207657_100847863 217
104 3300025920 Ga0207649_10297436 Ga0207649_102974362 217
105 3300025923 Ga0207681_10576014 Ga0207681_105760141 217
106 3300025933 Ga0207706_10075941 Ga0207706_100759414 217
107 3300025938 Ga0207704_10458614 Ga0207704_104586141 217
108 3300025945 Ga0207679_10031468 Ga0207679_100314683 217
109 3300025981 Ga0207640_10130605 Ga0207640_101306052 217
110 3300025981 Ga0207640_10194925 Ga0207640_101949252 217
111 3300026041 Ga0207639_10057992 Ga0207639_100579923 217
112 3300026089 Ga0207648_10032415 Ga0207648_100324156 217
113 3300026089 Ga0207648_10432414 Ga0207648_104324142 217
114 3300026142 Ga0207698_10057016 Ga0207698_100570164 217
115 3300026142 Ga0207698_10141595 Ga0207698_101415952 217
116 3300028379 Ga0268266_10119878 Ga0268266_101198782 217
117 3300028379 Ga0268266_10124985 Ga0268266_101249854 217
118 3300031548 Ga0307408_100436288 Ga0307408_1004362882 217
119 3300031731 Ga0307405_10039098 Ga0307405_100390984 217
120 3300031824 Ga0307413_10004386 Ga0307413_100043866 217
121 3300031852 Ga0307410_10022720 Ga0307410_100227203 217
122 3300031901 Ga0307406_10092100 Ga0307406_100921003 217
123 3300031903 Ga0307407_10000601 Ga0307407_100006016 217
124 3300031911 Ga0307412_10152429 Ga0307412_101524292 217
125 3300031995 Ga0307409_100039079 Ga0307409_1000390793 217
126 3300032002 Ga0307416_100001982 Ga0307416_1000019825 217
127 3300032004 Ga0307414_10012388 Ga0307414_100123884 217
128 3300032126 Ga0307415_100001273 Ga0307415_1000012733 217
129 3300037312 Ga0395899_0025562 Ga0395899_0025562_742_1395 217
130 3300037312 Ga0395899_0058051 Ga0395899_0058051_1777_2430 217
131 3300037418 Ga0395900_0034133 Ga0395900_0034133_1116_1769 217
132 3300037466 Ga0395898_0055783 Ga0395898_0055783_1597_2250 217
133 3300037466 Ga0395898_0276829 Ga0395898_0276829_425_1078 217
134 3300037471 Ga0395905_0016443 Ga0395905_0016443_2333_2986 217
135 3300037471 Ga0395905_0227292 Ga0395905_0227292_487_1140 217
136 3300038443 Ga0395901_0062667 Ga0395901_0062667_2591_3244 217
137 3300042006 Ga0439432_030078 Ga0439432_030078_43_696 217
138 3300042007 Ga0439449_0011911 Ga0439449_0011911_1491_2144 217
139 3300046525 Ga0495663_0007592 Ga0495663_0007592_1818_2471 217
140 3300046537 Ga0495598_0000656 Ga0495598_0000656_5337_5990 217
141 3300046539 Ga0495621_0000263 Ga0495621_0000263_9889_10542 217
142 3300046558 Ga0495633_0010443 Ga0495633_0010443_3155_3808 217
143 3300046665 Ga0495661_0093076 Ga0495661_0093076_657_1310 217
144 3300046684 Ga0495669_0000648 Ga0495669_0000648_12191_12844 217
145 3300046684 Ga0495669_0002758 Ga0495669_0002758_5329_5982 217
146 3300046691 Ga0495670_0012796 Ga0495670_0012796_1926_2579 217
147 3300047445 Ga0495677_0026987 Ga0495677_0026987_1390_2043 217
148 3300001915 JGI24741J21665_1000799 JGI24741J21665_10007998 218
149 3300001915 JGI24741J21665_1006384 JGI24741J21665_10063843 218
150 3300001976 JGI24752J21851_1008347 JGI24752J21851_10083472 218
151 3300001979 JGI24740J21852_10000953 JGI24740J21852_1000095312 218
152 3300001979 JGI24740J21852_10002998 JGI24740J21852_100029983 218
153 3300001979 JGI24740J21852_10064552 JGI24740J21852_100645521 218
154 3300001989 JGI24739J22299_10003826 JGI24739J22299_100038264 218
155 3300001989 JGI24739J22299_10009049 JGI24739J22299_100090493 218
156 3300001990 JGI24737J22298_10010275 JGI24737J22298_100102754 218
157 3300001990 JGI24737J22298_10020974 JGI24737J22298_100209742 218
158 3300002067 JGI24735J21928_10005733 JGI24735J21928_100057334 218
159 3300002067 JGI24735J21928_10006929 JGI24735J21928_100069294 218
160 3300002067 JGI24735J21928_10013014 JGI24735J21928_100130143 218
161 3300003323 rootH1_10067802 rootH1_100678022 218
162 3300005327 Ga0070658_10000177 Ga0070658_1000017710 218
163 3300005327 Ga0070658_10000256 Ga0070658_1000025610 218
164 3300005327 Ga0070658_10015902 Ga0070658_100159023 218
165 3300005327 Ga0070658_10070153 Ga0070658_100701532 218
166 3300005327 Ga0070658_10077630 Ga0070658_100776304 218
167 3300005327 Ga0070658_10090745 Ga0070658_100907453 218
168 3300005327 Ga0070658_10250564 Ga0070658_102505642 218
169 3300005327 Ga0070658_10314768 Ga0070658_103147682 218
170 3300005327 Ga0070658_10388791 Ga0070658_103887912 218
171 3300005327 Ga0070658_10624600 Ga0070658_106246001 218
172 3300005328 Ga0070676_10084458 Ga0070676_100844582 218
173 3300005328 Ga0070676_10087977 Ga0070676_100879772 218
174 3300005329 Ga0070683_100000686 Ga0070683_1000006869 218
175 3300005329 Ga0070683_100001183 Ga0070683_1000011835 218
176 3300005329 Ga0070683_100005397 Ga0070683_10000539710 218
177 3300005329 Ga0070683_100008667 Ga0070683_1000086678 218
178 3300005329 Ga0070683_100039165 Ga0070683_1000391652 218
179 3300005329 Ga0070683_100469592 Ga0070683_1004695921 218
180 3300005331 Ga0070670_100001825 Ga0070670_10000182512 218
181 3300005331 Ga0070670_100026971 Ga0070670_1000269713 218
182 3300005331 Ga0070670_100046810 Ga0070670_1000468104 218
183 3300005331 Ga0070670_100126985 Ga0070670_1001269853 218
184 3300005331 Ga0070670_100455436 Ga0070670_1004554362 218
185 3300005331 Ga0070670_100782452 Ga0070670_1007824521 218
186 3300005335 Ga0070666_10013662 Ga0070666_100136622 218
187 3300005335 Ga0070666_10053723 Ga0070666_100537232 218
188 3300005335 Ga0070666_10089819 Ga0070666_100898194 218
189 3300005335 Ga0070666_10118427 Ga0070666_101184272 218
190 3300005336 Ga0070680_100000105 Ga0070680_10000010549 218
191 3300005337 Ga0070682_100149061 Ga0070682_1001490612 218
192 3300005338 Ga0068868_100022216 Ga0068868_1000222165 218
193 3300005338 Ga0068868_100072424 Ga0068868_1000724242 218
194 3300005338 Ga0068868_100076037 Ga0068868_1000760374 218
195 3300005338 Ga0068868_100218594 Ga0068868_1002185942 218
196 3300005338 Ga0068868_100307312 Ga0068868_1003073122 218
197 3300005338 Ga0068868_100366338 Ga0068868_1003663382 218
198 3300005339 Ga0070660_100000064 Ga0070660_10000006443 218
199 3300005339 Ga0070660_100000065 Ga0070660_1000000659 218
200 3300005339 Ga0070660_100007019 Ga0070660_1000070195 218
201 3300005339 Ga0070660_100015669 Ga0070660_1000156696 218
202 3300005339 Ga0070660_100043765 Ga0070660_1000437652 218
203 3300005339 Ga0070660_100135043 Ga0070660_1001350432 218
204 3300005339 Ga0070660_100197196 Ga0070660_1001971962 218
205 3300005339 Ga0070660_100406815 Ga0070660_1004068152 218
206 3300005339 Ga0070660_100640525 Ga0070660_1006405252 218
207 3300005341 Ga0070691_10000496 Ga0070691_100004968 218
208 3300005341 Ga0070691_10173591 Ga0070691_101735912 218
209 3300005344 Ga0070661_100001118 Ga0070661_10000111811 218
210 3300005344 Ga0070661_100008218 Ga0070661_1000082185 218
211 3300005344 Ga0070661_100008646 Ga0070661_1000086462 218
212 3300005344 Ga0070661_100016702 Ga0070661_1000167024 218
213 3300005344 Ga0070661_100022325 Ga0070661_1000223251 218
214 3300005344 Ga0070661_100023580 Ga0070661_1000235804 218
215 3300005344 Ga0070661_100033941 Ga0070661_1000339412 218
216 3300005344 Ga0070661_100181256 Ga0070661_1001812561 218
217 3300005344 Ga0070661_100306040 Ga0070661_1003060402 218
218 3300005345 Ga0070692_10007696 Ga0070692_100076963 218
219 3300005353 Ga0070669_100256928 Ga0070669_1002569282 218
220 3300005354 Ga0070675_100123993 Ga0070675_1001239933 218
221 3300005354 Ga0070675_100292059 Ga0070675_1002920592 218
222 3300005355 Ga0070671_100000918 Ga0070671_10000091820 218
223 3300005355 Ga0070671_100018172 Ga0070671_1000181725 218
224 3300005355 Ga0070671_100022379 Ga0070671_1000223796 218
225 3300005355 Ga0070671_100542431 Ga0070671_1005424312 218
226 3300005355 Ga0070671_100591897 Ga0070671_1005918971 218
227 3300005355 Ga0070671_100666802 Ga0070671_1006668022 218
228 3300005356 Ga0070674_100017382 Ga0070674_1000173825 218
229 3300005356 Ga0070674_100022798 Ga0070674_1000227984 218
230 3300005356 Ga0070674_100047680 Ga0070674_1000476803 218
231 3300005356 Ga0070674_100740742 Ga0070674_1007407421 218
232 3300005364 Ga0070673_100000158 Ga0070673_1000001582 218
233 3300005364 Ga0070673_100001256 Ga0070673_10000125615 218
234 3300005364 Ga0070673_100251219 Ga0070673_1002512192 218
235 3300005364 Ga0070673_100358722 Ga0070673_1003587222 218
236 3300005366 Ga0070659_100002462 Ga0070659_10000246211 218
237 3300005366 Ga0070659_100010839 Ga0070659_1000108394 218
238 3300005366 Ga0070659_100016167 Ga0070659_1000161671 218
239 3300005366 Ga0070659_100019741 Ga0070659_1000197416 218
240 3300005366 Ga0070659_100042884 Ga0070659_1000428844 218
241 3300005366 Ga0070659_100085013 Ga0070659_1000850131 218
