F491104
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1167 | 342 | 2334 | 105 |
Family's Representative Sequence
| Representative Sequence | 3300048903|Ga0496100_0618928|Ga0496100_0618928_383_700 |
| Length | 100 |
| Sequence | MTELCTHLDEVTVRELPPAVDGCEDCLREGGKWLHLRICLTCGHVGCCDDSPSRHATAHNPIIRSLEPGEDWSWCYVDEVAFVLDGVRGTTRIPPSPLLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 75 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 113 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 114 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 115 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 173 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 177 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 178 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 181 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 182 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 183 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 184 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 185 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 186 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 187 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 192 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 195 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 198 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 203 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 207 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 209 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 215 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 216 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 217 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 218 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 219 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 220 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 221 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 222 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 223 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 224 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 225 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 226 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 227 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 228 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 229 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 230 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 231 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 232 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 233 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 234 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 235 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 238 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 239 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 306 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 307 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 308 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 309 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 310 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 311 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 314 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 315 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 316 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 317 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 318 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 319 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 320 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 328 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 340 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 341 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 342 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.4 |
| Metatranscriptomes | 0.6 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.34 |
| Nodule | 0 |
| Rhizoplane | 11.91 |
| Rhizosphere | 86.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496100_0618928 | 3300048903 | Bacteria | 842 |
| 2 | Ga0070658_10030658 | 3300005327 | Bacteria | 4320 |
| 3 | Ga0070658_11623482 | 3300005327 | Bacteria | 560 |
| 4 | Ga0070683_100176541 | 3300005329 | Bacteria | 2028 |
| 5 | Ga0070683_100517700 | 3300005329 | Bacteria | 1140 |
| 6 | Ga0070683_102128403 | 3300005329 | Bacteria | 539 |
| 7 | Ga0070690_100983650 | 3300005330 | Bacteria | 664 |
| 8 | Ga0070680_100088856 | 3300005336 | Bacteria | 2556 |
| 9 | Ga0070680_100154856 | 3300005336 | Bacteria | 1925 |
| 10 | Ga0070680_100256194 | 3300005336 | Bacteria | 1480 |
| 11 | Ga0070680_100439784 | 3300005336 | Bacteria | 1113 |
| 12 | Ga0070680_100517735 | 3300005336 | Bacteria | 1021 |
| 13 | Ga0070682_100020779 | 3300005337 | Bacteria | 3867 |
| 14 | Ga0070682_100110921 | 3300005337 | Bacteria | 1828 |
| 15 | Ga0070682_100547466 | 3300005337 | Unclassified | 905 |
| 16 | Ga0068868_100152685 | 3300005338 | Bacteria | 1902 |
| 17 | Ga0068868_100339838 | 3300005338 | Bacteria | 1283 |
| 18 | Ga0068868_101772299 | 3300005338 | Bacteria | 583 |
| 19 | Ga0070660_100055632 | 3300005339 | Bacteria | 3058 |
| 20 | Ga0070660_100195910 | 3300005339 | Bacteria | 1638 |
| 21 | Ga0070691_10301628 | 3300005341 | Unclassified | 875 |
| 22 | Ga0070691_10450770 | 3300005341 | Bacteria | 734 |
| 23 | Ga0070691_10457620 | 3300005341 | Bacteria | 730 |
| 24 | Ga0070687_100119355 | 3300005343 | Bacteria | 1506 |
| 25 | Ga0070661_100530815 | 3300005344 | Bacteria | 945 |
| 26 | Ga0070661_100539365 | 3300005344 | Bacteria | 937 |
| 27 | Ga0070661_100601107 | 3300005344 | Bacteria | 889 |
| 28 | Ga0070661_101940059 | 3300005344 | Bacteria | 501 |
| 29 | Ga0070692_10020730 | 3300005345 | Bacteria | 3190 |
| 30 | Ga0070671_100029992 | 3300005355 | Bacteria | 4488 |
| 31 | Ga0070674_100061979 | 3300005356 | Bacteria | 2612 |
| 32 | Ga0070674_100294806 | 3300005356 | Bacteria | 1291 |
| 33 | Ga0070673_101323316 | 3300005364 | Bacteria | 677 |
| 34 | Ga0070688_101528228 | 3300005365 | Bacteria | 544 |
| 35 | Ga0070659_100064124 | 3300005366 | Bacteria | 2907 |
| 36 | Ga0070659_100071805 | 3300005366 | Bacteria | 2753 |
| 37 | Ga0070659_100213213 | 3300005366 | Bacteria | 1592 |
| 38 | Ga0070659_101789792 | 3300005366 | Bacteria | 550 |
| 39 | Ga0070709_10390046 | 3300005434 | Bacteria | 1037 |
| 40 | Ga0070709_10406023 | 3300005434 | Bacteria | 1018 |
| 41 | Ga0070709_11460248 | 3300005434 | Bacteria | 555 |
| 42 | Ga0070714_100162757 | 3300005435 | Bacteria | 2020 |
| 43 | Ga0070714_100457498 | 3300005435 | Bacteria | 1213 |
| 44 | Ga0070714_100520205 | 3300005435 | Bacteria | 1136 |
| 45 | Ga0070714_100869971 | 3300005435 | Bacteria | 874 |
| 46 | Ga0070714_101457666 | 3300005435 | Bacteria | 668 |
| 47 | Ga0070714_101481058 | 3300005435 | Bacteria | 663 |
| 48 | Ga0070714_102193712 | 3300005435 | Bacteria | 538 |
| 49 | Ga0070713_100089645 | 3300005436 | Bacteria | 2642 |
| 50 | Ga0070713_100216781 | 3300005436 | Bacteria | 1735 |
| 51 | Ga0070713_101537750 | 3300005436 | Bacteria | 646 |
| 52 | Ga0070710_10002761 | 3300005437 | Bacteria | 8361 |
| 53 | Ga0070710_10017693 | 3300005437 | Bacteria | 3653 |
| 54 | Ga0070710_10393843 | 3300005437 | Bacteria | 927 |
| 55 | Ga0070710_11381646 | 3300005437 | Bacteria | 526 |
| 56 | Ga0070701_10124779 | 3300005438 | Bacteria | 1455 |
| 57 | Ga0070711_100004862 | 3300005439 | Bacteria | 7976 |
| 58 | Ga0070711_100022994 | 3300005439 | Bacteria | 4048 |
| 59 | Ga0070711_100094527 | 3300005439 | Bacteria | 2161 |
| 60 | Ga0070711_100655452 | 3300005439 | Bacteria | 880 |
| 61 | Ga0070711_100833137 | 3300005439 | Bacteria | 784 |
| 62 | Ga0070705_100015859 | 3300005440 | Bacteria | 3903 |
| 63 | Ga0070705_100057102 | 3300005440 | Bacteria | 2301 |
| 64 | Ga0070705_100197467 | 3300005440 | Bacteria | 1376 |
| 65 | Ga0070700_100938978 | 3300005441 | Bacteria | 707 |
| 66 | Ga0070694_100180183 | 3300005444 | Bacteria | 1562 |
| 67 | Ga0070694_100621581 | 3300005444 | Bacteria | 872 |
| 68 | Ga0070694_101154606 | 3300005444 | Bacteria | 648 |
| 69 | Ga0070708_100056097 | 3300005445 | Bacteria | 3503 |
| 70 | Ga0070708_100309276 | 3300005445 | Bacteria | 1488 |
| 71 | Ga0070708_100344827 | 3300005445 | Bacteria | 1403 |
| 72 | Ga0070708_100347540 | 3300005445 | Bacteria | 1397 |
| 73 | Ga0070708_100439973 | 3300005445 | Bacteria | 1230 |
| 74 | Ga0070708_100750821 | 3300005445 | Bacteria | 917 |
| 75 | Ga0070708_101181280 | 3300005445 | Bacteria | 716 |
| 76 | Ga0070708_101467463 | 3300005445 | Bacteria | 636 |
| 77 | Ga0070663_101658693 | 3300005455 | Bacteria | 571 |
| 78 | Ga0070678_100032856 | 3300005456 | Bacteria | 3596 |
| 79 | Ga0070678_100048228 | 3300005456 | Bacteria | 3066 |
| 80 | Ga0070662_100792985 | 3300005457 | Bacteria | 805 |
| 81 | Ga0070681_10047558 | 3300005458 | Bacteria | 4288 |
| 82 | Ga0070681_10052941 | 3300005458 | Bacteria | 4046 |
| 83 | Ga0070681_10145078 | 3300005458 | Bacteria | 2303 |
| 84 | Ga0070681_10185218 | 3300005458 | Bacteria | 2002 |
| 85 | Ga0070681_10203974 | 3300005458 | Bacteria | 1895 |
| 86 | Ga0070681_10396908 | 3300005458 | Bacteria | 1290 |
| 87 | Ga0070681_10798238 | 3300005458 | Bacteria | 861 |
| 88 | Ga0070681_11124179 | 3300005458 | Bacteria | 707 |
| 89 | Ga0068867_100014353 | 3300005459 | Bacteria | 5612 |
| 90 | Ga0068867_101249541 | 3300005459 | Bacteria | 684 |
| 91 | Ga0070706_100030095 | 3300005467 | Bacteria | 5001 |
| 92 | Ga0070706_100123927 | 3300005467 | Bacteria | 2409 |
| 93 | Ga0070706_100232365 | 3300005467 | Bacteria | 1721 |
| 94 | Ga0070706_100540909 | 3300005467 | Bacteria | 1083 |
| 95 | Ga0070706_100690009 | 3300005467 | Bacteria | 947 |
| 96 | Ga0070706_100983059 | 3300005467 | Bacteria | 778 |
| 97 | Ga0070707_100003358 | 3300005468 | Bacteria | 15111 |
| 98 | Ga0070707_100068131 | 3300005468 | Bacteria | 3424 |
| 99 | Ga0070707_100084272 | 3300005468 | Bacteria | 3071 |
| 100 | Ga0070707_100132241 | 3300005468 | Bacteria | 2427 |
| 101 | Ga0070707_100191630 | 3300005468 | Bacteria | 1993 |
| 102 | Ga0070707_100536680 | 3300005468 | Bacteria | 1132 |
| 103 | Ga0070707_100606791 | 3300005468 | Bacteria | 1057 |
| 104 | Ga0070707_100751381 | 3300005468 | Bacteria | 938 |
| 105 | Ga0070698_100172912 | 3300005471 | Bacteria | 2100 |
| 106 | Ga0070698_100250121 | 3300005471 | Bacteria | 1705 |
| 107 | Ga0070698_100261911 | 3300005471 | Bacteria | 1661 |
| 108 | Ga0070698_100340366 | 3300005471 | Bacteria | 1431 |
| 109 | Ga0070698_100498514 | 3300005471 | Bacteria | 1155 |
| 110 | Ga0070698_100827233 | 3300005471 | Bacteria | 870 |
| 111 | Ga0070698_100960727 | 3300005471 | Bacteria | 801 |
| 112 | Ga0070698_101534049 | 3300005471 | Bacteria | 618 |
| 113 | Ga0070699_100020255 | 3300005518 | Bacteria | 5735 |
| 114 | Ga0070699_100173887 | 3300005518 | Bacteria | 1909 |
| 115 | Ga0070699_100410773 | 3300005518 | Bacteria | 1225 |
| 116 | Ga0070699_100576053 | 3300005518 | Bacteria | 1025 |
| 117 | Ga0070699_100786420 | 3300005518 | Bacteria | 871 |
| 118 | Ga0070699_101033586 | 3300005518 | Unclassified | 753 |
| 119 | Ga0070699_101309337 | 3300005518 | Bacteria | 664 |
| 120 | Ga0070679_100044965 | 3300005530 | Bacteria | 4399 |
| 121 | Ga0070679_100059757 | 3300005530 | Bacteria | 3799 |
| 122 | Ga0070679_100096020 | 3300005530 | Bacteria | 2952 |
| 123 | Ga0070679_100103675 | 3300005530 | Bacteria | 2831 |
| 124 | Ga0070679_100335690 | 3300005530 | Bacteria | 1460 |
| 125 | Ga0070679_100558819 | 3300005530 | Bacteria | 1088 |
| 126 | Ga0070679_101417089 | 3300005530 | Bacteria | 641 |
| 127 | Ga0070684_100068875 | 3300005535 | Bacteria | 3111 |
| 128 | Ga0070684_100082221 | 3300005535 | Bacteria | 2851 |
| 129 | Ga0070684_100118564 | 3300005535 | Bacteria | 2379 |
| 130 | Ga0070684_100299318 | 3300005535 | Bacteria | 1476 |
| 131 | Ga0070684_100439659 | 3300005535 | Bacteria | 1205 |
| 132 | Ga0070697_100531250 | 3300005536 | Bacteria | 1030 |
| 133 | Ga0070697_100658859 | 3300005536 | Unclassified | 922 |
| 134 | Ga0070697_100823937 | 3300005536 | Bacteria | 822 |
| 135 | Ga0070697_100932779 | 3300005536 | Bacteria | 771 |
| 136 | Ga0070697_100936808 | 3300005536 | Bacteria | 769 |
| 137 | Ga0070697_101165037 | 3300005536 | Bacteria | 687 |
| 138 | Ga0068853_100582670 | 3300005539 | Bacteria | 1062 |
| 139 | Ga0068853_101923225 | 3300005539 | Bacteria | 573 |
| 140 | Ga0070686_100146968 | 3300005544 | Bacteria | 1647 |
| 141 | Ga0070686_100905263 | 3300005544 | Bacteria | 718 |
| 142 | Ga0070695_100000089 | 3300005545 | Bacteria | 38933 |
| 143 | Ga0070695_100336009 | 3300005545 | Bacteria | 1127 |
| 144 | Ga0070695_100434179 | 3300005545 | Bacteria | 1003 |
| 145 | Ga0070695_101042226 | 3300005545 | Bacteria | 667 |
| 146 | Ga0070695_101267605 | 3300005545 | Bacteria | 608 |
| 147 | Ga0070696_100071671 | 3300005546 | Bacteria | 2439 |
| 148 | Ga0070696_100449293 | 3300005546 | Bacteria | 1017 |
| 149 | Ga0070693_100012449 | 3300005547 | Bacteria | 4304 |
| 150 | Ga0070693_100152966 | 3300005547 | Bacteria | 1463 |
| 151 | Ga0070693_100160414 | 3300005547 | Bacteria | 1432 |
| 152 | Ga0070704_100292503 | 3300005549 | Bacteria | 1354 |
| 153 | Ga0070704_100498279 | 3300005549 | Bacteria | 1056 |
| 154 | Ga0070704_101049953 | 3300005549 | Bacteria | 738 |
| 155 | Ga0070704_101373095 | 3300005549 | Bacteria | 648 |
| 156 | Ga0068855_100204709 | 3300005563 | Bacteria | 2220 |
| 157 | Ga0068855_100209079 | 3300005563 | Bacteria | 2194 |
| 158 | Ga0068855_100299850 | 3300005563 | Bacteria | 1780 |
| 159 | Ga0068855_100368425 | 3300005563 | Bacteria | 1580 |
| 160 | Ga0068855_101967557 | 3300005563 | Bacteria | 591 |
| 161 | Ga0070664_100693626 | 3300005564 | Bacteria | 948 |
| 162 | Ga0070664_101321282 | 3300005564 | Bacteria | 681 |
| 163 | Ga0068857_101600205 | 3300005577 | Bacteria | 636 |
| 164 | Ga0068854_100033746 | 3300005578 | Bacteria | 3569 |
| 165 | Ga0068854_100131082 | 3300005578 | Bacteria | 1914 |
| 166 | Ga0068854_100597323 | 3300005578 | Bacteria | 942 |
| 167 | Ga0068854_102130955 | 3300005578 | Bacteria | 518 |
| 168 | Ga0068856_100077083 | 3300005614 | Bacteria | 3303 |
| 169 | Ga0068856_100097263 | 3300005614 | Bacteria | 2932 |
| 170 | Ga0068856_100180435 | 3300005614 | Bacteria | 2124 |
| 171 | Ga0068856_100858777 | 3300005614 | Bacteria | 927 |
| 172 | Ga0070702_100021704 | 3300005615 | Bacteria | 3384 |
| 173 | Ga0070702_100631966 | 3300005615 | Bacteria | 807 |
| 174 | Ga0070702_100849695 | 3300005615 | Bacteria | 710 |
| 175 | Ga0068852_100072272 | 3300005616 | Bacteria | 3031 |
| 176 | Ga0068852_100612322 | 3300005616 | Bacteria | 1094 |
| 177 | Ga0068861_100153027 | 3300005719 | Bacteria | 1894 |
| 178 | Ga0068861_100208323 | 3300005719 | Bacteria | 1645 |
| 179 | Ga0068861_100558847 | 3300005719 | Bacteria | 1044 |
| 180 | Ga0068861_101297458 | 3300005719 | Bacteria | 708 |
| 181 | Ga0068863_100954715 | 3300005841 | Bacteria | 859 |
| 182 | Ga0068860_100521222 | 3300005843 | Bacteria | 1188 |
| 183 | Ga0068862_101321161 | 3300005844 | Bacteria | 723 |
| 184 | Ga0081455_10036207 | 3300005937 | Bacteria | 4398 |
| 185 | Ga0081455_10092588 | 3300005937 | Bacteria | 2445 |
| 186 | Ga0081540_1000025 | 3300005983 | Bacteria | 157742 |
| 187 | Ga0081539_10000181 | 3300005985 | Bacteria | 148250 |
| 188 | Ga0070717_10002047 | 3300006028 | Bacteria | 14124 |
| 189 | Ga0070717_10007748 | 3300006028 | Bacteria | 7988 |
| 190 | Ga0070717_10801535 | 3300006028 | Bacteria | 857 |
| 191 | Ga0070717_10896914 | 3300006028 | Bacteria | 807 |
| 192 | Ga0075363_100046677 | 3300006048 | Bacteria | 2299 |
| 193 | Ga0070715_10002718 | 3300006163 | Bacteria | 5487 |
| 194 | Ga0070715_10006384 | 3300006163 | Bacteria | 4006 |
| 195 | Ga0070715_10013029 | 3300006163 | Bacteria | 3044 |
| 196 | Ga0070715_10486552 | 3300006163 | Bacteria | 704 |
| 197 | Ga0070716_100047323 | 3300006173 | Bacteria | 2425 |
| 198 | Ga0070716_100111927 | 3300006173 | Bacteria | 1693 |
| 199 | Ga0070716_100306116 | 3300006173 | Bacteria | 1107 |
| 200 | Ga0070716_100313724 | 3300006173 | Bacteria | 1096 |
| 201 | Ga0070712_100059604 | 3300006175 | Bacteria | 2689 |
| 202 | Ga0070712_100106201 | 3300006175 | Bacteria | 2087 |
| 203 | Ga0070712_100108563 | 3300006175 | Bacteria | 2066 |
| 204 | Ga0070712_100278882 | 3300006175 | Bacteria | 1345 |
| 205 | Ga0070712_100569287 | 3300006175 | Bacteria | 956 |
| 206 | Ga0070712_101222769 | 3300006175 | Bacteria | 654 |
| 207 | Ga0070712_101288942 | 3300006175 | Bacteria | 636 |
| 208 | Ga0097621_100369031 | 3300006237 | Bacteria | 1280 |
| 209 | Ga0068871_100896649 | 3300006358 | Bacteria | 822 |
| 210 | Ga0075428_100775379 | 3300006844 | Bacteria | 1020 |
| 211 | Ga0075430_100937510 | 3300006846 | Archaea | 713 |
| 212 | Ga0075430_101313302 | 3300006846 | Bacteria | 595 |
| 213 | Ga0075433_10002015 | 3300006852 | Bacteria | 15317 |
| 214 | Ga0075433_10034215 | 3300006852 | Bacteria | 4362 |
| 215 | Ga0075433_10036823 | 3300006852 | Bacteria | 4217 |
| 216 | Ga0075433_10458227 | 3300006852 | Bacteria | 1124 |
| 217 | Ga0075433_10472973 | 3300006852 | Bacteria | 1104 |
| 218 | Ga0075433_11301081 | 3300006852 | Bacteria | 630 |
| 219 | Ga0075434_100001203 | 3300006871 | Bacteria | 21514 |
| 220 | Ga0075434_100060788 | 3300006871 | Bacteria | 3758 |
| 221 | Ga0075434_100117584 | 3300006871 | Bacteria | 2672 |
| 222 | Ga0075434_100151958 | 3300006871 | Bacteria | 2336 |