242 3300005366 Ga0070659_100179020 Ga0070659_1001790202 218
243 3300005366 Ga0070659_100184284 Ga0070659_1001842842 218
244 3300005366 Ga0070659_100251732 Ga0070659_1002517322 218
245 3300005366 Ga0070659_100943469 Ga0070659_1009434691 218
246 3300005367 Ga0070667_100004176 Ga0070667_1000041767 218
247 3300005367 Ga0070667_100007140 Ga0070667_1000071406 218
248 3300005367 Ga0070667_100040368 Ga0070667_1000403684 218
249 3300005435 Ga0070714_100023219 Ga0070714_1000232195 218
250 3300005435 Ga0070714_100026273 Ga0070714_1000262734 218
251 3300005435 Ga0070714_100031562 Ga0070714_1000315622 218
252 3300005436 Ga0070713_100012866 Ga0070713_1000128665 218
253 3300005436 Ga0070713_100015960 Ga0070713_1000159603 218
254 3300005436 Ga0070713_100041432 Ga0070713_1000414324 218
255 3300005436 Ga0070713_100415206 Ga0070713_1004152062 218
256 3300005444 Ga0070694_100154201 Ga0070694_1001542013 218
257 3300005455 Ga0070663_100000033 Ga0070663_10000003339 218
258 3300005455 Ga0070663_100000701 Ga0070663_10000070117 218
259 3300005455 Ga0070663_100011822 Ga0070663_1000118229 218
260 3300005455 Ga0070663_100064360 Ga0070663_1000643602 218
261 3300005455 Ga0070663_100181264 Ga0070663_1001812642 218
262 3300005455 Ga0070663_100183247 Ga0070663_1001832472 218
263 3300005455 Ga0070663_100349761 Ga0070663_1003497612 218
264 3300005456 Ga0070678_100002162 Ga0070678_10000216211 218
265 3300005456 Ga0070678_100008440 Ga0070678_1000084407 218
266 3300005456 Ga0070678_100213464 Ga0070678_1002134642 218
267 3300005457 Ga0070662_100000017 Ga0070662_10000001784 218
268 3300005457 Ga0070662_100021686 Ga0070662_1000216864 218
269 3300005457 Ga0070662_100022394 Ga0070662_1000223944 218
270 3300005457 Ga0070662_100022923 Ga0070662_1000229232 218
271 3300005457 Ga0070662_100115286 Ga0070662_1001152862 218
272 3300005457 Ga0070662_100127689 Ga0070662_1001276892 218
273 3300005457 Ga0070662_100195091 Ga0070662_1001950913 218
274 3300005457 Ga0070662_100258860 Ga0070662_1002588602 218
275 3300005457 Ga0070662_100430877 Ga0070662_1004308772 218
276 3300005458 Ga0070681_10020638 Ga0070681_100206385 218
277 3300005458 Ga0070681_10031303 Ga0070681_100313035 218
278 3300005459 Ga0068867_100120583 Ga0068867_1001205832 218
279 3300005530 Ga0070679_100000125 Ga0070679_10000012514 218
280 3300005530 Ga0070679_100024833 Ga0070679_1000248335 218
281 3300005530 Ga0070679_100374239 Ga0070679_1003742392 218
282 3300005535 Ga0070684_100004075 Ga0070684_1000040751 218
283 3300005535 Ga0070684_100044912 Ga0070684_1000449124 218
284 3300005535 Ga0070684_100070971 Ga0070684_1000709713 218
285 3300005535 Ga0070684_100255462 Ga0070684_1002554621 218
286 3300005539 Ga0068853_100000703 Ga0068853_1000007033 218
287 3300005539 Ga0068853_100001925 Ga0068853_1000019257 218
288 3300005539 Ga0068853_100002108 Ga0068853_10000210813 218
289 3300005539 Ga0068853_100019076 Ga0068853_1000190762 218
290 3300005539 Ga0068853_100062890 Ga0068853_1000628902 218
291 3300005539 Ga0068853_100103161 Ga0068853_1001031613 218
292 3300005539 Ga0068853_100109796 Ga0068853_1001097963 218
293 3300005539 Ga0068853_100170354 Ga0068853_1001703543 218
294 3300005543 Ga0070672_100001526 Ga0070672_10000152611 218
295 3300005543 Ga0070672_100129764 Ga0070672_1001297642 218
296 3300005544 Ga0070686_100035950 Ga0070686_1000359502 218
297 3300005544 Ga0070686_100098552 Ga0070686_1000985522 218
298 3300005544 Ga0070686_100429455 Ga0070686_1004294551 218
299 3300005545 Ga0070695_100119089 Ga0070695_1001190893 218
300 3300005546 Ga0070696_100028105 Ga0070696_1000281052 218
301 3300005547 Ga0070693_100000820 Ga0070693_1000008206 218
302 3300005548 Ga0070665_100001860 Ga0070665_1000018604 218
303 3300005548 Ga0070665_100010457 Ga0070665_1000104577 218
304 3300005548 Ga0070665_100012945 Ga0070665_1000129456 218
305 3300005548 Ga0070665_100091965 Ga0070665_1000919654 218
306 3300005548 Ga0070665_100121694 Ga0070665_1001216943 218
307 3300005548 Ga0070665_100134896 Ga0070665_1001348962 218
308 3300005548 Ga0070665_100237146 Ga0070665_1002371462 218
309 3300005548 Ga0070665_101260648 Ga0070665_1012606481 218
310 3300005563 Ga0068855_100000194 Ga0068855_10000019439 218
311 3300005563 Ga0068855_100000660 Ga0068855_1000006605 218
312 3300005563 Ga0068855_100035406 Ga0068855_1000354064 218
313 3300005563 Ga0068855_100045992 Ga0068855_1000459923 218
314 3300005563 Ga0068855_100046928 Ga0068855_1000469285 218
315 3300005563 Ga0068855_100134268 Ga0068855_1001342682 218
316 3300005563 Ga0068855_100254660 Ga0068855_1002546603 218
317 3300005563 Ga0068855_100394169 Ga0068855_1003941692 218
318 3300005564 Ga0070664_100000098 Ga0070664_10000009810 218
319 3300005564 Ga0070664_100001922 Ga0070664_10000192212 218
320 3300005564 Ga0070664_100002156 Ga0070664_1000021563 218
321 3300005564 Ga0070664_100029018 Ga0070664_1000290182 218
322 3300005564 Ga0070664_100029619 Ga0070664_1000296191 218
323 3300005564 Ga0070664_100029884 Ga0070664_1000298842 218
324 3300005564 Ga0070664_100082842 Ga0070664_1000828424 218
325 3300005564 Ga0070664_100135940 Ga0070664_1001359402 218
326 3300005577 Ga0068857_100024206 Ga0068857_1000242065 218
327 3300005577 Ga0068857_100062941 Ga0068857_1000629413 218
328 3300005577 Ga0068857_100097225 Ga0068857_1000972253 218
329 3300005577 Ga0068857_100117680 Ga0068857_1001176802 218
330 3300005577 Ga0068857_100374850 Ga0068857_1003748501 218
331 3300005578 Ga0068854_100022085 Ga0068854_1000220853 218
332 3300005578 Ga0068854_100046087 Ga0068854_1000460872 218
333 3300005578 Ga0068854_100077975 Ga0068854_1000779753 218
334 3300005578 Ga0068854_100229564 Ga0068854_1002295642 218
335 3300005578 Ga0068854_100356792 Ga0068854_1003567921 218
336 3300005578 Ga0068854_100609196 Ga0068854_1006091962 218
337 3300005614 Ga0068856_100000098 Ga0068856_10000009882 218
338 3300005614 Ga0068856_100015637 Ga0068856_10001563711 218
339 3300005614 Ga0068856_100052216 Ga0068856_1000522163 218
340 3300005614 Ga0068856_100129246 Ga0068856_1001292463 218
341 3300005614 Ga0068856_100226604 Ga0068856_1002266043 218
342 3300005614 Ga0068856_100462773 Ga0068856_1004627732 218
343 3300005614 Ga0068856_100516397 Ga0068856_1005163972 218
344 3300005614 Ga0068856_101267591 Ga0068856_1012675911 218
345 3300005616 Ga0068852_100000953 Ga0068852_10000095310 218
346 3300005616 Ga0068852_100008945 Ga0068852_1000089452 218
347 3300005616 Ga0068852_100013576 Ga0068852_1000135764 218
348 3300005616 Ga0068852_100032966 Ga0068852_1000329663 218
349 3300005616 Ga0068852_100107541 Ga0068852_1001075413 218
350 3300005616 Ga0068852_100142404 Ga0068852_1001424042 218
351 3300005616 Ga0068852_100312681 Ga0068852_1003126813 218
352 3300005616 Ga0068852_100326855 Ga0068852_1003268552 218
353 3300005616 Ga0068852_100373407 Ga0068852_1003734072 218
354 3300005617 Ga0068859_100065640 Ga0068859_1000656403 218
355 3300005618 Ga0068864_100007806 Ga0068864_1000078064 218
356 3300005618 Ga0068864_100009821 Ga0068864_1000098213 218
357 3300005618 Ga0068864_100040839 Ga0068864_1000408393 218
358 3300005719 Ga0068861_100054228 Ga0068861_1000542282 218
359 3300005834 Ga0068851_10068150 Ga0068851_100681501 218
360 3300005834 Ga0068851_10117520 Ga0068851_101175202 218
361 3300005834 Ga0068851_10222512 Ga0068851_102225122 218
362 3300005834 Ga0068851_10245683 Ga0068851_102456832 218
363 3300005840 Ga0068870_10083110 Ga0068870_100831102 218
364 3300005840 Ga0068870_10088785 Ga0068870_100887853 218
365 3300005841 Ga0068863_100000948 Ga0068863_10000094811 218
366 3300005841 Ga0068863_100009868 Ga0068863_1000098684 218
367 3300005841 Ga0068863_100046820 Ga0068863_1000468204 218
368 3300005841 Ga0068863_100397159 Ga0068863_1003971592 218
369 3300005842 Ga0068858_100015008 Ga0068858_1000150082 218
370 3300005842 Ga0068858_100020175 Ga0068858_1000201754 218
371 3300005842 Ga0068858_100142026 Ga0068858_1001420262 218
372 3300005843 Ga0068860_100083785 Ga0068860_1000837852 218
373 3300005843 Ga0068860_100432204 Ga0068860_1004322042 218
374 3300006028 Ga0070717_10000958 Ga0070717_100009585 218
375 3300006051 Ga0075364_10181296 Ga0075364_101812962 218
376 3300006173 Ga0070716_100020532 Ga0070716_1000205325 218
377 3300006175 Ga0070712_100009798 Ga0070712_1000097986 218
378 3300006195 Ga0075366_10130255 Ga0075366_101302552 218
379 3300006237 Ga0097621_100012478 Ga0097621_1000124783 218
380 3300006237 Ga0097621_100036421 Ga0097621_1000364213 218