| 223 | Ga0075434_100166565 | 3300006871 | Bacteria | 2224 |
| 224 | Ga0075434_100243666 | 3300006871 | Bacteria | 1817 |
| 225 | Ga0068865_102025039 | 3300006881 | Bacteria | 523 |
| 226 | Ga0075436_100020282 | 3300006914 | Bacteria | 4562 |
| 227 | Ga0075436_100479677 | 3300006914 | Bacteria | 908 |
| 228 | Ga0075435_100015464 | 3300007076 | Bacteria | 5738 |
| 229 | Ga0075435_100063424 | 3300007076 | Bacteria | 3001 |
| 230 | Ga0075435_100093822 | 3300007076 | Bacteria | 2480 |
| 231 | Ga0075435_100450346 | 3300007076 | Bacteria | 1110 |
| 232 | Ga0099794_10343880 | 3300007265 | Bacteria | 775 |
| 233 | Ga0105244_10190972 | 3300009036 | Bacteria | 968 |
| 234 | Ga0105240_10012479 | 3300009093 | Bacteria | 11724 |
| 235 | Ga0105240_10134654 | 3300009093 | Bacteria | 2960 |
| 236 | Ga0105240_10145628 | 3300009093 | Bacteria | 2827 |
| 237 | Ga0105240_10778784 | 3300009093 | Bacteria | 1038 |
| 238 | Ga0105240_10779949 | 3300009093 | Bacteria | 1037 |
| 239 | Ga0105240_11147276 | 3300009093 | Bacteria | 825 |
| 240 | Ga0105240_11891084 | 3300009093 | Bacteria | 621 |
| 241 | Ga0111539_10833831 | 3300009094 | Bacteria | 1073 |
| 242 | Ga0111539_11195837 | 3300009094 | Bacteria | 883 |
| 243 | Ga0105245_10030624 | 3300009098 | Bacteria | 4759 |
| 244 | Ga0105245_10465794 | 3300009098 | Bacteria | 1275 |
| 245 | Ga0105245_10566947 | 3300009098 | Bacteria | 1159 |
| 246 | Ga0105245_10581412 | 3300009098 | Bacteria | 1145 |
| 247 | Ga0105245_10600908 | 3300009098 | Bacteria | 1127 |
| 248 | Ga0105247_10113068 | 3300009101 | Bacteria | 1750 |
| 249 | Ga0105247_10409802 | 3300009101 | Bacteria | 968 |
| 250 | Ga0105247_10726174 | 3300009101 | Bacteria | 750 |
| 251 | Ga0105247_11575123 | 3300009101 | Bacteria | 539 |
| 252 | Ga0114129_10096592 | 3300009147 | Bacteria | 4090 |
| 253 | Ga0114129_10136922 | 3300009147 | Bacteria | 3359 |
| 254 | Ga0114129_10317035 | 3300009147 | Bacteria | 2074 |
| 255 | Ga0114129_10456845 | 3300009147 | Bacteria | 1674 |
| 256 | Ga0114129_10576550 | 3300009147 | Bacteria | 1460 |
| 257 | Ga0114129_11862442 | 3300009147 | Bacteria | 730 |
| 258 | Ga0114129_11890026 | 3300009147 | Bacteria | 724 |
| 259 | Ga0114129_12328186 | 3300009147 | Bacteria | 643 |
| 260 | Ga0105243_10112064 | 3300009148 | Bacteria | 2285 |
| 261 | Ga0105243_10310081 | 3300009148 | Bacteria | 1434 |
| 262 | Ga0105243_10705862 | 3300009148 | Bacteria | 984 |
| 263 | Ga0105243_12145201 | 3300009148 | Bacteria | 595 |
| 264 | Ga0105241_10032826 | 3300009174 | Bacteria | 3895 |
| 265 | Ga0105241_10224103 | 3300009174 | Bacteria | 1582 |
| 266 | Ga0105241_10900274 | 3300009174 | Bacteria | 822 |
| 267 | Ga0105241_12047488 | 3300009174 | Bacteria | 564 |
| 268 | Ga0105242_10021162 | 3300009176 | Bacteria | 5105 |
| 269 | Ga0105242_10125404 | 3300009176 | Bacteria | 2209 |
| 270 | Ga0105242_10359141 | 3300009176 | Bacteria | 1348 |
| 271 | Ga0105242_10787895 | 3300009176 | Bacteria | 940 |
| 272 | Ga0105242_11756183 | 3300009176 | Bacteria | 658 |
| 273 | Ga0105242_13024438 | 3300009176 | Bacteria | 521 |
| 274 | Ga0105242_13128872 | 3300009176 | Unclassified | 513 |
| 275 | Ga0105248_11851832 | 3300009177 | Bacteria | 685 |
| 276 | Ga0105248_11956041 | 3300009177 | Bacteria | 666 |
| 277 | Ga0105237_10035633 | 3300009545 | Bacteria | 5034 |
| 278 | Ga0105237_10231202 | 3300009545 | Bacteria | 1850 |
| 279 | Ga0105237_10492405 | 3300009545 | Bacteria | 1232 |
| 280 | Ga0105237_11920209 | 3300009545 | Bacteria | 600 |
| 281 | Ga0105237_12664330 | 3300009545 | Bacteria | 511 |
| 282 | Ga0105238_10056425 | 3300009551 | Bacteria | 3941 |
| 283 | Ga0105238_11128631 | 3300009551 | Bacteria | 807 |
| 284 | Ga0105249_10256515 | 3300009553 | Bacteria | 1736 |
| 285 | Ga0105249_10704302 | 3300009553 | Bacteria | 1070 |
| 286 | Ga0105239_10224321 | 3300010375 | Unclassified | 2108 |
| 287 | Ga0105239_10266156 | 3300010375 | Bacteria | 1927 |
| 288 | Ga0105239_10888159 | 3300010375 | Bacteria | 1023 |
| 289 | Ga0105239_11307644 | 3300010375 | Bacteria | 836 |
| 290 | Ga0105239_11538974 | 3300010375 | Bacteria | 769 |
| 291 | Ga0105239_13205491 | 3300010375 | Bacteria | 533 |
| 292 | Ga0105246_11704771 | 3300011119 | Bacteria | 599 |
| 293 | Ga0157326_1036841 | 3300012513 | Bacteria | 671 |
| 294 | Ga0157373_11013879 | 3300013100 | Unclassified | 620 |
| 295 | Ga0157371_10402642 | 3300013102 | Bacteria | 1001 |
| 296 | Ga0157371_10744811 | 3300013102 | Bacteria | 736 |
| 297 | Ga0157370_10020230 | 3300013104 | Bacteria | 6650 |
| 298 | Ga0157370_10470046 | 3300013104 | Bacteria | 1156 |
| 299 | Ga0157370_11066679 | 3300013104 | Bacteria | 730 |
| 300 | Ga0157369_10024234 | 3300013105 | Bacteria | 6754 |
| 301 | Ga0157369_10063581 | 3300013105 | Bacteria | 3975 |
| 302 | Ga0157369_10252720 | 3300013105 | Bacteria | 1839 |
| 303 | Ga0157369_10796099 | 3300013105 | Bacteria | 971 |
| 304 | Ga0157374_10096015 | 3300013296 | Bacteria | 2835 |
| 305 | Ga0157374_10116033 | 3300013296 | Bacteria | 2579 |
| 306 | Ga0157374_10345674 | 3300013296 | Bacteria | 1477 |
| 307 | Ga0157374_10845553 | 3300013296 | Bacteria | 932 |
| 308 | Ga0157378_10230150 | 3300013297 | Bacteria | 1766 |
| 309 | Ga0157378_10524999 | 3300013297 | Bacteria | 1186 |
| 310 | Ga0157378_12894836 | 3300013297 | Bacteria | 532 |
| 311 | Ga0157378_13265246 | 3300013297 | Bacteria | 504 |
| 312 | Ga0163162_10430571 | 3300013306 | Bacteria | 1451 |
| 313 | Ga0163162_10839389 | 3300013306 | Bacteria | 1034 |
| 314 | Ga0157372_10019517 | 3300013307 | Bacteria | 7309 |
| 315 | Ga0157372_10056656 | 3300013307 | Bacteria | 4379 |
| 316 | Ga0157372_10410902 | 3300013307 | Bacteria | 1577 |
| 317 | Ga0157372_10484219 | 3300013307 | Bacteria | 1442 |
| 318 | Ga0157372_10545222 | 3300013307 | Bacteria | 1352 |
| 319 | Ga0157375_10108630 | 3300013308 | Bacteria | 2869 |
| 320 | Ga0157375_10139524 | 3300013308 | Bacteria | 2550 |
| 321 | Ga0157375_10936779 | 3300013308 | Bacteria | 1008 |
| 322 | Ga0163163_10695089 | 3300014325 | Bacteria | 1081 |
| 323 | Ga0163163_11383811 | 3300014325 | Bacteria | 765 |
| 324 | Ga0163163_11574275 | 3300014325 | Bacteria | 718 |
| 325 | Ga0157380_10214108 | 3300014326 | Bacteria | 1719 |
| 326 | Ga0157380_10463141 | 3300014326 | Bacteria | 1221 |
| 327 | Ga0182008_10197645 | 3300014497 | Bacteria | 1022 |
| 328 | Ga0157377_10395524 | 3300014745 | Bacteria | 940 |
| 329 | Ga0157379_10008331 | 3300014968 | Bacteria | 9010 |
| 330 | Ga0157379_10906361 | 3300014968 | Bacteria | 836 |
| 331 | Ga0157376_10113526 | 3300014969 | Bacteria | 2389 |
| 332 | Ga0157376_10411777 | 3300014969 | Bacteria | 1310 |
| 333 | Ga0182006_1307590 | 3300015261 | Bacteria | 520 |
| 334 | Ga0163161_10264390 | 3300017792 | Bacteria | 1344 |
| 335 | Ga0163161_10551893 | 3300017792 | Bacteria | 944 |
| 336 | Ga0197907_10618113 | 3300020069 | Bacteria | 2045 |
| 337 | Ga0206356_10612127 | 3300020070 | Bacteria | 823 |
| 338 | Ga0206350_10500599 | 3300020080 | Bacteria | 605 |
| 339 | Ga0206353_11412652 | 3300020082 | Bacteria | 2475 |
| 340 | Ga0213873_10041712 | 3300021358 | Unclassified | 1184 |
| 341 | Ga0213874_10444724 | 3300021377 | Bacteria | 511 |
| 342 | Ga0213876_10137717 | 3300021384 | Unclassified | 1298 |
| 343 | Ga0224712_10075621 | 3300022467 | Bacteria | 1378 |
| 344 | Ga0224712_10103381 | 3300022467 | Bacteria | 1212 |
| 345 | Ga0224712_10276874 | 3300022467 | Bacteria | 780 |
| 346 | Ga0207655_1104558 | 3300025728 | Bacteria | 968 |
| 347 | Ga0207653_10007523 | 3300025885 | Bacteria | 3395 |
| 348 | Ga0207692_10272424 | 3300025898 | Bacteria | 1021 |
| 349 | Ga0207692_10291031 | 3300025898 | Bacteria | 991 |
| 350 | Ga0207642_10113386 | 3300025899 | Bacteria | 1385 |
| 351 | Ga0207642_10141748 | 3300025899 | Bacteria | 1268 |
| 352 | Ga0207688_10176465 | 3300025901 | Bacteria | 1273 |
| 353 | Ga0207680_10504309 | 3300025903 | Bacteria | 862 |
| 354 | Ga0207685_10008057 | 3300025905 | Bacteria | 2978 |
| 355 | Ga0207699_10004270 | 3300025906 | Bacteria | 6833 |
| 356 | Ga0207699_10168458 | 3300025906 | Bacteria | 1464 |
| 357 | Ga0207705_10359906 | 3300025909 | Bacteria | 1122 |
| 358 | Ga0207705_11254243 | 3300025909 | Bacteria | 567 |
| 359 | Ga0207684_10036198 | 3300025910 | Bacteria | 4190 |
| 360 | Ga0207684_10107995 | 3300025910 | Bacteria | 2381 |
| 361 | Ga0207684_10109290 | 3300025910 | Bacteria | 2367 |
| 362 | Ga0207684_10111517 | 3300025910 | Bacteria | 2341 |
| 363 | Ga0207684_10526175 | 3300025910 | Bacteria | 1012 |
| 364 | Ga0207684_11011141 | 3300025910 | Bacteria | 695 |
| 365 | Ga0207684_11103520 | 3300025910 | Unclassified | 660 |
| 366 | Ga0207684_11437160 | 3300025910 | Bacteria | 563 |
| 367 | Ga0207654_10343363 | 3300025911 | Bacteria | 1026 |
| 368 | Ga0207707_10081698 | 3300025912 | Bacteria | 2821 |
| 369 | Ga0207707_10092722 | 3300025912 | Bacteria | 2639 |
| 370 | Ga0207707_10180584 | 3300025912 | Bacteria | 1842 |
| 371 | Ga0207707_11377222 | 3300025912 | Bacteria | 564 |
| 372 | Ga0207695_10081352 | 3300025913 | Bacteria | 3278 |
| 373 | Ga0207695_10328150 | 3300025913 | Bacteria | 1419 |
| 374 | Ga0207695_10659521 | 3300025913 | Bacteria | 927 |
| 375 | Ga0207695_10681020 | 3300025913 | Bacteria | 909 |
| 376 | Ga0207695_10787886 | 3300025913 | Bacteria | 831 |
| 377 | Ga0207671_10127353 | 3300025914 | Bacteria | 1952 |
| 378 | Ga0207671_10621897 | 3300025914 | Bacteria | 860 |
| 379 | Ga0207693_10002509 | 3300025915 | Bacteria | 15962 |
| 380 | Ga0207693_10003726 | 3300025915 | Bacteria | 12990 |
| 381 | Ga0207693_10005566 | 3300025915 | Bacteria | 10480 |
| 382 | Ga0207693_10063592 | 3300025915 | Bacteria | 2891 |
| 383 | Ga0207693_10114287 | 3300025915 | Bacteria | 2118 |
| 384 | Ga0207693_10407127 | 3300025915 | Bacteria | 1063 |
| 385 | Ga0207693_10781804 | 3300025915 | Bacteria | 736 |
| 386 | Ga0207693_10805310 | 3300025915 | Bacteria | 724 |
| 387 | Ga0207693_10993148 | 3300025915 | Bacteria | 641 |
| 388 | Ga0207663_10008683 | 3300025916 | Bacteria | 5331 |
| 389 | Ga0207663_10029080 | 3300025916 | Bacteria | 3241 |
| 390 | Ga0207663_10175499 | 3300025916 | Bacteria | 1526 |
| 391 | Ga0207663_10177501 | 3300025916 | Bacteria | 1518 |
| 392 | Ga0207663_10186613 | 3300025916 | Bacteria | 1485 |
| 393 | Ga0207663_11441093 | 3300025916 | Bacteria | 555 |
| 394 | Ga0207660_10121011 | 3300025917 | Bacteria | 1982 |
| 395 | Ga0207660_10159899 | 3300025917 | Bacteria | 1737 |
| 396 | Ga0207660_10217036 | 3300025917 | Bacteria | 1500 |
| 397 | Ga0207660_10265521 | 3300025917 | Bacteria | 1358 |
| 398 | Ga0207660_10397191 | 3300025917 | Bacteria | 1110 |
| 399 | Ga0207662_10082887 | 3300025918 | Bacteria | 1959 |
| 400 | Ga0207657_10003380 | 3300025919 | Bacteria | 17064 |
| 401 | Ga0207657_10242734 | 3300025919 | Bacteria | 1438 |
| 402 | Ga0207657_11333649 | 3300025919 | Bacteria | 541 |
| 403 | Ga0207649_10138597 | 3300025920 | Bacteria | 1661 |
| 404 | Ga0207649_10948431 | 3300025920 | Bacteria | 676 |
| 405 | Ga0207649_11260909 | 3300025920 | Bacteria | 584 |
| 406 | Ga0207652_10108965 | 3300025921 | Bacteria | 2454 |
| 407 | Ga0207652_10110845 | 3300025921 | Bacteria | 2433 |
| 408 | Ga0207652_10162728 | 3300025921 | Bacteria | 2000 |
| 409 | Ga0207652_10226635 | 3300025921 | Bacteria | 1684 |
| 410 | Ga0207646_10000936 | 3300025922 | Bacteria | 37493 |
| 411 | Ga0207646_10073077 | 3300025922 | Bacteria | 3063 |
| 412 | Ga0207646_10204141 | 3300025922 | Bacteria | 1785 |
| 413 | Ga0207646_10209955 | 3300025922 | Bacteria | 1758 |
| 414 | Ga0207646_10330432 | 3300025922 | Bacteria | 1377 |
| 415 | Ga0207646_10463049 | 3300025922 | Bacteria | 1143 |
| 416 | Ga0207646_10491441 | 3300025922 | Bacteria | 1106 |
| 417 | Ga0207646_10899189 | 3300025922 | Bacteria | 785 |
| 418 | Ga0207646_11234145 | 3300025922 | Bacteria | 655 |
| 419 | Ga0207694_10387095 | 3300025924 | Bacteria | 1161 |
| 420 | Ga0207694_10502094 | 3300025924 | Bacteria | 1016 |
| 421 | Ga0207694_11587120 | 3300025924 | Bacteria | 552 |
| 422 | Ga0207687_10076838 | 3300025927 | Bacteria | 2400 |
| 423 | Ga0207687_10223150 | 3300025927 | Bacteria | 1485 |
| 424 | Ga0207687_10622236 | 3300025927 | Bacteria | 911 |
| 425 | Ga0207687_10790310 | 3300025927 | Bacteria | 809 |
| 426 | Ga0207687_11092611 | 3300025927 | Bacteria | 685 |
| 427 | Ga0207687_11521226 | 3300025927 | Bacteria | 575 |
| 428 | Ga0207700_10017365 | 3300025928 | Bacteria | 4805 |
| 429 | Ga0207700_10020498 | 3300025928 | Bacteria | 4492 |
| 430 | Ga0207700_10173557 | 3300025928 | Bacteria | 1800 |
| 431 | Ga0207700_10804538 | 3300025928 | Bacteria | 841 |
| 432 | Ga0207700_11012966 | 3300025928 | Bacteria | 743 |
| 433 | Ga0207664_10059046 | 3300025929 | Bacteria | 3053 |
| 434 | Ga0207664_10079324 | 3300025929 | Bacteria | 2665 |
| 435 | Ga0207664_10089972 | 3300025929 | Bacteria | 2514 |
| 436 | Ga0207664_10092539 | 3300025929 | Bacteria | 2482 |
| 437 | Ga0207664_10115576 | 3300025929 | Bacteria | 2237 |
| 438 | Ga0207664_10146051 | 3300025929 | Bacteria | 2006 |
| 439 | Ga0207664_10663217 | 3300025929 | Bacteria | 938 |
| 440 | Ga0207664_10782853 | 3300025929 | Bacteria | 858 |
| 441 | Ga0207664_10923296 | 3300025929 | Bacteria | 783 |
| 442 | Ga0207644_10081402 | 3300025931 | Bacteria | 2393 |
| 443 | Ga0207644_11858676 | 3300025931 | Bacteria | 504 |
| 444 | Ga0207690_10045471 | 3300025932 | Bacteria | 2900 |
| 445 | Ga0207690_10194436 | 3300025932 | Bacteria | 1536 |
| 446 | Ga0207690_10394531 | 3300025932 | Bacteria | 1102 |
| 447 | Ga0207690_11165102 | 3300025932 | Bacteria | 643 |
| 448 | Ga0207690_11721983 | 3300025932 | Bacteria | 524 |
| 449 | Ga0207706_10016899 | 3300025933 | Bacteria | 6581 |
| 450 | Ga0207706_10158288 | 3300025933 | Bacteria | 1991 |
| 451 | Ga0207686_10044996 | 3300025934 | Bacteria | 2713 |
| 452 | Ga0207686_10180031 | 3300025934 | Bacteria | 1498 |
| 453 | Ga0207686_10208930 | 3300025934 | Bacteria | 1402 |
| 454 | Ga0207669_10378034 | 3300025937 | Bacteria | 1103 |
| 455 | Ga0207669_11637510 | 3300025937 | Bacteria | 549 |
| 456 | Ga0207704_10699347 | 3300025938 | Bacteria | 839 |
| 457 | Ga0207704_10842662 | 3300025938 | Bacteria | 768 |
| 458 | Ga0207704_11338272 | 3300025938 | Bacteria | 613 |
| 459 | Ga0207665_10000230 | 3300025939 | Bacteria | 38061 |
| 460 | Ga0207665_10019435 | 3300025939 | Bacteria | 4466 |
| 461 | Ga0207665_10048100 | 3300025939 | Bacteria | 2861 |
| 462 | Ga0207665_10532652 | 3300025939 | Bacteria | 911 |
| 463 | Ga0207665_11016874 | 3300025939 | Bacteria | 660 |
| 464 | Ga0207691_10908111 | 3300025940 | Bacteria | 737 |
| 465 | Ga0207711_10632484 | 3300025941 | Bacteria | 998 |
| 466 | Ga0207711_10664095 | 3300025941 | Bacteria | 972 |
| 467 | Ga0207689_11032715 | 3300025942 | Bacteria | 693 |
| 468 | Ga0207661_10088614 | 3300025944 | Bacteria | 2573 |
| 469 | Ga0207661_10471359 | 3300025944 | Bacteria | 1145 |
| 470 | Ga0207661_10976185 | 3300025944 | Bacteria | 780 |
| 471 | Ga0207667_10491424 | 3300025949 | Bacteria | 1245 |
| 472 | Ga0207667_11298931 | 3300025949 | Bacteria | 704 |
| 473 | Ga0207651_10254202 | 3300025960 | Bacteria | 1439 |
| 474 | Ga0207712_10830199 | 3300025961 | Bacteria | 814 |
| 475 | Ga0207668_10585035 | 3300025972 | Bacteria | 971 |
| 476 | Ga0207668_11266904 | 3300025972 | Bacteria | 663 |
| 477 | Ga0207668_11628266 | 3300025972 | Bacteria | 583 |
| 478 | Ga0207640_10784382 | 3300025981 | Bacteria | 824 |
| 479 | Ga0207640_11379383 | 3300025981 | Bacteria | 631 |
| 480 | Ga0207640_11582434 | 3300025981 | Bacteria | 590 |
| 481 | Ga0207658_10136684 | 3300025986 | Bacteria | 1978 |
| 482 | Ga0207677_10516760 | 3300026023 | Bacteria | 1035 |
| 483 | Ga0207677_10643678 | 3300026023 | Bacteria | 935 |
| 484 | Ga0207639_10234939 | 3300026041 | Bacteria | 1591 |
| 485 | Ga0207639_10420660 | 3300026041 | Bacteria | 1208 |
| 486 | Ga0207678_10510240 | 3300026067 | Bacteria | 1049 |
| 487 | Ga0207678_10523706 | 3300026067 | Bacteria | 1035 |
| 488 | Ga0207708_10042459 | 3300026075 | Bacteria | 3466 |
| 489 | Ga0207708_10046313 | 3300026075 | Bacteria | 3312 |
| 490 | Ga0207702_10087231 | 3300026078 | Bacteria | 2723 |
| 491 | Ga0207702_10412048 | 3300026078 | Bacteria | 1305 |
| 492 | Ga0207702_10715240 | 3300026078 | Bacteria | 987 |
| 493 | Ga0207648_10252349 | 3300026089 | Bacteria | 1573 |
| 494 | Ga0207648_10306945 | 3300026089 | Bacteria | 1424 |
| 495 | Ga0207674_10328944 | 3300026116 | Bacteria | 1478 |
| 496 | Ga0207675_100068242 | 3300026118 | Bacteria | 3324 |
| 497 | Ga0207675_100140348 | 3300026118 | Bacteria | 2295 |
| 498 | Ga0207675_100583421 | 3300026118 | Bacteria | 1120 |
| 499 | Ga0207683_10007722 | 3300026121 | Bacteria | 9212 |
| 500 | Ga0207683_10111769 | 3300026121 | Bacteria | 2446 |
| 501 | Ga0207683_10402975 | 3300026121 | Bacteria | 1259 |
| 502 | Ga0207683_10631204 | 3300026121 | Bacteria | 992 |
| 503 | Ga0207698_10159279 | 3300026142 | Bacteria | 1972 |
| 504 | Ga0207698_10548287 | 3300026142 | Bacteria | 1133 |
| 505 | Ga0207698_10860971 | 3300026142 | Bacteria | 912 |
| 506 | Ga0207428_10522570 | 3300027907 | Bacteria | 860 |
| 507 | Ga0268266_10615230 | 3300028379 | Bacteria | 1044 |
| 508 | Ga0268265_10593213 | 3300028380 | Bacteria | 1058 |
| 509 | Ga0265319_1047156 | 3300028563 | Bacteria | 1435 |
| 510 | Ga0265319_1053693 | 3300028563 | Bacteria | 1323 |
| 511 | Ga0265336_10004455 | 3300028666 | Bacteria | 5289 |
| 512 | Ga0265338_10004047 | 3300028800 | Bacteria | 20111 |
| 513 | Ga0265338_10011160 | 3300028800 | Bacteria | 10413 |