381 3300006237 Ga0097621_100718384 Ga0097621_1007183841 218
382 3300006358 Ga0068871_100003349 Ga0068871_1000033499 218
383 3300006358 Ga0068871_100015486 Ga0068871_1000154864 218
384 3300006358 Ga0068871_100115828 Ga0068871_1001158283 218
385 3300006358 Ga0068871_100386464 Ga0068871_1003864641 218
386 3300006844 Ga0075428_100485230 Ga0075428_1004852302 218
387 3300006931 Ga0097620_100065638 Ga0097620_1000656383 218
388 3300009093 Ga0105240_10020205 Ga0105240_100202056 218
389 3300009093 Ga0105240_10140682 Ga0105240_101406824 218
390 3300009093 Ga0105240_10729233 Ga0105240_107292332 218
391 3300009094 Ga0111539_10282877 Ga0111539_102828771 218
392 3300009098 Ga0105245_10013631 Ga0105245_100136312 218
393 3300009101 Ga0105247_10142867 Ga0105247_101428672 218
394 3300009174 Ga0105241_10258637 Ga0105241_102586372 218
395 3300009177 Ga0105248_10000206 Ga0105248_1000020613 218
396 3300009177 Ga0105248_10037274 Ga0105248_100372747 218
397 3300009177 Ga0105248_10198700 Ga0105248_101987002 218
398 3300009545 Ga0105237_10021979 Ga0105237_100219793 218
399 3300009545 Ga0105237_10435052 Ga0105237_104350523 218
400 3300009551 Ga0105238_10011287 Ga0105238_100112877 218
401 3300009551 Ga0105238_10032471 Ga0105238_100324714 218
402 3300009553 Ga0105249_10523740 Ga0105249_105237402 218
403 3300010375 Ga0105239_10174692 Ga0105239_101746922 218
404 3300010375 Ga0105239_10749181 Ga0105239_107491812 218
405 3300011119 Ga0105246_10058818 Ga0105246_100588182 218
406 3300013100 Ga0157373_10001618 Ga0157373_100016185 218
407 3300013100 Ga0157373_10053636 Ga0157373_100536364 218
408 3300013100 Ga0157373_10064671 Ga0157373_100646713 218
409 3300013100 Ga0157373_10136274 Ga0157373_101362741 218
410 3300013100 Ga0157373_10241012 Ga0157373_102410122 218
411 3300013102 Ga0157371_10071343 Ga0157371_100713433 218
412 3300013102 Ga0157371_10137425 Ga0157371_101374252 218
413 3300013104 Ga0157370_10001780 Ga0157370_1000178019 218
414 3300013104 Ga0157370_10004682 Ga0157370_1000468215 218
415 3300013104 Ga0157370_10009396 Ga0157370_100093967 218
416 3300013104 Ga0157370_10539788 Ga0157370_105397882 218
417 3300013105 Ga0157369_10045685 Ga0157369_100456854 218
418 3300013105 Ga0157369_10081409 Ga0157369_100814093 218
419 3300013105 Ga0157369_10195506 Ga0157369_101955062 218
420 3300013105 Ga0157369_10299097 Ga0157369_102990973 218
421 3300013105 Ga0157369_10757297 Ga0157369_107572972 218
422 3300013296 Ga0157374_10016481 Ga0157374_100164815 218
423 3300013296 Ga0157374_10020625 Ga0157374_100206254 218
424 3300013297 Ga0157378_10006347 Ga0157378_100063474 218
425 3300013297 Ga0157378_10052129 Ga0157378_100521294 218
426 3300013306 Ga0163162_10000299 Ga0163162_1000029939 218
427 3300013306 Ga0163162_10079088 Ga0163162_100790884 218
428 3300013307 Ga0157372_10000935 Ga0157372_1000093511 218
429 3300013307 Ga0157372_10058538 Ga0157372_100585382 218
430 3300013307 Ga0157372_10126056 Ga0157372_101260563 218
431 3300013307 Ga0157372_11266299 Ga0157372_112662992 218
432 3300013308 Ga0157375_10000899 Ga0157375_1000089911 218
433 3300013308 Ga0157375_10006083 Ga0157375_1000608311 218
434 3300014325 Ga0163163_10000454 Ga0163163_1000045411 218
435 3300014325 Ga0163163_10002078 Ga0163163_1000207814 218
436 3300014325 Ga0163163_10015746 Ga0163163_100157462 218
437 3300014325 Ga0163163_10018039 Ga0163163_100180394 218
438 3300014968 Ga0157379_10020058 Ga0157379_100200586 218
439 3300014968 Ga0157379_10127824 Ga0157379_101278241 218
440 3300014968 Ga0157379_10248075 Ga0157379_102480752 218
441 3300014968 Ga0157379_10382250 Ga0157379_103822502 218
442 3300014969 Ga0157376_10049329 Ga0157376_100493294 218
443 3300014969 Ga0157376_10371368 Ga0157376_103713682 218
444 3300025321 Ga0207656_10032454 Ga0207656_100324542 218
445 3300025321 Ga0207656_10073320 Ga0207656_100733201 218
446 3300025899 Ga0207642_10048829 Ga0207642_100488293 218
447 3300025903 Ga0207680_10002206 Ga0207680_100022064 218
448 3300025903 Ga0207680_10002981 Ga0207680_100029817 218
449 3300025903 Ga0207680_10084040 Ga0207680_100840402 218
450 3300025903 Ga0207680_10234540 Ga0207680_102345402 218
451 3300025903 Ga0207680_10318108 Ga0207680_103181082 218
452 3300025904 Ga0207647_10001917 Ga0207647_100019173 218
453 3300025904 Ga0207647_10009229 Ga0207647_100092292 218
454 3300025904 Ga0207647_10013750 Ga0207647_100137506 218
455 3300025904 Ga0207647_10018310 Ga0207647_100183103 218
456 3300025904 Ga0207647_10047441 Ga0207647_100474413 218
457 3300025904 Ga0207647_10086655 Ga0207647_100866553 218
458 3300025907 Ga0207645_10316344 Ga0207645_103163442 218
459 3300025909 Ga0207705_10000067 Ga0207705_1000006754 218
460 3300025909 Ga0207705_10000137 Ga0207705_1000013727 218
461 3300025909 Ga0207705_10012658 Ga0207705_100126586 218
462 3300025909 Ga0207705_10025984 Ga0207705_100259844 218
463 3300025909 Ga0207705_10040426 Ga0207705_100404262 218
464 3300025909 Ga0207705_10123817 Ga0207705_101238172 218
465 3300025909 Ga0207705_10324451 Ga0207705_103244512 218
466 3300025911 Ga0207654_10206123 Ga0207654_102061232 218
467 3300025912 Ga0207707_10006775 Ga0207707_100067759 218
468 3300025912 Ga0207707_10010860 Ga0207707_100108602 218
469 3300025912 Ga0207707_10019444 Ga0207707_100194443 218
470 3300025912 Ga0207707_10108742 Ga0207707_101087422 218
471 3300025913 Ga0207695_10009541 Ga0207695_1000954111 218
472 3300025914 Ga0207671_10054587 Ga0207671_100545873 218
473 3300025915 Ga0207693_10211480 Ga0207693_102114801 218
474 3300025917 Ga0207660_10011564 Ga0207660_100115646 218
475 3300025917 Ga0207660_10377031 Ga0207660_103770312 218
476 3300025919 Ga0207657_10000508 Ga0207657_1000050836 218
477 3300025919 Ga0207657_10000552 Ga0207657_1000055235 218
478 3300025919 Ga0207657_10007657 Ga0207657_100076572 218
479 3300025919 Ga0207657_10008334 Ga0207657_100083343 218
480 3300025919 Ga0207657_10008510 Ga0207657_100085103 218
481 3300025919 Ga0207657_10011257 Ga0207657_100112576 218
482 3300025919 Ga0207657_10015848 Ga0207657_100158482 218
483 3300025919 Ga0207657_10040350 Ga0207657_100403504 218
484 3300025919 Ga0207657_10062963 Ga0207657_100629633 218
485 3300025919 Ga0207657_10126264 Ga0207657_101262642 218
486 3300025919 Ga0207657_10171175 Ga0207657_101711752 218
487 3300025919 Ga0207657_10365349 Ga0207657_103653492 218
488 3300025920 Ga0207649_10000186 Ga0207649_1000018627 218
489 3300025920 Ga0207649_10002647 Ga0207649_100026479 218
490 3300025920 Ga0207649_10003998 Ga0207649_100039986 218
491 3300025920 Ga0207649_10012646 Ga0207649_100126465 218
492 3300025920 Ga0207649_10028135 Ga0207649_100281354 218
493 3300025920 Ga0207649_10029033 Ga0207649_100290332 218
494 3300025920 Ga0207649_10038861 Ga0207649_100388612 218
495 3300025920 Ga0207649_10136349 Ga0207649_101363492 218
496 3300025920 Ga0207649_10236108 Ga0207649_102361081 218
497 3300025920 Ga0207649_10300511 Ga0207649_103005112 218
498 3300025920 Ga0207649_10307540 Ga0207649_103075402 218
499 3300025921 Ga0207652_10000058 Ga0207652_1000005814 218
500 3300025921 Ga0207652_10019707 Ga0207652_100197074 218
501 3300025921 Ga0207652_10053467 Ga0207652_100534674 218
502 3300025921 Ga0207652_10328066 Ga0207652_103280662 218
503 3300025923 Ga0207681_10106767 Ga0207681_101067672 218
504 3300025924 Ga0207694_10001654 Ga0207694_100016547 218
505 3300025924 Ga0207694_10012683 Ga0207694_100126834 218
506 3300025925 Ga0207650_10007663 Ga0207650_100076637 218
507 3300025925 Ga0207650_10033138 Ga0207650_100331384 218
508 3300025925 Ga0207650_10073837 Ga0207650_100738372 218
509 3300025925 Ga0207650_10485875 Ga0207650_104858752 218
510 3300025925 Ga0207650_10549435 Ga0207650_105494351 218
511 3300025926 Ga0207659_10117761 Ga0207659_101177612 218
512 3300025926 Ga0207659_10339815 Ga0207659_103398152 218
513 3300025928 Ga0207700_10029985 Ga0207700_100299855 218
514 3300025928 Ga0207700_10056423 Ga0207700_100564235 218
515 3300025928 Ga0207700_10553957 Ga0207700_105539572 218
516 3300025929 Ga0207664_10016664 Ga0207664_100166647 218
517 3300025929 Ga0207664_10035002 Ga0207664_100350025 218
518 3300025931 Ga0207644_10000484 Ga0207644_1000048425 218
519 3300025931 Ga0207644_10007648 Ga0207644_100076482 218
520 3300025931 Ga0207644_10014676 Ga0207644_100146762 218
521 3300025931 Ga0207644_10587686 Ga0207644_105876862 218
522 3300025931 Ga0207644_10816753 Ga0207644_108167531 218
523 3300025932 Ga0207690_10000573 Ga0207690_1000057323 218
524 3300025932 Ga0207690_10002248 Ga0207690_1000224811 218