| 514 | Ga0265338_10071644 | 3300028800 | Bacteria | 2963 |
| 515 | Ga0265324_10013354 | 3300029957 | Bacteria | 3067 |
| 516 | Ga0265316_10448734 | 3300031344 | Bacteria | 925 |
| 517 | Ga0307408_100521740 | 3300031548 | Bacteria | 1043 |
| 518 | Ga0265313_10019590 | 3300031595 | Bacteria | 3760 |
| 519 | Ga0307405_12143020 | 3300031731 | Bacteria | 502 |
| 520 | Ga0307410_10304009 | 3300031852 | Bacteria | 1260 |
| 521 | Ga0307410_10740285 | 3300031852 | Bacteria | 832 |
| 522 | Ga0307409_100446737 | 3300031995 | Bacteria | 1247 |
| 523 | Ga0307409_102057718 | 3300031995 | Bacteria | 601 |
| 524 | Ga0307415_102392727 | 3300032126 | Bacteria | 519 |
| 525 | Ga0373950_0004669 | 3300034818 | Bacteria | 2014 |
| 526 | Ga0373938_0001439 | 3300034957 | Bacteria | 3810 |
| 527 | Ga0373926_0017537 | 3300035083 | Bacteria | 2458 |
| 528 | Ga0373929_0225702 | 3300035085 | Bacteria | 534 |
| 529 | Ga0373934_0011684 | 3300035086 | Bacteria | 3306 |
| 530 | Ga0373944_0292858 | 3300035089 | Bacteria | 609 |
| 531 | Ga0373949_0002626 | 3300035090 | Bacteria | 4548 |
| 532 | Ga0373949_0123305 | 3300035090 | Bacteria | 729 |
| 533 | Ga0373951_0038797 | 3300035091 | Bacteria | 1143 |
| 534 | Ga0373952_0067614 | 3300035092 | Bacteria | 887 |
| 535 | Ga0373923_0200692 | 3300035111 | Bacteria | 922 |
| 536 | Ga0373932_0110406 | 3300035112 | Bacteria | 906 |
| 537 | Ga0373936_0031578 | 3300035113 | Bacteria | 2092 |
| 538 | Ga0373936_0172573 | 3300035113 | Bacteria | 946 |
| 539 | Ga0373941_0006178 | 3300035115 | Bacteria | 2870 |
| 540 | Ga0373956_0216848 | 3300035119 | Bacteria | 908 |
| 541 | Ga0373957_0184940 | 3300035120 | Bacteria | 865 |
| 542 | Ga0373960_0006663 | 3300035121 | Bacteria | 2716 |
| 543 | Ga0373960_0134212 | 3300035121 | Bacteria | 833 |
| 544 | Ga0373960_0185347 | 3300035121 | Bacteria | 729 |
| 545 | Ga0373943_0002421 | 3300035170 | Bacteria | 8464 |
| 546 | Ga0373943_0028710 | 3300035170 | Bacteria | 2623 |
| 547 | Ga0373946_0002116 | 3300035171 | Bacteria | 6962 |
| 548 | Ga0373946_0167905 | 3300035171 | Bacteria | 1034 |
| 549 | Ga0373955_0074369 | 3300035172 | Bacteria | 1907 |
| 550 | Ga0373955_0103154 | 3300035172 | Bacteria | 1640 |
| 551 | Ga0373955_0850858 | 3300035172 | Bacteria | 561 |
| 552 | Ga0373955_0859157 | 3300035172 | Bacteria | 558 |
| 553 | Ga0373962_0002688 | 3300035242 | Bacteria | 4230 |
| 554 | Ga0373924_0059514 | 3300035410 | Bacteria | 1596 |
| 555 | Ga0373931_0018638 | 3300035691 | Bacteria | 3453 |
| 556 | Ga0373935_0842581 | 3300035692 | Bacteria | 678 |
| 557 | Ga0373935_1398658 | 3300035692 | Bacteria | 523 |
| 558 | Ga0373927_0014469 | 3300035695 | Bacteria | 5222 |
| 559 | Ga0373927_0063211 | 3300035695 | Bacteria | 2394 |
| 560 | Ga0373933_0138581 | 3300035724 | Bacteria | 1534 |
| 561 | Ga0373933_0384028 | 3300035724 | Bacteria | 915 |
| 562 | Ga0373947_0000358 | 3300035725 | Bacteria | 25937 |
| 563 | Ga0373947_0017957 | 3300035725 | Bacteria | 4071 |
| 564 | Ga0373937_0000364 | 3300036401 | Bacteria | 42155 |
| 565 | Ga0373937_0696814 | 3300036401 | Bacteria | 962 |
| 566 | Ga0373925_0005599 | 3300037068 | Bacteria | 9352 |
| 567 | Ga0395899_0007078 | 3300037312 | Bacteria | 8684 |
| 568 | Ga0395899_0037763 | 3300037312 | Bacteria | 3619 |
| 569 | Ga0395899_0404662 | 3300037312 | Bacteria | 902 |
| 570 | Ga0395899_0520906 | 3300037312 | Bacteria | 768 |
| 571 | Ga0395900_0008224 | 3300037418 | Bacteria | 10742 |
| 572 | Ga0395900_0084886 | 3300037418 | Bacteria | 3254 |
| 573 | Ga0395900_0159853 | 3300037418 | Bacteria | 2298 |
| 574 | Ga0395900_0202406 | 3300037418 | Bacteria | 2008 |
| 575 | Ga0395900_0363159 | 3300037418 | Bacteria | 1419 |
| 576 | Ga0395900_0412002 | 3300037418 | Bacteria | 1314 |
| 577 | Ga0395900_0486073 | 3300037418 | Bacteria | 1186 |
| 578 | Ga0395900_0524699 | 3300037418 | Bacteria | 1132 |
| 579 | Ga0395900_0573444 | 3300037418 | Bacteria | 1071 |
| 580 | Ga0395900_0584668 | 3300037418 | Bacteria | 1058 |
| 581 | Ga0395900_0615922 | 3300037418 | Bacteria | 1025 |
| 582 | Ga0395900_0812093 | 3300037418 | Bacteria | 863 |
| 583 | Ga0395898_0010596 | 3300037466 | Bacteria | 9626 |
| 584 | Ga0395898_0120165 | 3300037466 | Bacteria | 2517 |
| 585 | Ga0395898_0138381 | 3300037466 | Bacteria | 2331 |
| 586 | Ga0395898_0186974 | 3300037466 | Bacteria | 1979 |
| 587 | Ga0395898_0188085 | 3300037466 | Bacteria | 1973 |
| 588 | Ga0395898_0191172 | 3300037466 | Bacteria | 1955 |
| 589 | Ga0395898_0254243 | 3300037466 | Bacteria | 1675 |
| 590 | Ga0395898_0368039 | 3300037466 | Bacteria | 1371 |
| 591 | Ga0395898_0432031 | 3300037466 | Bacteria | 1255 |
| 592 | Ga0395898_0435617 | 3300037466 | Bacteria | 1249 |
| 593 | Ga0395898_0669570 | 3300037466 | Bacteria | 980 |
| 594 | Ga0395898_1597140 | 3300037466 | Bacteria | 576 |
| 595 | Ga0395905_0012735 | 3300037471 | Bacteria | 8089 |
| 596 | Ga0395905_0015099 | 3300037471 | Bacteria | 7352 |
| 597 | Ga0395905_0150043 | 3300037471 | Bacteria | 2193 |
| 598 | Ga0395905_0205684 | 3300037471 | Bacteria | 1845 |
| 599 | Ga0395905_0244456 | 3300037471 | Bacteria | 1676 |
| 600 | Ga0395905_0301824 | 3300037471 | Bacteria | 1489 |
| 601 | Ga0436364_0191199 | 3300037853 | Bacteria | 664 |
| 602 | Ga0436364_0679884 | 3300037853 | Bacteria | 1032 |
| 603 | Ga0436364_1332041 | 3300037853 | Bacteria | 1000 |
| 604 | Ga0395901_0008511 | 3300038443 | Bacteria | 10368 |
| 605 | Ga0395901_0017661 | 3300038443 | Bacteria | 7282 |
| 606 | Ga0395901_0019438 | 3300038443 | Bacteria | 6946 |
| 607 | Ga0395901_0054258 | 3300038443 | Bacteria | 4165 |
| 608 | Ga0395901_0092066 | 3300038443 | Bacteria | 3174 |
| 609 | Ga0395901_0160727 | 3300038443 | Bacteria | 2359 |
| 610 | Ga0395901_0169937 | 3300038443 | Bacteria | 2288 |
| 611 | Ga0395901_0205400 | 3300038443 | Bacteria | 2064 |
| 612 | Ga0395901_0296266 | 3300038443 | Bacteria | 1677 |
| 613 | Ga0395901_0444582 | 3300038443 | Bacteria | 1326 |
| 614 | Ga0395901_0588956 | 3300038443 | Bacteria | 1123 |
| 615 | Ga0395901_0670254 | 3300038443 | Bacteria | 1038 |
| 616 | Ga0395901_0728767 | 3300038443 | Bacteria | 986 |
| 617 | Ga0395901_0745372 | 3300038443 | Bacteria | 973 |
| 618 | Ga0436365_0702942 | 3300039437 | Bacteria | 1250 |
| 619 | Ga0436365_0724570 | 3300039437 | Bacteria | 1251 |
| 620 | Ga0436365_1560342 | 3300039437 | Bacteria | 9407 |
| 621 | Ga0436363_0683573 | 3300039450 | Bacteria | 965 |
| 622 | Ga0436363_1398587 | 3300039450 | Bacteria | 830 |
| 623 | Ga0436363_1546757 | 3300039450 | Bacteria | 608 |
| 624 | Ga0436362_0735388 | 3300039453 | Bacteria | 4696 |
| 625 | Ga0451849_1029388 | 3300041505 | Bacteria | 663 |
| 626 | Ga0451855_0037803 | 3300041511 | Bacteria | 598 |
| 627 | Ga0451577_0777262 | 3300042876 | Bacteria | 866 |
| 628 | Ga0466969_0007451 | 3300044656 | Bacteria | 5814 |
| 629 | Ga0466969_0009459 | 3300044656 | Bacteria | 5168 |
| 630 | Ga0466969_0431485 | 3300044656 | Bacteria | 599 |
| 631 | Ga0466969_0502956 | 3300044656 | Bacteria | 553 |
| 632 | Ga0466972_0405425 | 3300044658 | Unclassified | 639 |
| 633 | Ga0466965_0043621 | 3300044683 | Bacteria | 2215 |
| 634 | Ga0466965_0094864 | 3300044683 | Bacteria | 1521 |
| 635 | Ga0466965_0175187 | 3300044683 | Bacteria | 1130 |
| 636 | Ga0466965_0425553 | 3300044683 | Bacteria | 736 |
| 637 | Ga0466965_0629112 | 3300044683 | Bacteria | 611 |
| 638 | Ga0466966_0062206 | 3300044684 | Bacteria | 2354 |
| 639 | Ga0466966_0089556 | 3300044684 | Bacteria | 1911 |
| 640 | Ga0466961_0019609 | 3300044693 | Bacteria | 4351 |
| 641 | Ga0466961_0019863 | 3300044693 | Bacteria | 4324 |
| 642 | Ga0466961_0089808 | 3300044693 | Bacteria | 1940 |
| 643 | Ga0466961_0518196 | 3300044693 | Bacteria | 719 |
| 644 | Ga0466963_0000976 | 3300044694 | Bacteria | 14710 |
| 645 | Ga0466963_0003259 | 3300044694 | Bacteria | 9256 |
| 646 | Ga0466963_0003688 | 3300044694 | Bacteria | 8813 |
| 647 | Ga0466963_0003971 | 3300044694 | Bacteria | 8557 |
| 648 | Ga0466963_0019898 | 3300044694 | Bacteria | 4217 |
| 649 | Ga0466963_0024992 | 3300044694 | Bacteria | 3805 |
| 650 | Ga0466963_0025030 | 3300044694 | Bacteria | 3803 |
| 651 | Ga0466963_0027857 | 3300044694 | Bacteria | 3622 |
| 652 | Ga0466963_0028906 | 3300044694 | Bacteria | 3563 |
| 653 | Ga0466963_0036641 | 3300044694 | Bacteria | 3199 |
| 654 | Ga0466963_0039810 | 3300044694 | Bacteria | 3079 |
| 655 | Ga0466963_0042103 | 3300044694 | Bacteria | 2998 |
| 656 | Ga0466963_0042869 | 3300044694 | Bacteria | 2972 |
| 657 | Ga0466963_0131225 | 3300044694 | Bacteria | 1731 |
| 658 | Ga0466963_0149065 | 3300044694 | Bacteria | 1624 |
| 659 | Ga0466963_0161445 | 3300044694 | Bacteria | 1559 |
| 660 | Ga0466963_1068509 | 3300044694 | Bacteria | 568 |
| 661 | Ga0466964_0034372 | 3300044706 | Bacteria | 2023 |
| 662 | Ga0466964_0063569 | 3300044706 | Bacteria | 1542 |
| 663 | Ga0466964_0073507 | 3300044706 | Bacteria | 1451 |
| 664 | Ga0466964_0184428 | 3300044706 | Bacteria | 991 |
| 665 | Ga0466964_0299697 | 3300044706 | Bacteria | 810 |
| 666 | Ga0466964_0811370 | 3300044706 | Bacteria | 529 |
| 667 | Ga0466971_0008681 | 3300044719 | Bacteria | 4434 |
| 668 | Ga0466971_0206481 | 3300044719 | Bacteria | 928 |
| 669 | Ga0466968_0032578 | 3300044735 | Bacteria | 2169 |
| 670 | Ga0466968_0054688 | 3300044735 | Bacteria | 1711 |
| 671 | Ga0466968_0070601 | 3300044735 | Bacteria | 1520 |
| 672 | Ga0466968_0100368 | 3300044735 | Bacteria | 1291 |
| 673 | Ga0466968_0105978 | 3300044735 | Bacteria | 1260 |
| 674 | Ga0466968_0127872 | 3300044735 | Bacteria | 1154 |
| 675 | Ga0466968_0158238 | 3300044735 | Bacteria | 1044 |
| 676 | Ga0466968_0159104 | 3300044735 | Bacteria | 1042 |
| 677 | Ga0466970_0102505 | 3300044765 | Bacteria | 1559 |
| 678 | Ga0466970_0130423 | 3300044765 | Bacteria | 1380 |
| 679 | Ga0466970_0134758 | 3300044765 | Bacteria | 1358 |
| 680 | Ga0466970_0384914 | 3300044765 | Bacteria | 799 |
| 681 | Ga0466957_0000999 | 3300044842 | Bacteria | 14560 |
| 682 | Ga0466957_0002541 | 3300044842 | Bacteria | 9818 |
| 683 | Ga0466957_0011104 | 3300044842 | Bacteria | 5184 |
| 684 | Ga0466957_0014542 | 3300044842 | Bacteria | 4584 |
| 685 | Ga0466957_0047463 | 3300044842 | Bacteria | 2609 |
| 686 | Ga0466957_0052402 | 3300044842 | Bacteria | 2484 |
| 687 | Ga0466957_0413442 | 3300044842 | Bacteria | 924 |
| 688 | Ga0466957_0844113 | 3300044842 | Bacteria | 652 |
| 689 | Ga0466957_0916111 | 3300044842 | Bacteria | 627 |
| 690 | Ga0466957_1269850 | 3300044842 | Bacteria | 534 |
| 691 | Ga0466960_0016679 | 3300044901 | Bacteria | 3191 |
| 692 | Ga0466960_0180054 | 3300044901 | Bacteria | 1145 |
| 693 | Ga0466960_0449217 | 3300044901 | Bacteria | 749 |
| 694 | Ga0466960_0564117 | 3300044901 | Bacteria | 673 |
| 695 | Ga0466959_0004426 | 3300045049 | Bacteria | 9411 |
| 696 | Ga0466959_0005274 | 3300045049 | Bacteria | 8830 |
| 697 | Ga0466959_0061762 | 3300045049 | Bacteria | 2724 |
| 698 | Ga0466959_0181921 | 3300045049 | Bacteria | 1470 |
| 699 | Ga0466959_0209346 | 3300045049 | Bacteria | 1355 |
| 700 | Ga0466959_0477766 | 3300045049 | Bacteria | 844 |
| 701 | Ga0466959_0923420 | 3300045049 | Bacteria | 582 |
| 702 | Ga0451576_1448588 | 3300045051 | Bacteria | 714 |
| 703 | Ga0466958_0000473 | 3300045836 | Bacteria | 16786 |
| 704 | Ga0466958_0009653 | 3300045836 | Bacteria | 5384 |
| 705 | Ga0466958_0013734 | 3300045836 | Bacteria | 4615 |
| 706 | Ga0466958_0066004 | 3300045836 | Bacteria | 2209 |
| 707 | Ga0466958_0086325 | 3300045836 | Bacteria | 1936 |
| 708 | Ga0466958_0164591 | 3300045836 | Bacteria | 1403 |
| 709 | Ga0466958_0189182 | 3300045836 | Bacteria | 1308 |
| 710 | Ga0466958_0289658 | 3300045836 | Bacteria | 1050 |
| 711 | Ga0466958_0844275 | 3300045836 | Bacteria | 597 |
| 712 | Ga0466967_0000270 | 3300045976 | Bacteria | 22873 |
| 713 | Ga0466967_0002301 | 3300045976 | Bacteria | 11793 |
| 714 | Ga0466967_0012958 | 3300045976 | Bacteria | 6414 |
| 715 | Ga0466967_0014116 | 3300045976 | Bacteria | 6206 |
| 716 | Ga0466967_0014987 | 3300045976 | Bacteria | 6062 |
| 717 | Ga0466967_0015687 | 3300045976 | Bacteria | 5949 |
| 718 | Ga0466967_0031484 | 3300045976 | Bacteria | 4465 |
| 719 | Ga0466967_0033693 | 3300045976 | Bacteria | 4339 |
| 720 | Ga0466967_0067230 | 3300045976 | Bacteria | 3196 |
| 721 | Ga0466967_0068999 | 3300045976 | Bacteria | 3158 |
| 722 | Ga0466967_0076564 | 3300045976 | Bacteria | 3010 |
| 723 | Ga0466967_0092675 | 3300045976 | Bacteria | 2747 |
| 724 | Ga0466967_0095075 | 3300045976 | Bacteria | 2715 |
| 725 | Ga0466967_0107801 | 3300045976 | Bacteria | 2555 |
| 726 | Ga0466967_0245581 | 3300045976 | Bacteria | 1708 |
| 727 | Ga0466967_0256932 | 3300045976 | Bacteria | 1670 |
| 728 | Ga0466967_0496448 | 3300045976 | Bacteria | 1197 |
| 729 | Ga0466967_0646496 | 3300045976 | Bacteria | 1045 |
| 730 | Ga0466967_0857272 | 3300045976 | Bacteria | 903 |
| 731 | Ga0466967_1206105 | 3300045976 | Bacteria | 754 |
| 732 | Ga0466967_1403421 | 3300045976 | Bacteria | 695 |
| 733 | Ga0466967_1438033 | 3300045976 | Bacteria | 687 |
| 734 | Ga0466967_1486521 | 3300045976 | Bacteria | 675 |
| 735 | Ga0466967_1566912 | 3300045976 | Bacteria | 656 |
| 736 | Ga0466967_2318396 | 3300045976 | Bacteria | 532 |
| 737 | Ga0495617_285845 | 3300046452 | Bacteria | 505 |
| 738 | Ga0495592_0000050 | 3300046454 | Bacteria | 111971 |
| 739 | Ga0495592_0078434 | 3300046454 | Bacteria | 2392 |
| 740 | Ga0495592_0281853 | 3300046454 | Bacteria | 1087 |
| 741 | Ga0495603_0095085 | 3300046455 | Bacteria | 1741 |
| 742 | Ga0495603_0141334 | 3300046455 | Bacteria | 1400 |
| 743 | Ga0495629_0000079 | 3300046459 | Bacteria | 85673 |
| 744 | Ga0495629_0015231 | 3300046459 | Bacteria | 5523 |
| 745 | Ga0495629_0024820 | 3300046459 | Bacteria | 4266 |
| 746 | Ga0495629_0079362 | 3300046459 | Bacteria | 2292 |
| 747 | Ga0495629_0299993 | 3300046459 | Bacteria | 1100 |
| 748 | Ga0495641_0000395 | 3300046461 | Bacteria | 36541 |
| 749 | Ga0495641_0005449 | 3300046461 | Bacteria | 8598 |
| 750 | Ga0495641_0036094 | 3300046461 | Bacteria | 2325 |
| 751 | Ga0495641_0168103 | 3300046461 | Bacteria | 981 |
| 752 | Ga0495641_0181441 | 3300046461 | Bacteria | 942 |
| 753 | Ga0495641_0230975 | 3300046461 | Bacteria | 830 |
| 754 | Ga0495651_0000004 | 3300046462 | Bacteria | 177080 |
| 755 | Ga0495651_0203014 | 3300046462 | Bacteria | 1386 |
| 756 | Ga0495651_0460820 | 3300046462 | Bacteria | 820 |
| 757 | Ga0495651_0860475 | 3300046462 | Bacteria | 556 |
| 758 | Ga0495653_0002246 | 3300046463 | Bacteria | 15275 |
| 759 | Ga0495653_0073719 | 3300046463 | Bacteria | 2546 |
| 760 | Ga0495653_0083989 | 3300046463 | Bacteria | 2346 |
| 761 | Ga0495653_0277779 | 3300046463 | Bacteria | 1100 |
| 762 | Ga0495653_0479634 | 3300046463 | Bacteria | 778 |
| 763 | Ga0495653_0530415 | 3300046463 | Bacteria | 731 |
| 764 | Ga0495580_0021128 | 3300046472 | Bacteria | 4806 |
| 765 | Ga0495580_0635193 | 3300046472 | Bacteria | 703 |
| 766 | Ga0495580_0798300 | 3300046472 | Bacteria | 612 |
| 767 | Ga0495582_0000498 | 3300046473 | Bacteria | 21485 |
| 768 | Ga0495582_0001645 | 3300046473 | Bacteria | 12598 |
| 769 | Ga0495582_0020615 | 3300046473 | Bacteria | 3609 |
| 770 | Ga0495582_0066708 | 3300046473 | Bacteria | 1988 |
| 771 | Ga0495582_0377667 | 3300046473 | Bacteria | 817 |
| 772 | Ga0495605_0090480 | 3300046474 | Bacteria | 1419 |
| 773 | Ga0495639_0001414 | 3300046475 | Bacteria | 10732 |
| 774 | Ga0495639_0002465 | 3300046475 | Bacteria | 8084 |
| 775 | Ga0495662_0000357 | 3300046476 | Bacteria | 20066 |
| 776 | Ga0495662_0008908 | 3300046476 | Bacteria | 4929 |
| 777 | Ga0495664_0021650 | 3300046477 | Bacteria | 3714 |
| 778 | Ga0495664_0091286 | 3300046477 | Bacteria | 1831 |
| 779 | Ga0495664_0106514 | 3300046477 | Bacteria | 1690 |
| 780 | Ga0495664_0335336 | 3300046477 | Bacteria | 911 |
| 781 | Ga0495584_0172812 | 3300046491 | Bacteria | 1098 |
| 782 | Ga0495594_0083209 | 3300046499 | Bacteria | 1789 |
| 783 | Ga0495594_0278029 | 3300046499 | Bacteria | 954 |
| 784 | Ga0495594_0657669 | 3300046499 | Bacteria | 593 |
| 785 | Ga0495607_0087075 | 3300046501 | Bacteria | 1701 |
| 786 | Ga0495607_0384161 | 3300046501 | Bacteria | 642 |
| 787 | Ga0495608_0010189 | 3300046511 | Bacteria | 6558 |
| 788 | Ga0495608_0046698 | 3300046511 | Bacteria | 2881 |
| 789 | Ga0495608_0269036 | 3300046511 | Bacteria | 1060 |
| 790 | Ga0495608_0289718 | 3300046511 | Bacteria | 1015 |
| 791 | Ga0495608_0338226 | 3300046511 | Bacteria | 928 |
| 792 | Ga0495616_0418587 | 3300046513 | Bacteria | 548 |
| 793 | Ga0495618_0002772 | 3300046514 | Bacteria | 11140 |
| 794 | Ga0495618_0071632 | 3300046514 | Bacteria | 2205 |
| 795 | Ga0495618_0233126 | 3300046514 | Bacteria | 1158 |
| 796 | Ga0495618_0361920 | 3300046514 | Bacteria | 892 |
| 797 | Ga0495618_0417489 | 3300046514 | Bacteria | 818 |
| 798 | Ga0495618_0480434 | 3300046514 | Bacteria | 751 |
| 799 | Ga0495628_0001466 | 3300046516 | Bacteria | 21651 |
| 800 | Ga0495628_0336856 | 3300046516 | Bacteria | 1111 |
| 801 | Ga0495628_0523930 | 3300046516 | Bacteria | 853 |
| 802 | Ga0495628_0997128 | 3300046516 | Bacteria | 576 |
| 803 | Ga0495628_0999330 | 3300046516 | Bacteria | 576 |
| 804 | Ga0495630_0012040 | 3300046517 | Bacteria | 6273 |
| 805 | Ga0495630_0068308 | 3300046517 | Bacteria | 2672 |
| 806 | Ga0495630_0106295 | 3300046517 | Bacteria | 2125 |
| 807 | Ga0495630_0121502 | 3300046517 | Bacteria | 1981 |
| 808 | Ga0495644_0080914 | 3300046523 | Bacteria | 1224 |
| 809 | Ga0495644_0293969 | 3300046523 | Bacteria | 635 |