525 3300025932 Ga0207690_10006556 Ga0207690_100065562 218
526 3300025932 Ga0207690_10031417 Ga0207690_100314174 218
527 3300025932 Ga0207690_10115297 Ga0207690_101152973 218
528 3300025932 Ga0207690_10152614 Ga0207690_101526142 218
529 3300025932 Ga0207690_10287579 Ga0207690_102875791 218
530 3300025932 Ga0207690_10884466 Ga0207690_108844661 218
531 3300025933 Ga0207706_10000514 Ga0207706_1000051410 218
532 3300025933 Ga0207706_10002779 Ga0207706_1000277914 218
533 3300025933 Ga0207706_10004258 Ga0207706_1000425810 218
534 3300025933 Ga0207706_10010427 Ga0207706_100104272 218
535 3300025933 Ga0207706_10026954 Ga0207706_100269544 218
536 3300025933 Ga0207706_10056403 Ga0207706_100564031 218
537 3300025933 Ga0207706_10069353 Ga0207706_100693534 218
538 3300025933 Ga0207706_10113753 Ga0207706_101137532 218
539 3300025933 Ga0207706_10119061 Ga0207706_101190612 218
540 3300025933 Ga0207706_10202299 Ga0207706_102022993 218
541 3300025934 Ga0207686_10026306 Ga0207686_100263062 218
542 3300025937 Ga0207669_10012758 Ga0207669_100127586 218
543 3300025937 Ga0207669_10186020 Ga0207669_101860201 218
544 3300025937 Ga0207669_10334802 Ga0207669_103348022 218
545 3300025938 Ga0207704_10114291 Ga0207704_101142912 218
546 3300025939 Ga0207665_10055571 Ga0207665_100555713 218
547 3300025940 Ga0207691_10002265 Ga0207691_100022656 218
548 3300025940 Ga0207691_10048094 Ga0207691_100480942 218
549 3300025940 Ga0207691_10072556 Ga0207691_100725562 218
550 3300025940 Ga0207691_10089768 Ga0207691_100897682 218
551 3300025941 Ga0207711_10002223 Ga0207711_100022232 218
552 3300025941 Ga0207711_10081762 Ga0207711_100817622 218
553 3300025941 Ga0207711_10163025 Ga0207711_101630252 218
554 3300025944 Ga0207661_10000315 Ga0207661_100003155 218
555 3300025944 Ga0207661_10002683 Ga0207661_100026837 218
556 3300025944 Ga0207661_10004639 Ga0207661_100046396 218
557 3300025944 Ga0207661_10064809 Ga0207661_100648094 218
558 3300025944 Ga0207661_10561757 Ga0207661_105617572 218
559 3300025945 Ga0207679_10000114 Ga0207679_1000011441 218
560 3300025945 Ga0207679_10014472 Ga0207679_100144725 218
561 3300025945 Ga0207679_10021743 Ga0207679_100217435 218
562 3300025945 Ga0207679_10056267 Ga0207679_100562674 218
563 3300025945 Ga0207679_10643824 Ga0207679_106438242 218
564 3300025949 Ga0207667_10003951 Ga0207667_1000395111 218
565 3300025949 Ga0207667_10009848 Ga0207667_1000984811 218
566 3300025949 Ga0207667_10020116 Ga0207667_100201162 218
567 3300025949 Ga0207667_10041796 Ga0207667_100417962 218
568 3300025949 Ga0207667_10049290 Ga0207667_100492904 218
569 3300025949 Ga0207667_10100903 Ga0207667_101009032 218
570 3300025949 Ga0207667_10226131 Ga0207667_102261313 218
571 3300025949 Ga0207667_10737788 Ga0207667_107377882 218
572 3300025960 Ga0207651_10001046 Ga0207651_100010466 218
573 3300025960 Ga0207651_10043936 Ga0207651_100439364 218
574 3300025960 Ga0207651_10067734 Ga0207651_100677342 218
575 3300025960 Ga0207651_10113790 Ga0207651_101137902 218
576 3300025960 Ga0207651_10122520 Ga0207651_101225202 218
577 3300025960 Ga0207651_10268786 Ga0207651_102687862 218
578 3300025960 Ga0207651_10323651 Ga0207651_103236512 218
579 3300025972 Ga0207668_10031756 Ga0207668_100317562 218
580 3300025972 Ga0207668_10189717 Ga0207668_101897172 218
581 3300025981 Ga0207640_10017516 Ga0207640_100175165 218
582 3300025981 Ga0207640_10033972 Ga0207640_100339723 218
583 3300025981 Ga0207640_10040456 Ga0207640_100404562 218
584 3300025981 Ga0207640_10041470 Ga0207640_100414703 218
585 3300025981 Ga0207640_10061654 Ga0207640_100616543 218
586 3300025981 Ga0207640_10222762 Ga0207640_102227622 218
587 3300025981 Ga0207640_10782857 Ga0207640_107828571 218
588 3300025986 Ga0207658_10005868 Ga0207658_100058683 218
589 3300025986 Ga0207658_10018055 Ga0207658_100180555 218
590 3300025986 Ga0207658_10486010 Ga0207658_104860102 218
591 3300026023 Ga0207677_10153343 Ga0207677_101533431 218
592 3300026023 Ga0207677_10704192 Ga0207677_107041922 218
593 3300026023 Ga0207677_10706992 Ga0207677_107069922 218
594 3300026035 Ga0207703_10036759 Ga0207703_100367595 218
595 3300026041 Ga0207639_10000139 Ga0207639_1000013942 218
596 3300026041 Ga0207639_10001196 Ga0207639_1000119617 218
597 3300026041 Ga0207639_10001867 Ga0207639_100018678 218
598 3300026041 Ga0207639_10027955 Ga0207639_100279554 218
599 3300026041 Ga0207639_10107184 Ga0207639_101071841 218
600 3300026041 Ga0207639_10139423 Ga0207639_101394232 218
601 3300026041 Ga0207639_10291528 Ga0207639_102915282 218
602 3300026041 Ga0207639_10947836 Ga0207639_109478361 218
603 3300026067 Ga0207678_10000278 Ga0207678_1000027835 218
604 3300026067 Ga0207678_10002094 Ga0207678_100020946 218
605 3300026067 Ga0207678_10005457 Ga0207678_100054573 218
606 3300026067 Ga0207678_10007933 Ga0207678_100079334 218
607 3300026067 Ga0207678_10097558 Ga0207678_100975584 218
608 3300026067 Ga0207678_10159456 Ga0207678_101594562 218
609 3300026067 Ga0207678_10222814 Ga0207678_102228143 218
610 3300026067 Ga0207678_10319388 Ga0207678_103193882 218
611 3300026067 Ga0207678_10440328 Ga0207678_104403282 218
612 3300026078 Ga0207702_10004645 Ga0207702_100046456 218
613 3300026078 Ga0207702_10037724 Ga0207702_100377244 218
614 3300026078 Ga0207702_10362829 Ga0207702_103628292 218
615 3300026078 Ga0207702_10369590 Ga0207702_103695902 218
616 3300026078 Ga0207702_10428897 Ga0207702_104288972 218
617 3300026078 Ga0207702_10444013 Ga0207702_104440132 218
618 3300026088 Ga0207641_10011259 Ga0207641_100112597 218
619 3300026088 Ga0207641_10025660 Ga0207641_100256604 218
620 3300026088 Ga0207641_10027415 Ga0207641_100274152 218
621 3300026089 Ga0207648_10070048 Ga0207648_100700482 218
622 3300026095 Ga0207676_10031329 Ga0207676_100313293 218
623 3300026116 Ga0207674_10002900 Ga0207674_1000290013 218
624 3300026116 Ga0207674_10022143 Ga0207674_100221436 218
625 3300026116 Ga0207674_10023506 Ga0207674_100235066 218
626 3300026116 Ga0207674_10041206 Ga0207674_100412064 218
627 3300026116 Ga0207674_10120062 Ga0207674_101200622 218
628 3300026116 Ga0207674_10457004 Ga0207674_104570042 218
629 3300026116 Ga0207674_10895525 Ga0207674_108955251 218
630 3300026121 Ga0207683_10000721 Ga0207683_1000072111 218
631 3300026121 Ga0207683_10003627 Ga0207683_100036276 218
632 3300026121 Ga0207683_10075932 Ga0207683_100759322 218
633 3300026142 Ga0207698_10000921 Ga0207698_1000092111 218
634 3300026142 Ga0207698_10004194 Ga0207698_100041946 218
635 3300026142 Ga0207698_10004557 Ga0207698_100045575 218
636 3300026142 Ga0207698_10082333 Ga0207698_100823332 218
637 3300026142 Ga0207698_10271694 Ga0207698_102716942 218
638 3300026142 Ga0207698_10288834 Ga0207698_102888342 218
639 3300026142 Ga0207698_10349038 Ga0207698_103490382 218
640 3300026142 Ga0207698_10508649 Ga0207698_105086491 218
641 3300028379 Ga0268266_10000200 Ga0268266_1000020068 218
642 3300028379 Ga0268266_10020207 Ga0268266_100202074 218
643 3300028379 Ga0268266_10082753 Ga0268266_100827532 218
644 3300028379 Ga0268266_10117276 Ga0268266_101172762 218
645 3300028379 Ga0268266_10248552 Ga0268266_102485522 218
646 3300028379 Ga0268266_10849660 Ga0268266_108496602 218
647 3300028381 Ga0268264_10154044 Ga0268264_101540442 218
648 3300028381 Ga0268264_10215273 Ga0268264_102152733 218
649 3300031548 Ga0307408_100008024 Ga0307408_1000080247 218
650 3300031548 Ga0307408_100107366 Ga0307408_1001073661 218
651 3300031548 Ga0307408_100619995 Ga0307408_1006199952 218
652 3300031731 Ga0307405_10010914 Ga0307405_100109142 218
653 3300031731 Ga0307405_10137435 Ga0307405_101374353 218
654 3300031731 Ga0307405_10211065 Ga0307405_102110652 218
655 3300031731 Ga0307405_10225911 Ga0307405_102259112 218
656 3300031731 Ga0307405_10323284 Ga0307405_103232842 218
657 3300031824 Ga0307413_10055299 Ga0307413_100552993 218
658 3300031824 Ga0307413_10083204 Ga0307413_100832042 218
659 3300031824 Ga0307413_10190698 Ga0307413_101906982 218
660 3300031824 Ga0307413_10317463 Ga0307413_103174632 218
661 3300031852 Ga0307410_10003285 Ga0307410_100032856 218
662 3300031852 Ga0307410_10017685 Ga0307410_100176852 218
663 3300031852 Ga0307410_10075059 Ga0307410_100750593 218
664 3300031852 Ga0307410_10114774 Ga0307410_101147742 218
665 3300031852 Ga0307410_10274096 Ga0307410_102740962 218
666 3300031852 Ga0307410_10356375 Ga0307410_103563752 218
667 3300031852 Ga0307410_10466246 Ga0307410_104662461 218
668 3300031852 Ga0307410_10537495 Ga0307410_105374952 218
669 3300031852 Ga0307410_10689413 Ga0307410_106894132 218
670 3300031901 Ga0307406_10099830 Ga0307406_100998302 218
671 3300031901 Ga0307406_10102773 Ga0307406_101027732 218
672 3300031903 Ga0307407_10047365 Ga0307407_100473652 218
673 3300031903 Ga0307407_10066499 Ga0307407_100664993 218
674 3300031903 Ga0307407_10390887 Ga0307407_103908872 218
675 3300031911 Ga0307412_10053139 Ga0307412_100531394 218
676 3300031911 Ga0307412_10204448 Ga0307412_102044482 218
677 3300031911 Ga0307412_10296002 Ga0307412_102960021 218
678 3300031911 Ga0307412_10305428 Ga0307412_103054282 218
679 3300031911 Ga0307412_10539273 Ga0307412_105392732 218
680 3300031995 Ga0307409_100007302 Ga0307409_1000073025 218
681 3300031995 Ga0307409_100008220 Ga0307409_1000082207 218
682 3300031995 Ga0307409_100011973 Ga0307409_1000119735 218
683 3300031995 Ga0307409_100028940 Ga0307409_1000289403 218
684 3300031995 Ga0307409_100038514 Ga0307409_1000385144 218
685 3300031995 Ga0307409_100079958 Ga0307409_1000799583 218
686 3300032002 Ga0307416_100004831 Ga0307416_1000048316 218
687 3300032002 Ga0307416_100014946 Ga0307416_1000149465 218
688 3300032002 Ga0307416_100035122 Ga0307416_1000351223 218
689 3300032002 Ga0307416_100200149 Ga0307416_1002001492 218
690 3300032004 Ga0307414_10003009 Ga0307414_100030093 218
691 3300032004 Ga0307414_10015959 Ga0307414_100159595 218
692 3300032004 Ga0307414_10054411 Ga0307414_100544113 218
693 3300032004 Ga0307414_10074174 Ga0307414_100741743 218
694 3300032004 Ga0307414_10135153 Ga0307414_101351532 218
695 3300032004 Ga0307414_10156175 Ga0307414_101561752 218
696 3300032004 Ga0307414_10295292 Ga0307414_102952922 218
697 3300032005 Ga0307411_10019133 Ga0307411_100191335 218
698 3300032005 Ga0307411_10130092 Ga0307411_101300922 218
699 3300032005 Ga0307411_10151190 Ga0307411_101511902 218
700 3300032005 Ga0307411_10354081 Ga0307411_103540812 218
701 3300032126 Ga0307415_100019700 Ga0307415_1000197003 218
702 3300032126 Ga0307415_100038314 Ga0307415_1000383143 218
703 3300032126 Ga0307415_100285945 Ga0307415_1002859452 218
704 3300032126 Ga0307415_100360177 Ga0307415_1003601772 218
705 3300032126 Ga0307415_100398591 Ga0307415_1003985912 218
706 3300032126 Ga0307415_100735484 Ga0307415_1007354842 218
707 3300034819 Ga0373958_0055702 Ga0373958_0055702_66_746 218
708 3300034820 Ga0373959_0011664 Ga0373959_0011664_607_1287 218
709 3300035691 Ga0373931_0024953 Ga0373931_0024953_648_1328 218
710 3300036401 Ga0373937_0377847 Ga0373937_0377847_525_1181 218
711 3300037312 Ga0395899_0000157 Ga0395899_0000157_59904_60560 218
712 3300037312 Ga0395899_0003036 Ga0395899_0003036_12691_13347 218
713 3300037312 Ga0395899_0004121 Ga0395899_0004121_10365_11021 218
714 3300037312 Ga0395899_0007337 Ga0395899_0007337_354_1010 218
715 3300037312 Ga0395899_0032658 Ga0395899_0032658_2925_3581 218
716 3300037312 Ga0395899_0035493 Ga0395899_0035493_1038_1694 218
717 3300037312 Ga0395899_0056928 Ga0395899_0056928_1514_2170 218
718 3300037312 Ga0395899_0077458 Ga0395899_0077458_881_1537 218
719 3300037312 Ga0395899_0114710 Ga0395899_0114710_279_935 218
720 3300037312 Ga0395899_0115117 Ga0395899_0115117_168_824 218
721 3300037312 Ga0395899_0145837 Ga0395899_0145837_783_1439 218
722 3300037312 Ga0395899_0336264 Ga0395899_0336264_139_795 218
723 3300037312 Ga0395899_0426775 Ga0395899_0426775_101_757 218
724 3300037418 Ga0395900_0000296 Ga0395900_0000296_31107_31763 218
725 3300037418 Ga0395900_0004777 Ga0395900_0004777_1063_1719 218
726 3300037418 Ga0395900_0006365 Ga0395900_0006365_3371_4027 218
727 3300037418 Ga0395900_0011590 Ga0395900_0011590_1364_2020 218
728 3300037418 Ga0395900_0015667 Ga0395900_0015667_4801_5457 218
729 3300037418 Ga0395900_0034052 Ga0395900_0034052_4556_5212 218
730 3300037418 Ga0395900_0059434 Ga0395900_0059434_2146_2802 218
731 3300037418 Ga0395900_0066274 Ga0395900_0066274_497_1153 218
732 3300037418 Ga0395900_0067966 Ga0395900_0067966_1157_1813 218
733 3300037418 Ga0395900_0096098 Ga0395900_0096098_824_1480 218
734 3300037418 Ga0395900_0112079 Ga0395900_0112079_757_1413 218
735 3300037418 Ga0395900_0132851 Ga0395900_0132851_730_1386 218
736 3300037418 Ga0395900_0158363 Ga0395900_0158363_168_824 218
737 3300037418 Ga0395900_0181648 Ga0395900_0181648_87_743 218
738 3300037418 Ga0395900_0189088 Ga0395900_0189088_685_1341 218
739 3300037418 Ga0395900_0388346 Ga0395900_0388346_395_1051 218
740 3300037418 Ga0395900_0588928 Ga0395900_0588928_265_921 218
741 3300037418 Ga0395900_0703862 Ga0395900_0703862_167_823 218
742 3300037418 Ga0395900_0892721 Ga0395900_0892721_33_689 218
743 3300037466 Ga0395898_0000054 Ga0395898_0000054_167736_168392 218
744 3300037466 Ga0395898_0011440 Ga0395898_0011440_7214_7870 218
745 3300037466 Ga0395898_0014366 Ga0395898_0014366_898_1554 218
746 3300037466 Ga0395898_0028332 Ga0395898_0028332_967_1623 218
747 3300037466 Ga0395898_0032325 Ga0395898_0032325_1678_2334 218
748 3300037466 Ga0395898_0070627 Ga0395898_0070627_1474_2130 218
749 3300037466 Ga0395898_0085318 Ga0395898_0085318_1526_2182 218
750 3300037466 Ga0395898_0161291 Ga0395898_0161291_188_844 218
751 3300037466 Ga0395898_0196305 Ga0395898_0196305_129_785 218
752 3300037466 Ga0395898_0259402 Ga0395898_0259402_42_698 218
753 3300037466 Ga0395898_0552557 Ga0395898_0552557_29_685 218
754 3300037471 Ga0395905_0000046 Ga0395905_0000046_128742_129398 218
755 3300037471 Ga0395905_0000232 Ga0395905_0000232_44082_44738 218
756 3300037471 Ga0395905_0000464 Ga0395905_0000464_53082_53738 218
757 3300037471 Ga0395905_0000606 Ga0395905_0000606_18041_18697 218
758 3300037471 Ga0395905_0000897 Ga0395905_0000897_1540_2196 218
759 3300037471 Ga0395905_0011107 Ga0395905_0011107_5560_6216 218
760 3300037471 Ga0395905_0012624 Ga0395905_0012624_2945_3601 218
761 3300037471 Ga0395905_0015124 Ga0395905_0015124_333_1031 218
762 3300037471 Ga0395905_0020751 Ga0395905_0020751_2531_3187 218
763 3300037471 Ga0395905_0027028 Ga0395905_0027028_912_1568 218
764 3300037471 Ga0395905_0042840 Ga0395905_0042840_420_1076 218
765 3300037471 Ga0395905_0051450 Ga0395905_0051450_1055_1711 218
766 3300037471 Ga0395905_0071488 Ga0395905_0071488_2428_3084 218
767 3300037471 Ga0395905_0072133 Ga0395905_0072133_2092_2748 218
768 3300037471 Ga0395905_0080076 Ga0395905_0080076_353_1009 218
769 3300037471 Ga0395905_0080391 Ga0395905_0080391_1615_2271 218
770 3300037471 Ga0395905_0093487 Ga0395905_0093487_1408_2064 218
771 3300037471 Ga0395905_0107993 Ga0395905_0107993_590_1246 218
772 3300037471 Ga0395905_0110235 Ga0395905_0110235_1527_2183 218
773 3300037471 Ga0395905_0117167 Ga0395905_0117167_291_947 218
774 3300037471 Ga0395905_0146564 Ga0395905_0146564_1175_1831 218
775 3300037471 Ga0395905_0262979 Ga0395905_0262979_868_1524 218
776 3300037471 Ga0395905_0279922 Ga0395905_0279922_235_891 218
777 3300037471 Ga0395905_0347806 Ga0395905_0347806_77_733 218
778 3300037471 Ga0395905_0398835 Ga0395905_0398835_513_1169 218
779 3300037471 Ga0395905_0415972 Ga0395905_0415972_557_1216 218
780 3300038443 Ga0395901_0000102 Ga0395901_0000102_94719_95375 218
781 3300038443 Ga0395901_0001796 Ga0395901_0001796_12560_13216 218
782 3300038443 Ga0395901_0003125 Ga0395901_0003125_1249_1905 218
783 3300038443 Ga0395901_0008849 Ga0395901_0008849_225_881 218
784 3300038443 Ga0395901_0027975 Ga0395901_0027975_4674_5330 218
785 3300038443 Ga0395901_0036764 Ga0395901_0036764_2022_2678 218
786 3300038443 Ga0395901_0037647 Ga0395901_0037647_3380_4036 218
787 3300038443 Ga0395901_0046931 Ga0395901_0046931_1310_1966 218
788 3300038443 Ga0395901_0056516 Ga0395901_0056516_414_1070 218
789 3300038443 Ga0395901_0057431 Ga0395901_0057431_1751_2407 218
790 3300038443 Ga0395901_0066141 Ga0395901_0066141_2746_3402 218
791 3300038443 Ga0395901_0070112 Ga0395901_0070112_1024_1680 218
792 3300038443 Ga0395901_0111298 Ga0395901_0111298_2100_2756 218
793 3300038443 Ga0395901_0282130 Ga0395901_0282130_129_785 218
794 3300038443 Ga0395901_0311156 Ga0395901_0311156_294_950 218
795 3300038443 Ga0395901_0455028 Ga0395901_0455028_204_860 218
796 3300038443 Ga0395901_0476910 Ga0395901_0476910_488_1144 218
797 3300038443 Ga0395901_0503469 Ga0395901_0503469_301_957 218
798 3300038443 Ga0395901_0581923 Ga0395901_0581923_413_1069 218
799 3300038443 Ga0395901_0872548 Ga0395901_0872548_75_755 218
800 3300038443 Ga0395901_0900542 Ga0395901_0900542_20_676 218
801 3300042000 Ga0439437_004915 Ga0439437_004915_380_1036 218
802 3300042127 Ga0450890_001948 Ga0450890_001948_851_1510 218