| 810 | Ga0495644_0306392 | 3300046523 | Bacteria | 622 |
| 811 | Ga0495644_0424101 | 3300046523 | Bacteria | 528 |
| 812 | Ga0495663_0020477 | 3300046525 | Bacteria | 1899 |
| 813 | Ga0495666_0005352 | 3300046526 | Bacteria | 6472 |
| 814 | Ga0495666_0007050 | 3300046526 | Bacteria | 5647 |
| 815 | Ga0495642_0040718 | 3300046528 | Bacteria | 1888 |
| 816 | Ga0495642_0109508 | 3300046528 | Bacteria | 1180 |
| 817 | Ga0495642_0304997 | 3300046528 | Bacteria | 698 |
| 818 | Ga0495642_0526630 | 3300046528 | Bacteria | 524 |
| 819 | Ga0495652_0000512 | 3300046529 | Bacteria | 45282 |
| 820 | Ga0495652_0095428 | 3300046529 | Bacteria | 2423 |
| 821 | Ga0495652_0544886 | 3300046529 | Bacteria | 798 |
| 822 | Ga0495665_0009774 | 3300046531 | Bacteria | 5193 |
| 823 | Ga0495665_0017319 | 3300046531 | Bacteria | 3875 |
| 824 | Ga0495665_0073213 | 3300046531 | Bacteria | 1804 |
| 825 | Ga0495640_0005660 | 3300046533 | Bacteria | 9939 |
| 826 | Ga0495640_0021002 | 3300046533 | Bacteria | 4799 |
| 827 | Ga0495640_0050158 | 3300046533 | Bacteria | 2876 |
| 828 | Ga0495640_0535140 | 3300046533 | Bacteria | 711 |
| 829 | Ga0495586_0026830 | 3300046535 | Bacteria | 3082 |
| 830 | Ga0495586_0197260 | 3300046535 | Bacteria | 1141 |
| 831 | Ga0495587_0000103 | 3300046536 | Bacteria | 64471 |
| 832 | Ga0495587_0016237 | 3300046536 | Bacteria | 4635 |
| 833 | Ga0495587_0158570 | 3300046536 | Bacteria | 1288 |
| 834 | Ga0495587_0631420 | 3300046536 | Bacteria | 589 |
| 835 | Ga0495609_0065862 | 3300046538 | Bacteria | 1596 |
| 836 | Ga0495609_0161728 | 3300046538 | Bacteria | 949 |
| 837 | Ga0495645_0000028 | 3300046543 | Bacteria | 113461 |
| 838 | Ga0495645_0245080 | 3300046543 | Bacteria | 1194 |
| 839 | Ga0495645_0574941 | 3300046543 | Bacteria | 696 |
| 840 | Ga0495633_0421094 | 3300046558 | Bacteria | 604 |
| 841 | Ga0495667_0022355 | 3300046559 | Bacteria | 4260 |
| 842 | Ga0495667_0038516 | 3300046559 | Bacteria | 3183 |
| 843 | Ga0495667_0162994 | 3300046559 | Bacteria | 1434 |
| 844 | Ga0495667_0642442 | 3300046559 | Bacteria | 660 |
| 845 | Ga0495656_0032907 | 3300046615 | Bacteria | 2113 |
| 846 | Ga0495656_0491903 | 3300046615 | Unclassified | 650 |
| 847 | Ga0495634_0011663 | 3300046642 | Bacteria | 6392 |
| 848 | Ga0495634_0030047 | 3300046642 | Bacteria | 3756 |
| 849 | Ga0495634_0059295 | 3300046642 | Bacteria | 2550 |
| 850 | Ga0495634_0421466 | 3300046642 | Bacteria | 790 |
| 851 | Ga0495634_0778374 | 3300046642 | Bacteria | 547 |
| 852 | Ga0495634_0790517 | 3300046642 | Bacteria | 541 |
| 853 | Ga0495611_0084236 | 3300046648 | Bacteria | 1465 |
| 854 | Ga0495635_0030663 | 3300046663 | Bacteria | 3735 |
| 855 | Ga0495635_0101212 | 3300046663 | Bacteria | 1969 |
| 856 | Ga0495635_0111098 | 3300046663 | Bacteria | 1872 |
| 857 | Ga0495659_0045754 | 3300046664 | Bacteria | 1578 |
| 858 | Ga0495588_0147858 | 3300046674 | Bacteria | 1242 |
| 859 | Ga0495588_0694907 | 3300046674 | Bacteria | 532 |
| 860 | Ga0495588_0753874 | 3300046674 | Bacteria | 509 |
| 861 | Ga0495657_0045213 | 3300046675 | Bacteria | 2989 |
| 862 | Ga0495657_0164039 | 3300046675 | Bacteria | 1373 |
| 863 | Ga0495657_0181426 | 3300046675 | Bacteria | 1292 |
| 864 | Ga0495657_0338906 | 3300046675 | Bacteria | 891 |
| 865 | Ga0495599_0000059 | 3300046678 | Bacteria | 75747 |
| 866 | Ga0495599_0003876 | 3300046678 | Bacteria | 8798 |
| 867 | Ga0495599_0045100 | 3300046678 | Bacteria | 2764 |
| 868 | Ga0495599_0167274 | 3300046678 | Bacteria | 1357 |
| 869 | Ga0495599_0723638 | 3300046678 | Bacteria | 572 |
| 870 | Ga0495623_0000082 | 3300046679 | Bacteria | 56315 |
| 871 | Ga0495623_0645138 | 3300046679 | Bacteria | 546 |
| 872 | Ga0495646_0001107 | 3300046680 | Bacteria | 15705 |
| 873 | Ga0495646_0131137 | 3300046680 | Bacteria | 1411 |
| 874 | Ga0495646_0683157 | 3300046680 | Unclassified | 517 |
| 875 | Ga0495647_0000192 | 3300046681 | Bacteria | 16221 |
| 876 | Ga0495647_0000915 | 3300046681 | Bacteria | 8854 |
| 877 | Ga0495647_0058566 | 3300046681 | Bacteria | 1514 |
| 878 | Ga0495647_0068729 | 3300046681 | Bacteria | 1413 |
| 879 | Ga0495658_0001639 | 3300046683 | Bacteria | 11634 |
| 880 | Ga0495658_0012654 | 3300046683 | Bacteria | 4280 |
| 881 | Ga0495658_0130514 | 3300046683 | Bacteria | 1529 |
| 882 | Ga0495613_0006549 | 3300046689 | Bacteria | 8702 |
| 883 | Ga0495613_0018045 | 3300046689 | Bacteria | 5258 |
| 884 | Ga0495613_0061843 | 3300046689 | Bacteria | 2741 |
| 885 | Ga0495613_0348627 | 3300046689 | Bacteria | 1017 |
| 886 | Ga0495613_0542272 | 3300046689 | Bacteria | 779 |
| 887 | Ga0495613_0564630 | 3300046689 | Bacteria | 760 |
| 888 | Ga0495613_0839508 | 3300046689 | Bacteria | 598 |
| 889 | Ga0495624_0016141 | 3300046690 | Bacteria | 5029 |
| 890 | Ga0495624_0020887 | 3300046690 | Bacteria | 4350 |
| 891 | Ga0495624_0021625 | 3300046690 | Bacteria | 4263 |
| 892 | Ga0495624_0021818 | 3300046690 | Bacteria | 4243 |
| 893 | Ga0495671_0436888 | 3300046692 | Bacteria | 626 |
| 894 | Ga0495589_0071323 | 3300046794 | Bacteria | 1698 |
| 895 | Ga0495589_0096817 | 3300046794 | Bacteria | 1430 |
| 896 | Ga0495589_0273691 | 3300046794 | Bacteria | 786 |
| 897 | Ga0495600_0035122 | 3300046809 | Bacteria | 3255 |
| 898 | Ga0495600_0063462 | 3300046809 | Bacteria | 2414 |
| 899 | Ga0495600_0066737 | 3300046809 | Bacteria | 2352 |
| 900 | Ga0495600_0104747 | 3300046809 | Bacteria | 1843 |
| 901 | Ga0495600_0693338 | 3300046809 | Bacteria | 613 |
| 902 | Ga0495581_0005444 | 3300047315 | Bacteria | 7363 |
| 903 | Ga0495581_0013745 | 3300047315 | Bacteria | 4693 |
| 904 | Ga0495581_0031069 | 3300047315 | Bacteria | 3094 |
| 905 | Ga0495604_0000489 | 3300047317 | Bacteria | 34803 |
| 906 | Ga0495604_0083791 | 3300047317 | Bacteria | 2382 |
| 907 | Ga0495604_0195935 | 3300047317 | Bacteria | 1405 |
| 908 | Ga0495604_0675777 | 3300047317 | Bacteria | 657 |
| 909 | Ga0495604_0714389 | 3300047317 | Bacteria | 635 |
| 910 | Ga0495636_0046193 | 3300047318 | Bacteria | 1816 |
| 911 | Ga0495674_0012179 | 3300047319 | Bacteria | 8106 |
| 912 | Ga0495674_0032490 | 3300047319 | Bacteria | 4733 |
| 913 | Ga0495674_0239846 | 3300047319 | Bacteria | 1494 |
| 914 | Ga0495674_0456987 | 3300047319 | Bacteria | 1025 |
| 915 | Ga0495674_0570525 | 3300047319 | Bacteria | 899 |
| 916 | Ga0495674_0622308 | 3300047319 | Bacteria | 853 |
| 917 | Ga0495674_1030097 | 3300047319 | Bacteria | 629 |
| 918 | Ga0495676_0014130 | 3300047321 | Bacteria | 7150 |
| 919 | Ga0495676_0061383 | 3300047321 | Bacteria | 2940 |
| 920 | Ga0495676_0071264 | 3300047321 | Bacteria | 2672 |
| 921 | Ga0495676_0394964 | 3300047321 | Bacteria | 918 |
| 922 | Ga0495676_0428716 | 3300047321 | Bacteria | 874 |
| 923 | Ga0495680_0014870 | 3300047322 | Bacteria | 6728 |
| 924 | Ga0495680_0015545 | 3300047322 | Bacteria | 6565 |
| 925 | Ga0495680_0022819 | 3300047322 | Bacteria | 5212 |
| 926 | Ga0495680_0132702 | 3300047322 | Bacteria | 1828 |
| 927 | Ga0495680_0171467 | 3300047322 | Bacteria | 1571 |
| 928 | Ga0495680_0620374 | 3300047322 | Bacteria | 722 |
| 929 | Ga0495675_0000020 | 3300047444 | Bacteria | 111526 |
| 930 | Ga0495677_0085792 | 3300047445 | Bacteria | 1183 |
| 931 | Ga0495679_029221 | 3300047446 | Bacteria | 1800 |
| 932 | Ga0495685_101848 | 3300047447 | Bacteria | 948 |
| 933 | Ga0495684_0010136 | 3300047471 | Bacteria | 7288 |
| 934 | Ga0495684_0014390 | 3300047471 | Bacteria | 6087 |
| 935 | Ga0495684_0042889 | 3300047471 | Bacteria | 3464 |
| 936 | Ga0495684_0221776 | 3300047471 | Bacteria | 1386 |
| 937 | Ga0495684_0392372 | 3300047471 | Bacteria | 976 |
| 938 | Ga0495593_0002867 | 3300047673 | Bacteria | 10395 |
| 939 | Ga0495593_0003732 | 3300047673 | Bacteria | 9084 |
| 940 | Ga0495593_0178751 | 3300047673 | Bacteria | 1069 |
| 941 | Ga0495602_0002220 | 3300048088 | Bacteria | 19610 |
| 942 | Ga0495602_0394382 | 3300048088 | Bacteria | 988 |
| 943 | Ga0495602_0411899 | 3300048088 | Bacteria | 962 |
| 944 | Ga0495602_0773535 | 3300048088 | Bacteria | 646 |
| 945 | Ga0495614_0012211 | 3300048089 | Bacteria | 3772 |
| 946 | Ga0496100_0001246 | 3300048903 | Bacteria | 12391 |
| 947 | Ga0496100_0009574 | 3300048903 | Bacteria | 5444 |
| 948 | Ga0496100_0066333 | 3300048903 | Bacteria | 2394 |
| 949 | Ga0496100_0100749 | 3300048903 | Bacteria | 1990 |
| 950 | Ga0496100_0913174 | 3300048903 | Bacteria | 690 |
| 951 | Ga0496100_1176967 | 3300048903 | Bacteria | 604 |
| 952 | Ga0496100_1319307 | 3300048903 | Bacteria | 569 |
| 953 | Ga0496100_1661759 | 3300048903 | Unclassified | 505 |
| 954 | Ga0496101_0001915 | 3300048904 | Bacteria | 12580 |
| 955 | Ga0496101_0010442 | 3300048904 | Bacteria | 6133 |
| 956 | Ga0496101_0019660 | 3300048904 | Bacteria | 4615 |
| 957 | Ga0496101_0042900 | 3300048904 | Bacteria | 3230 |