803 3300042144 Ga0450889_000276 Ga0450889_000276_1075_1734 218
804 3300042157 Ga0439458_0000054 Ga0439458_0000054_10463_11119 218
805 3300042438 Ga0439459_0047598 Ga0439459_0047598_40_699 218
806 3300044656 Ga0466969_0018980 Ga0466969_0018980_2814_3470 218
807 3300044656 Ga0466969_0078060 Ga0466969_0078060_247_903 218
808 3300044683 Ga0466965_0024613 Ga0466965_0024613_279_935 218
809 3300044684 Ga0466966_0028795 Ga0466966_0028795_724_1380 218
810 3300044693 Ga0466961_0009140 Ga0466961_0009140_4401_5057 218
811 3300044693 Ga0466961_0069930 Ga0466961_0069930_673_1329 218
812 3300044693 Ga0466961_0084487 Ga0466961_0084487_1124_1780 218
813 3300044693 Ga0466961_0101201 Ga0466961_0101201_308_964 218
814 3300044693 Ga0466961_0151606 Ga0466961_0151606_350_1006 218
815 3300044693 Ga0466961_0161164 Ga0466961_0161164_34_690 218
816 3300044694 Ga0466963_0007523 Ga0466963_0007523_5406_6062 218
817 3300044694 Ga0466963_0014690 Ga0466963_0014690_2004_2660 218
818 3300044694 Ga0466963_0029599 Ga0466963_0029599_2264_2920 218
819 3300044694 Ga0466963_0035498 Ga0466963_0035498_1157_1813 218
820 3300044694 Ga0466963_0078373 Ga0466963_0078373_1491_2147 218
821 3300044694 Ga0466963_0319679 Ga0466963_0319679_258_938 218
822 3300044719 Ga0466971_0006052 Ga0466971_0006052_2602_3258 218
823 3300044719 Ga0466971_0077658 Ga0466971_0077658_567_1223 218
824 3300044735 Ga0466968_0025697 Ga0466968_0025697_309_965 218
825 3300044765 Ga0466970_0022401 Ga0466970_0022401_1265_1921 218
826 3300044765 Ga0466970_0213217 Ga0466970_0213217_289_945 218
827 3300044842 Ga0466957_0033575 Ga0466957_0033575_1913_2569 218
828 3300044842 Ga0466957_0115418 Ga0466957_0115418_167_826 218
829 3300045049 Ga0466959_0027112 Ga0466959_0027112_3461_4117 218
830 3300045049 Ga0466959_0038100 Ga0466959_0038100_2783_3439 218
831 3300045049 Ga0466959_0221085 Ga0466959_0221085_324_980 218
832 3300045836 Ga0466958_0051402 Ga0466958_0051402_475_1131 218
833 3300045836 Ga0466958_0238222 Ga0466958_0238222_289_945 218
834 3300045976 Ga0466967_0050584 Ga0466967_0050584_1456_2112 218
835 3300045976 Ga0466967_0061319 Ga0466967_0061319_2425_3081 218
836 3300045976 Ga0466967_0079516 Ga0466967_0079516_247_927 218
837 3300045976 Ga0466967_0188674 Ga0466967_0188674_857_1513 218
838 3300045976 Ga0466967_0192475 Ga0466967_0192475_287_943 218
839 3300045976 Ga0466967_0218390 Ga0466967_0218390_765_1421 218
840 3300045976 Ga0466967_0366063 Ga0466967_0366063_27_683 218
841 3300046515 Ga0495620_0055457 Ga0495620_0055457_778_1434 218
842 3300046525 Ga0495663_0012320 Ga0495663_0012320_157_813 218
843 3300046537 Ga0495598_0000126 Ga0495598_0000126_7421_8077 218
844 3300046539 Ga0495621_0002183 Ga0495621_0002183_3096_3752 218
845 3300046684 Ga0495669_0051824 Ga0495669_0051824_728_1384 218
846 3300046691 Ga0495670_0000419 Ga0495670_0000419_1629_2285 218
847 3300047445 Ga0495677_0118573 Ga0495677_0118573_67_723 218
848 3300048903 Ga0496100_0091671 Ga0496100_0091671_724_1380 218
849 3300048903 Ga0496100_0234176 Ga0496100_0234176_159_815 218
850 3300048904 Ga0496101_0028347 Ga0496101_0028347_866_1522 218
851 3300048905 Ga0496102_0198371 Ga0496102_0198371_710_1366 218
852 3300048905 Ga0496102_0256078 Ga0496102_0256078_715_1371 218
853 3300048909 Ga0496106_0080761 Ga0496106_0080761_579_1235 218
854 3300048909 Ga0496106_0189717 Ga0496106_0189717_709_1365 218
855 3300048910 Ga0496107_0009582 Ga0496107_0009582_5923_6579 218
856 3300048911 Ga0496108_0001931 Ga0496108_0001931_15876_16532 218
857 3300048911 Ga0496108_0055807 Ga0496108_0055807_813_1469 218
858 3300048912 Ga0496109_0008971 Ga0496109_0008971_2897_3553 218
859 3300048912 Ga0496109_0122451 Ga0496109_0122451_1436_2092 218
860 3300048912 Ga0496109_0255294 Ga0496109_0255294_339_1019 218
861 3300048912 Ga0496109_0366784 Ga0496109_0366784_606_1262 218
862 3300048912 Ga0496109_0675370 Ga0496109_0675370_174_830 218
863 3300048913 Ga0496110_0182515 Ga0496110_0182515_918_1574 218
864 3300048914 Ga0496111_0003393 Ga0496111_0003393_6467_7123 218
865 3300048914 Ga0496111_0382372 Ga0496111_0382372_300_956 218
866 3300048915 Ga0496112_0014957 Ga0496112_0014957_4965_5621 218
867 3300048915 Ga0496112_0027081 Ga0496112_0027081_2863_3519 218
868 3300048915 Ga0496112_0058862 Ga0496112_0058862_331_987 218
869 3300048915 Ga0496112_0059733 Ga0496112_0059733_790_1446 218
870 3300048915 Ga0496112_0065572 Ga0496112_0065572_769_1425 218
871 3300048916 Ga0496113_0004989 Ga0496113_0004989_4986_5642 218
872 3300048916 Ga0496113_0007376 Ga0496113_0007376_462_1118 218
873 3300048916 Ga0496113_0777669 Ga0496113_0777669_57_737 218
874 3300048917 Ga0496114_0072442 Ga0496114_0072442_1717_2373 218
875 3300048918 Ga0496115_0319383 Ga0496115_0319383_160_816 218
876 3300049585 Ga0501069_0419893 Ga0501069_0419893_69_725 218
877 3300049767 Ga0501270_011966 Ga0501270_011966_51_707 218
878 3300050511 nmdc:mga08y16_258887_c1 nmdc:mga08y16_258887_c1_130_789 218
879 3300061719 Ga0466962_0006718 Ga0466962_0006718_4142_4798 218
880 3300061719 Ga0466962_0161841 Ga0466962_0161841_81_737 218
881 3300001904 JGI24736J21556_1018046 JGI24736J21556_10180462 219
882 3300001990 JGI24737J22298_10015033 JGI24737J22298_100150333 219
883 3300005327 Ga0070658_10005880 Ga0070658_100058809 219
884 3300005328 Ga0070676_10009410 Ga0070676_100094103 219
885 3300005329 Ga0070683_100259584 Ga0070683_1002595842 219
886 3300005334 Ga0068869_100029885 Ga0068869_1000298854 219
887 3300005336 Ga0070680_100001387 Ga0070680_1000013876 219
888 3300005336 Ga0070680_100002431 Ga0070680_10000243110 219
889 3300005338 Ga0068868_100080116 Ga0068868_1000801162 219
890 3300005338 Ga0068868_100202523 Ga0068868_1002025232 219
891 3300005338 Ga0068868_100449925 Ga0068868_1004499251 219
892 3300005339 Ga0070660_100006285 Ga0070660_1000062855 219
893 3300005339 Ga0070660_100031263 Ga0070660_1000312632 219
894 3300005344 Ga0070661_100025998 Ga0070661_1000259986 219
895 3300005345 Ga0070692_10110986 Ga0070692_101109861 219
896 3300005347 Ga0070668_100019102 Ga0070668_1000191025 219
897 3300005347 Ga0070668_100141412 Ga0070668_1001414121 219
898 3300005353 Ga0070669_100038661 Ga0070669_1000386614 219
899 3300005353 Ga0070669_100162482 Ga0070669_1001624822 219
900 3300005353 Ga0070669_100171613 Ga0070669_1001716132 219
901 3300005354 Ga0070675_100070518 Ga0070675_1000705183 219
902 3300005354 Ga0070675_100313668 Ga0070675_1003136681 219
903 3300005355 Ga0070671_100003286 Ga0070671_1000032865 219
904 3300005355 Ga0070671_100158720 Ga0070671_1001587202 219
905 3300005355 Ga0070671_100485574 Ga0070671_1004855741 219
906 3300005356 Ga0070674_100007083 Ga0070674_1000070834 219
907 3300005356 Ga0070674_100272245 Ga0070674_1002722452 219
908 3300005364 Ga0070673_100123294 Ga0070673_1001232942 219
909 3300005366 Ga0070659_100011332 Ga0070659_1000113324 219
910 3300005366 Ga0070659_100017548 Ga0070659_1000175484 219
911 3300005367 Ga0070667_100005701 Ga0070667_1000057014 219
912 3300005367 Ga0070667_100028404 Ga0070667_1000284044 219
913 3300005367 Ga0070667_100073251 Ga0070667_1000732514 219
914 3300005367 Ga0070667_100087747 Ga0070667_1000877474 219
915 3300005367 Ga0070667_100397850 Ga0070667_1003978502 219
916 3300005434 Ga0070709_10214942 Ga0070709_102149421 219
917 3300005435 Ga0070714_100017172 Ga0070714_1000171722 219
918 3300005444 Ga0070694_100006539 Ga0070694_1000065396 219
919 3300005455 Ga0070663_100046441 Ga0070663_1000464414 219
920 3300005455 Ga0070663_100093664 Ga0070663_1000936642 219
921 3300005456 Ga0070678_100078236 Ga0070678_1000782363 219
922 3300005456 Ga0070678_100324279 Ga0070678_1003242791 219
923 3300005457 Ga0070662_100022257 Ga0070662_1000222574 219
924 3300005458 Ga0070681_10067531 Ga0070681_100675313 219
925 3300005459 Ga0068867_100024507 Ga0068867_1000245071 219
926 3300005459 Ga0068867_100029472 Ga0068867_1000294723 219
927 3300005530 Ga0070679_100059142 Ga0070679_1000591424 219
928 3300005530 Ga0070679_100198561 Ga0070679_1001985613 219
929 3300005530 Ga0070679_101001938 Ga0070679_1010019381 219
930 3300005535 Ga0070684_100032649 Ga0070684_1000326492 219
931 3300005539 Ga0068853_100073888 Ga0068853_1000738885 219
932 3300005539 Ga0068853_100095088 Ga0068853_1000950883 219
933 3300005539 Ga0068853_100108952 Ga0068853_1001089522 219
934 3300005539 Ga0068853_100243154 Ga0068853_1002431542 219
935 3300005543 Ga0070672_100015057 Ga0070672_1000150574 219
936 3300005543 Ga0070672_100072979 Ga0070672_1000729791 219
937 3300005543 Ga0070672_100080345 Ga0070672_1000803452 219
938 3300005545 Ga0070695_100456012 Ga0070695_1004560122 219
939 3300005547 Ga0070693_100040422 Ga0070693_1000404222 219
940 3300005547 Ga0070693_100408670 Ga0070693_1004086701 219
941 3300005548 Ga0070665_100200705 Ga0070665_1002007052 219
942 3300005549 Ga0070704_100053679 Ga0070704_1000536793 219
943 3300005564 Ga0070664_100480990 Ga0070664_1004809902 219
944 3300005577 Ga0068857_100350293 Ga0068857_1003502932 219
945 3300005578 Ga0068854_100016294 Ga0068854_1000162944 219
946 3300005578 Ga0068854_100168611 Ga0068854_1001686112 219
947 3300005614 Ga0068856_100018917 Ga0068856_1000189177 219
948 3300005614 Ga0068856_100374832 Ga0068856_1003748322 219
949 3300005616 Ga0068852_100005309 Ga0068852_1000053095 219
950 3300005617 Ga0068859_100003037 Ga0068859_10000303714 219
951 3300005617 Ga0068859_100021936 Ga0068859_1000219364 219
952 3300005617 Ga0068859_100047776 Ga0068859_1000477763 219
953 3300005618 Ga0068864_100000118 Ga0068864_10000011879 219
954 3300005841 Ga0068863_100033463 Ga0068863_1000334634 219
955 3300005841 Ga0068863_100042581 Ga0068863_1000425814 219
956 3300005841 Ga0068863_100164794 Ga0068863_1001647942 219
957 3300005841 Ga0068863_100550175 Ga0068863_1005501751 219
958 3300005842 Ga0068858_100000561 Ga0068858_10000056130 219
959 3300005842 Ga0068858_100014347 Ga0068858_1000143475 219
960 3300005843 Ga0068860_100008415 Ga0068860_1000084152 219
961 3300005843 Ga0068860_100041734 Ga0068860_1000417344 219
962 3300005843 Ga0068860_100139378 Ga0068860_1001393782 219
963 3300005844 Ga0068862_100004687 Ga0068862_1000046876 219
964 3300005844 Ga0068862_100030372 Ga0068862_1000303724 219
965 3300005844 Ga0068862_100202193 Ga0068862_1002021932 219
966 3300006237 Ga0097621_100017230 Ga0097621_1000172304 219
967 3300006358 Ga0068871_100009200 Ga0068871_1000092005 219
968 3300006852 Ga0075433_10007758 Ga0075433_100077582 219
969 3300006881 Ga0068865_100064921 Ga0068865_1000649214 219
970 3300006881 Ga0068865_100082985 Ga0068865_1000829852 219
971 3300006931 Ga0097620_100003037 Ga0097620_10000303714 219
972 3300006931 Ga0097620_100021936 Ga0097620_1000219366 219
973 3300006931 Ga0097620_100047778 Ga0097620_1000477784 219
974 3300009092 Ga0105250_10079005 Ga0105250_100790052 219
975 3300009148 Ga0105243_10139915 Ga0105243_101399153 219
976 3300009176 Ga0105242_10226400 Ga0105242_102264002 219
977 3300009177 Ga0105248_10000184 Ga0105248_1000018410 219
978 3300009177 Ga0105248_10006340 Ga0105248_100063404 219
979 3300009177 Ga0105248_10066528 Ga0105248_100665283 219
980 3300009177 Ga0105248_10509378 Ga0105248_105093782 219
981 3300009177 Ga0105248_10861504 Ga0105248_108615042 219
982 3300009553 Ga0105249_10030844 Ga0105249_100308442 219
983 3300009553 Ga0105249_10166705 Ga0105249_101667053 219
984 3300010375 Ga0105239_10095083 Ga0105239_100950834 219
985 3300013100 Ga0157373_10121236 Ga0157373_101212361 219
986 3300013100 Ga0157373_10260746 Ga0157373_102607462 219
987 3300013102 Ga0157371_10225271 Ga0157371_102252712 219
988 3300013104 Ga0157370_10018523 Ga0157370_100185236 219
989 3300013105 Ga0157369_10011507 Ga0157369_100115077 219
990 3300013105 Ga0157369_10049791 Ga0157369_100497912 219
991 3300013105 Ga0157369_10171368 Ga0157369_101713683 219
992 3300013105 Ga0157369_10233540 Ga0157369_102335402 219
993 3300013296 Ga0157374_10390900 Ga0157374_103909002 219
994 3300013306 Ga0163162_10073048 Ga0163162_100730483 219
995 3300013306 Ga0163162_10413061 Ga0163162_104130612 219
996 3300013307 Ga0157372_10266146 Ga0157372_102661462 219
997 3300013308 Ga0157375_10048110 Ga0157375_100481104 219
998 3300013308 Ga0157375_10195276 Ga0157375_101952763 219
999 3300014325 Ga0163163_10000131 Ga0163163_100001312 219
1000 3300014968 Ga0157379_10004164 Ga0157379_100041648 219
1001 3300020082 Ga0206353_10924596 Ga0206353_109245962 219
1002 3300021384 Ga0213876_10015334 Ga0213876_100153343 219
1003 3300025901 Ga0207688_10083065 Ga0207688_100830651 219
1004 3300025904 Ga0207647_10001021 Ga0207647_1000102113 219
1005 3300025906 Ga0207699_10594291 Ga0207699_105942911 219
1006 3300025907 Ga0207645_10018254 Ga0207645_100182543 219
1007 3300025909 Ga0207705_10005814 Ga0207705_100058144 219
1008 3300025909 Ga0207705_10023252 Ga0207705_100232525 219
1009 3300025909 Ga0207705_10025067 Ga0207705_100250675 219
1010 3300025909 Ga0207705_10059582 Ga0207705_100595824 219
1011 3300025911 Ga0207654_10220681 Ga0207654_102206812 219
1012 3300025912 Ga0207707_10837181 Ga0207707_108371811 219
1013 3300025913 Ga0207695_10526519 Ga0207695_105265192 219
1014 3300025917 Ga0207660_10001083 Ga0207660_1000108314 219
1015 3300025917 Ga0207660_10005519 Ga0207660_100055198 219
1016 3300025919 Ga0207657_10005670 Ga0207657_1000567010 219
1017 3300025919 Ga0207657_10012422 Ga0207657_100124226 219
1018 3300025919 Ga0207657_10083267 Ga0207657_100832672 219
1019 3300025921 Ga0207652_10035429 Ga0207652_100354294 219
1020 3300025921 Ga0207652_10047689 Ga0207652_100476893 219
1021 3300025923 Ga0207681_10008567 Ga0207681_100085673 219
1022 3300025923 Ga0207681_10015190 Ga0207681_100151905 219
1023 3300025923 Ga0207681_10097374 Ga0207681_100973742 219
1024 3300025923 Ga0207681_10255683 Ga0207681_102556832 219
1025 3300025923 Ga0207681_10316270 Ga0207681_103162702 219
1026 3300025925 Ga0207650_10062488 Ga0207650_100624882 219
1027 3300025926 Ga0207659_10021746 Ga0207659_100217465 219
1028 3300025926 Ga0207659_10171437 Ga0207659_101714372 219
1029 3300025929 Ga0207664_10060954 Ga0207664_100609542 219
1030 3300025929 Ga0207664_10272385 Ga0207664_102723853 219
1031 3300025931 Ga0207644_10030209 Ga0207644_100302094 219
1032 3300025931 Ga0207644_10275900 Ga0207644_102759002 219
1033 3300025932 Ga0207690_10012443 Ga0207690_100124434 219
1034 3300025932 Ga0207690_10057663 Ga0207690_100576632 219
1035 3300025932 Ga0207690_10660007 Ga0207690_106600071 219
1036 3300025933 Ga0207706_10022035 Ga0207706_100220354 219
1037 3300025933 Ga0207706_10103739 Ga0207706_101037393 219
1038 3300025934 Ga0207686_10204828 Ga0207686_102048282 219
1039 3300025937 Ga0207669_10013281 Ga0207669_100132814 219
1040 3300025938 Ga0207704_10800165 Ga0207704_108001651 219
1041 3300025940 Ga0207691_10157228 Ga0207691_101572283 219
1042 3300025941 Ga0207711_10000153 Ga0207711_100001534 219
1043 3300025941 Ga0207711_10000413 Ga0207711_100004139 219
1044 3300025941 Ga0207711_10070657 Ga0207711_100706572 219
1045 3300025941 Ga0207711_10672398 Ga0207711_106723981 219
1046 3300025942 Ga0207689_10026321 Ga0207689_100263211 219
1047 3300025942 Ga0207689_10041871 Ga0207689_100418713 219
1048 3300025942 Ga0207689_10088205 Ga0207689_100882052 219
1049 3300025942 Ga0207689_10353851 Ga0207689_103538511 219
1050 3300025944 Ga0207661_11008335 Ga0207661_110083351 219
1051 3300025945 Ga0207679_10029274 Ga0207679_100292742 219
1052 3300025945 Ga0207679_10269798 Ga0207679_102697981 219
1053 3300025949 Ga0207667_10038174 Ga0207667_100381745 219
1054 3300025949 Ga0207667_10100751 Ga0207667_101007513 219
1055 3300025960 Ga0207651_10027155 Ga0207651_100271554 219
1056 3300025960 Ga0207651_10034642 Ga0207651_100346423 219
1057 3300025960 Ga0207651_10206137 Ga0207651_102061372 219
1058 3300025961 Ga0207712_10000783 Ga0207712_1000078315 219
1059 3300025961 Ga0207712_10021438 Ga0207712_100214384 219
1060 3300025972 Ga0207668_10000321 Ga0207668_100003218 219
1061 3300025972 Ga0207668_10078198 Ga0207668_100781982 219
1062 3300025972 Ga0207668_10276449 Ga0207668_102764492 219
1063 3300025981 Ga0207640_10005516 Ga0207640_100055164 219
1064 3300025981 Ga0207640_10415517 Ga0207640_104155172 219
1065 3300025986 Ga0207658_10001832 Ga0207658_100018327 219
1066 3300025986 Ga0207658_10004856 Ga0207658_100048565 219
1067 3300025986 Ga0207658_10012599 Ga0207658_100125994 219
1068 3300025986 Ga0207658_10049529 Ga0207658_100495294 219
1069 3300026023 Ga0207677_10058044 Ga0207677_100580442 219
1070 3300026023 Ga0207677_10208581 Ga0207677_102085812 219
1071 3300026023 Ga0207677_10984770 Ga0207677_109847701 219
1072 3300026035 Ga0207703_10006321 Ga0207703_100063218 219
1073 3300026035 Ga0207703_10009327 Ga0207703_100093275 219
1074 3300026041 Ga0207639_10037135 Ga0207639_100371354 219
1075 3300026041 Ga0207639_10057265 Ga0207639_100572652 219
1076 3300026041 Ga0207639_10058008 Ga0207639_100580081 219
1077 3300026041 Ga0207639_10162335 Ga0207639_101623353 219
1078 3300026067 Ga0207678_10022613 Ga0207678_100226132 219
1079 3300026067 Ga0207678_10217580 Ga0207678_102175802 219
1080 3300026078 Ga0207702_10302149 Ga0207702_103021492 219
1081 3300026078 Ga0207702_10449232 Ga0207702_104492322 219
1082 3300026088 Ga0207641_10000205 Ga0207641_1000020574 219
1083 3300026088 Ga0207641_10013936 Ga0207641_100139362 219
1084 3300026088 Ga0207641_11123964 Ga0207641_111239641 219
1085 3300026089 Ga0207648_10004221 Ga0207648_100042214 219
1086 3300026089 Ga0207648_10011323 Ga0207648_100113236 219
1087 3300026095 Ga0207676_10238815 Ga0207676_102388152 219
1088 3300026095 Ga0207676_10460416 Ga0207676_104604162 219
1089 3300026116 Ga0207674_10028640 Ga0207674_100286403 219
1090 3300026116 Ga0207674_10090135 Ga0207674_100901354 219
1091 3300026116 Ga0207674_10547299 Ga0207674_105472992 219
1092 3300026121 Ga0207683_10339743 Ga0207683_103397432 219
1093 3300026121 Ga0207683_10771481 Ga0207683_107714811 219
1094 3300028380 Ga0268265_10003672 Ga0268265_100036727 219
1095 3300028380 Ga0268265_10012876 Ga0268265_100128766 219
1096 3300028380 Ga0268265_10035629 Ga0268265_100356294 219
1097 3300028380 Ga0268265_10067819 Ga0268265_100678192 219
1098 3300028380 Ga0268265_10614335 Ga0268265_106143352 219
1099 3300028381 Ga0268264_10000268 Ga0268264_1000026890 219
1100 3300028381 Ga0268264_10001019 Ga0268264_1000101922 219
1101 3300028381 Ga0268264_10009700 Ga0268264_100097004 219
1102 3300028381 Ga0268264_10046258 Ga0268264_100462582 219
1103 3300028381 Ga0268264_10097653 Ga0268264_100976533 219
1104 3300031548 Ga0307408_100509764 Ga0307408_1005097642 219
1105 3300031852 Ga0307410_10001234 Ga0307410_100012346 219
1106 3300031901 Ga0307406_10228204 Ga0307406_102282042 219
1107 3300031903 Ga0307407_10066863 Ga0307407_100668633 219
1108 3300031995 Ga0307409_100250575 Ga0307409_1002505752 219
1109 3300032005 Ga0307411_10173703 Ga0307411_101737032 219
1110 3300035091 Ga0373951_0073753 Ga0373951_0073753_69_728 219
1111 3300035113 Ga0373936_0213475 Ga0373936_0213475_166_828 219
1112 3300037312 Ga0395899_0063664 Ga0395899_0063664_1795_2454 219
1113 3300037312 Ga0395899_0065097 Ga0395899_0065097_904_1563 219
1114 3300037312 Ga0395899_0082360 Ga0395899_0082360_269_931 219
1115 3300037312 Ga0395899_0253571 Ga0395899_0253571_231_914 219
1116 3300037312 Ga0395899_0411297 Ga0395899_0411297_121_783 219
1117 3300037418 Ga0395900_0044771 Ga0395900_0044771_2035_2694 219
1118 3300037418 Ga0395900_0046619 Ga0395900_0046619_2759_3424 219
1119 3300037418 Ga0395900_0088609 Ga0395900_0088609_1345_2007 219
1120 3300037418 Ga0395900_0105480 Ga0395900_0105480_1086_1748 219
1121 3300037418 Ga0395900_0154330 Ga0395900_0154330_786_1445 219
1122 3300037418 Ga0395900_0162554 Ga0395900_0162554_414_1073 219
1123 3300037418 Ga0395900_0204009 Ga0395900_0204009_277_936 219
1124 3300037418 Ga0395900_0252884 Ga0395900_0252884_261_920 219
1125 3300037466 Ga0395898_0170518 Ga0395898_0170518_1344_2006 219
1126 3300037466 Ga0395898_0304393 Ga0395898_0304393_530_1189 219
1127 3300037471 Ga0395905_0017293 Ga0395905_0017293_2984_3646 219
1128 3300037471 Ga0395905_0021204 Ga0395905_0021204_2069_2734 219
1129 3300037471 Ga0395905_0032995 Ga0395905_0032995_1383_2045 219
1130 3300037471 Ga0395905_0035133 Ga0395905_0035133_2396_3055 219
1131 3300037471 Ga0395905_0041151 Ga0395905_0041151_2991_3653 219
1132 3300037471 Ga0395905_0073338 Ga0395905_0073338_298_981 219
1133 3300037471 Ga0395905_0091475 Ga0395905_0091475_1920_2579 219
1134 3300037471 Ga0395905_0098818 Ga0395905_0098818_1780_2442 219
1135 3300037471 Ga0395905_0195607 Ga0395905_0195607_76_735 219
1136 3300037471 Ga0395905_0202580 Ga0395905_0202580_136_795 219
1137 3300037471 Ga0395905_0221289 Ga0395905_0221289_627_1286 219
1138 3300037471 Ga0395905_0275673 Ga0395905_0275673_614_1273 219
1139 3300038443 Ga0395901_0000086 Ga0395901_0000086_107692_108351 219
1140 3300038443 Ga0395901_0018555 Ga0395901_0018555_2667_3329 219
1141 3300038443 Ga0395901_0028003 Ga0395901_0028003_3279_3941 219
1142 3300038443 Ga0395901_0076752 Ga0395901_0076752_289_948 219
1143 3300038443 Ga0395901_0315571 Ga0395901_0315571_85_744 219
1144 3300038443 Ga0395901_0462022 Ga0395901_0462022_232_897 219
1145 3300039437 Ga0436365_1796941 Ga0436365_1796941_2473_3132 219
1146 3300039450 Ga0436363_1607284 Ga0436363_1607284_2395_3054 219
1147 3300042439 Ga0439464_0000134 Ga0439464_0000134_8723_9382 219
1148 3300044694 Ga0466963_0118625 Ga0466963_0118625_994_1653 219
1149 3300044842 Ga0466957_0041073 Ga0466957_0041073_366_1028 219
1150 3300044901 Ga0466960_0505717 Ga0466960_0505717_18_680 219
1151 3300045836 Ga0466958_0157115 Ga0466958_0157115_570_1256 219
1152 3300045976 Ga0466967_0001162 Ga0466967_0001162_5901_6623 219
1153 3300045976 Ga0466967_0036384 Ga0466967_0036384_1170_1832 219
1154 3300045976 Ga0466967_0062045 Ga0466967_0062045_2033_2692 219
1155 3300045976 Ga0466967_0072532 Ga0466967_0072532_1668_2327 219
1156 3300045976 Ga0466967_0206439 Ga0466967_0206439_415_1077 219
1157 3300045976 Ga0466967_0567968 Ga0466967_0567968_86_748 219
1158 3300045976 Ga0466967_0586513 Ga0466967_0586513_312_974 219
1159 3300046525 Ga0495663_0009428 Ga0495663_0009428_1730_2389 219
1160 3300046531 Ga0495665_0379383 Ga0495665_0379383_44_706 219
1161 3300046616 Ga0495668_0005930 Ga0495668_0005930_5127_5786 219
1162 3300046684 Ga0495669_0014555 Ga0495669_0014555_273_932 219
1163 3300046684 Ga0495669_0083743 Ga0495669_0083743_291_953 219
1164 3300048903 Ga0496100_0065909 Ga0496100_0065909_1729_2391 219
1165 3300048904 Ga0496101_0085300 Ga0496101_0085300_1217_1879 219
1166 3300048907 Ga0496104_0036159 Ga0496104_0036159_889_1551 219
1167 3300048908 Ga0496105_0018981 Ga0496105_0018981_4197_4859 219
1168 3300048911 Ga0496108_0011249 Ga0496108_0011249_2006_2668 219
1169 3300048912 Ga0496109_0011973 Ga0496109_0011973_784_1446 219
1170 3300048912 Ga0496109_0661468 Ga0496109_0661468_258_917 219
1171 3300048913 Ga0496110_0238633 Ga0496110_0238633_970_1632 219
1172 3300048914 Ga0496111_0021271 Ga0496111_0021271_1147_1809 219
1173 3300048915 Ga0496112_0143772 Ga0496112_0143772_264_926 219
1174 3300048917 Ga0496114_0069099 Ga0496114_0069099_1913_2575 219
1175 3300048918 Ga0496115_0009603 Ga0496115_0009603_3112_3774 219
1176 3300049583 Ga0501067_0053315 Ga0501067_0053315_1120_1779 219
1177 3300049584 Ga0501068_0397539 Ga0501068_0397539_137_796 219
1178 3300049742 Ga0501080_0542700 Ga0501080_0542700_357_1016 219
1179 3300050512 nmdc:mga0n895_182265_c1 nmdc:mga0n895_182265_c1_1192_1851 219
1180 3300050513 nmdc:mga0rr50_254481_c1 nmdc:mga0rr50_254481_c1_396_1055 219
1181 3300050515 nmdc:mga0a205_4289_c1 nmdc:mga0a205_4289_c1_7338_7997 219
1182 3300053134 Ga0500658_0000032 Ga0500658_0000032_4991_5650 219
1183 3300061719 Ga0466962_0023990 Ga0466962_0023990_2174_2860 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

35

245

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r79-assembly3.cif.gz_A-2 crystal structure of an uncharactertized protein from agrobacterium tumefaciens 0.9725 2 216
3r79-assembly3.cif.gz_B crystal structure of an uncharactertized protein from agrobacterium tumefaciens 0.967 4 218
3r79-assembly3.cif.gz_A-2 crystal structure of an uncharactertized protein from agrobacterium tumefaciens 0.9508 2 216
3r79-assembly3.cif.gz_B crystal structure of an uncharactertized protein from agrobacterium tumefaciens 0.9368 4 218
3sy1-assembly1.cif.gz_A crystal structure of engineered protein. northeast structural genomics consortium target or70 0.9362 1 218
ID Description Score Start End Superfamily
3r79B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9597 4 218 3.20.20.10
af_B9EWG6_2_244_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9344 2 218 3.20.20.10
af_Q9Z2Y8_11_258_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9301 4 218 3.20.20.10
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9272 4 218 3.20.20.10
af_B9EWG6_2_244_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.922 2 218 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A7H0GB16-F1-model_v4 deleted 0.9911 1 218
AF-A0A529LS87-F1-model_v4 YggS family pyridoxal phosphate-dependent enzyme 0.9902 32 129 GO:0030170
AF-A0A7H0GB16-F1-model_v4 deleted 0.9866 1 218
AF-A0A5N8ADR0-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9831 10 216 GO:0030170
AF-A0A1S1H9R3-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9812 7 219 GO:0030170

Feature Viewer

pLDDT pTM Quality
94.51 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map