| 958 | Ga0496101_0051870 | 3300048904 | Bacteria | 2956 |
| 959 | Ga0496101_0096254 | 3300048904 | Bacteria | 2209 |
| 960 | Ga0496101_0244165 | 3300048904 | Bacteria | 1398 |
| 961 | Ga0496101_0421492 | 3300048904 | Bacteria | 1052 |
| 962 | Ga0496101_0662881 | 3300048904 | Bacteria | 824 |
| 963 | Ga0496101_0705366 | 3300048904 | Bacteria | 796 |
| 964 | Ga0496102_0005766 | 3300048905 | Bacteria | 10528 |
| 965 | Ga0496102_0203083 | 3300048905 | Bacteria | 1868 |
| 966 | Ga0496102_0301868 | 3300048905 | Bacteria | 1509 |
| 967 | Ga0496102_0631837 | 3300048905 | Bacteria | 994 |
| 968 | Ga0496102_0705569 | 3300048905 | Bacteria | 932 |
| 969 | Ga0496102_1087374 | 3300048905 | Bacteria | 720 |
| 970 | Ga0496102_1171585 | 3300048905 | Bacteria | 688 |
| 971 | Ga0496102_1519274 | 3300048905 | Bacteria | 588 |
| 972 | Ga0496103_0019267 | 3300048906 | Bacteria | 4097 |
| 973 | Ga0496103_0039249 | 3300048906 | Bacteria | 2909 |
| 974 | Ga0496103_0046759 | 3300048906 | Bacteria | 2673 |
| 975 | Ga0496103_0049449 | 3300048906 | Bacteria | 2599 |
| 976 | Ga0496103_0158791 | 3300048906 | Bacteria | 1450 |
| 977 | Ga0496103_0498258 | 3300048906 | Bacteria | 779 |
| 978 | Ga0496104_0001405 | 3300048907 | Bacteria | 20859 |
| 979 | Ga0496104_0006013 | 3300048907 | Bacteria | 10640 |
| 980 | Ga0496104_0064981 | 3300048907 | Bacteria | 3461 |
| 981 | Ga0496104_0085084 | 3300048907 | Bacteria | 3018 |
| 982 | Ga0496104_0186041 | 3300048907 | Bacteria | 1987 |
| 983 | Ga0496104_0733074 | 3300048907 | Bacteria | 896 |
| 984 | Ga0496104_0837319 | 3300048907 | Bacteria | 826 |
| 985 | Ga0496105_0004151 | 3300048908 | Bacteria | 10869 |
| 986 | Ga0496105_0005415 | 3300048908 | Bacteria | 9684 |
| 987 | Ga0496105_0016110 | 3300048908 | Bacteria | 5962 |
| 988 | Ga0496105_0075992 | 3300048908 | Bacteria | 2773 |
| 989 | Ga0496105_0091688 | 3300048908 | Bacteria | 2509 |
| 990 | Ga0496105_0429086 | 3300048908 | Bacteria | 1046 |
| 991 | Ga0496106_0001651 | 3300048909 | Bacteria | 16749 |
| 992 | Ga0496106_0030857 | 3300048909 | Bacteria | 3995 |
| 993 | Ga0496106_0063649 | 3300048909 | Bacteria | 2804 |
| 994 | Ga0496106_0080080 | 3300048909 | Bacteria | 2508 |
| 995 | Ga0496106_0124447 | 3300048909 | Bacteria | 2018 |
| 996 | Ga0496106_0446812 | 3300048909 | Unclassified | 1039 |
| 997 | Ga0496106_0451964 | 3300048909 | Bacteria | 1032 |
| 998 | Ga0496106_0915193 | 3300048909 | Bacteria | 692 |
| 999 | Ga0496107_0005046 | 3300048910 | Bacteria | 9000 |
| 1000 | Ga0496107_0005295 | 3300048910 | Bacteria | 8814 |
| 1001 | Ga0496107_0041830 | 3300048910 | Bacteria | 3291 |
| 1002 | Ga0496107_0059600 | 3300048910 | Bacteria | 2762 |
| 1003 | Ga0496107_0069876 | 3300048910 | Bacteria | 2549 |
| 1004 | Ga0496107_0122079 | 3300048910 | Bacteria | 1919 |
| 1005 | Ga0496107_0396836 | 3300048910 | Bacteria | 1026 |
| 1006 | Ga0496107_0491744 | 3300048910 | Bacteria | 910 |
| 1007 | Ga0496107_0518920 | 3300048910 | Bacteria | 883 |
| 1008 | Ga0496107_0617469 | 3300048910 | Bacteria | 800 |
| 1009 | Ga0496107_1273177 | 3300048910 | Bacteria | 527 |
| 1010 | Ga0496108_0004075 | 3300048911 | Bacteria | 11725 |
| 1011 | Ga0496108_0032976 | 3300048911 | Bacteria | 4302 |
| 1012 | Ga0496108_0060508 | 3300048911 | Bacteria | 3187 |
| 1013 | Ga0496108_0076240 | 3300048911 | Bacteria | 2834 |
| 1014 | Ga0496108_0208203 | 3300048911 | Bacteria | 1697 |
| 1015 | Ga0496108_0383281 | 3300048911 | Bacteria | 1228 |
| 1016 | Ga0496108_0782237 | 3300048911 | Bacteria | 824 |
| 1017 | Ga0496108_1021057 | 3300048911 | Bacteria | 706 |
| 1018 | Ga0496109_0002734 | 3300048912 | Bacteria | 14791 |
| 1019 | Ga0496109_0007262 | 3300048912 | Bacteria | 9367 |
| 1020 | Ga0496109_0009989 | 3300048912 | Bacteria | 8104 |
| 1021 | Ga0496109_0043212 | 3300048912 | Bacteria | 4084 |
| 1022 | Ga0496109_0050159 | 3300048912 | Bacteria | 3801 |
| 1023 | Ga0496109_0060232 | 3300048912 | Bacteria | 3468 |
| 1024 | Ga0496109_0534003 | 3300048912 | Bacteria | 1107 |
| 1025 | Ga0496109_0732081 | 3300048912 | Bacteria | 927 |
| 1026 | Ga0496109_0757198 | 3300048912 | Bacteria | 909 |
| 1027 | Ga0496109_1011873 | 3300048912 | Bacteria | 768 |
| 1028 | Ga0496110_0005994 | 3300048913 | Bacteria | 9566 |
| 1029 | Ga0496110_0006906 | 3300048913 | Bacteria | 9027 |
| 1030 | Ga0496110_0019184 | 3300048913 | Bacteria | 5750 |
| 1031 | Ga0496110_0058623 | 3300048913 | Bacteria | 3391 |
| 1032 | Ga0496110_0082412 | 3300048913 | Bacteria | 2869 |
| 1033 | Ga0496110_0128935 | 3300048913 | Bacteria | 2283 |
| 1034 | Ga0496110_0289918 | 3300048913 | Bacteria | 1490 |
| 1035 | Ga0496110_0492530 | 3300048913 | Bacteria | 1116 |
| 1036 | Ga0496110_1087812 | 3300048913 | Bacteria | 707 |
| 1037 | Ga0496110_1659595 | 3300048913 | Unclassified | 549 |
| 1038 | Ga0496111_0002987 | 3300048914 | Bacteria | 10360 |
| 1039 | Ga0496111_0005014 | 3300048914 | Bacteria | 8424 |
| 1040 | Ga0496111_0048505 | 3300048914 | Bacteria | 3059 |
| 1041 | Ga0496111_0062217 | 3300048914 | Bacteria | 2706 |
| 1042 | Ga0496111_0063794 | 3300048914 | Bacteria | 2672 |
| 1043 | Ga0496111_0122762 | 3300048914 | Bacteria | 1919 |
| 1044 | Ga0496111_0128535 | 3300048914 | Bacteria | 1874 |
| 1045 | Ga0496111_0156796 | 3300048914 | Bacteria | 1689 |
| 1046 | Ga0496111_0235060 | 3300048914 | Bacteria | 1361 |
| 1047 | Ga0496112_0025273 | 3300048915 | Bacteria | 5702 |
| 1048 | Ga0496112_0025598 | 3300048915 | Bacteria | 5667 |
| 1049 | Ga0496112_0027137 | 3300048915 | Bacteria | 5520 |
| 1050 | Ga0496112_0034002 | 3300048915 | Bacteria | 4959 |
| 1051 | Ga0496112_0035931 | 3300048915 | Bacteria | 4829 |
| 1052 | Ga0496112_0041343 | 3300048915 | Bacteria | 4510 |
| 1053 | Ga0496112_0084521 | 3300048915 | Bacteria | 3139 |
| 1054 | Ga0496112_0099930 | 3300048915 | Bacteria | 2871 |
| 1055 | Ga0496112_0150133 | 3300048915 | Bacteria | 2297 |
| 1056 | Ga0496112_0165281 | 3300048915 | Bacteria | 2179 |
| 1057 | Ga0496112_0255522 | 3300048915 | Bacteria | 1702 |
| 1058 | Ga0496112_0284251 | 3300048915 | Bacteria | 1601 |
| 1059 | Ga0496113_0016574 | 3300048916 | Bacteria | 5093 |
| 1060 | Ga0496113_0017158 | 3300048916 | Bacteria | 5019 |
| 1061 | Ga0496113_0059425 | 3300048916 | Bacteria | 2880 |
| 1062 | Ga0496113_0065375 | 3300048916 | Bacteria | 2752 |
| 1063 | Ga0496113_0114162 | 3300048916 | Bacteria | 2106 |
| 1064 | Ga0496113_0139969 | 3300048916 | Bacteria | 1903 |
| 1065 | Ga0496113_0188689 | 3300048916 | Bacteria | 1636 |
| 1066 | Ga0496113_0267360 | 3300048916 | Bacteria | 1366 |
| 1067 | Ga0496114_0002140 | 3300048917 | Bacteria | 15016 |
| 1068 | Ga0496114_0002672 | 3300048917 | Bacteria | 13616 |
| 1069 | Ga0496114_0018746 | 3300048917 | Bacteria | 5600 |
| 1070 | Ga0496114_0019365 | 3300048917 | Bacteria | 5515 |
| 1071 | Ga0496114_0027986 | 3300048917 | Bacteria | 4622 |
| 1072 | Ga0496114_0033035 | 3300048917 | Bacteria | 4262 |
| 1073 | Ga0496114_0101199 | 3300048917 | Bacteria | 2460 |
| 1074 | Ga0496114_0521347 | 3300048917 | Bacteria | 1051 |
| 1075 | Ga0496114_0640457 | 3300048917 | Bacteria | 935 |
| 1076 | Ga0496114_1616071 | 3300048917 | Bacteria | 536 |
| 1077 | Ga0496115_0000585 | 3300048918 | Bacteria | 27950 |
| 1078 | Ga0496115_0007297 | 3300048918 | Bacteria | 8129 |
| 1079 | Ga0496115_0080930 | 3300048918 | Bacteria | 2645 |
| 1080 | Ga0496115_0204876 | 3300048918 | Bacteria | 1629 |
| 1081 | Ga0496115_0261855 | 3300048918 | Bacteria | 1422 |
| 1082 | Ga0496115_0426383 | 3300048918 | Bacteria | 1074 |
| 1083 | Ga0496115_0813921 | 3300048918 | Bacteria | 726 |
| 1084 | Ga0496120_0314546 | 3300048923 | Bacteria | 713 |
| 1085 | Ga0501034_0010198 | 3300049571 | Bacteria | 9800 |
| 1086 | Ga0501067_0015440 | 3300049583 | Bacteria | 4228 |
| 1087 | Ga0501067_0027925 | 3300049583 | Bacteria | 3127 |
| 1088 | Ga0501067_0085159 | 3300049583 | Bacteria | 1754 |
| 1089 | Ga0501067_0138575 | 3300049583 | Bacteria | 1354 |
| 1090 | Ga0501067_0229271 | 3300049583 | Bacteria | 1034 |
| 1091 | Ga0501067_0273825 | 3300049583 | Unclassified | 940 |
| 1092 | Ga0501067_0306430 | 3300049583 | Bacteria | 884 |
| 1093 | Ga0501067_0332949 | 3300049583 | Bacteria | 846 |
| 1094 | Ga0501068_0034577 | 3300049584 | Bacteria | 3014 |
| 1095 | Ga0501068_0045001 | 3300049584 | Bacteria | 2659 |
| 1096 | Ga0501069_0030920 | 3300049585 | Bacteria | 2942 |
| 1097 | Ga0501069_0054018 | 3300049585 | Bacteria | 2237 |
| 1098 | Ga0501069_0219751 | 3300049585 | Bacteria | 1104 |
| 1099 | Ga0501069_0235980 | 3300049585 | Bacteria | 1065 |
| 1100 | Ga0501070_0914725 | 3300049586 | Bacteria | 684 |
| 1101 | Ga0501071_0807987 | 3300049587 | Unclassified | 723 |
| 1102 | Ga0501074_0206166 | 3300049590 | Bacteria | 1401 |
| 1103 | nmdc:mga0yw44_496849_c1 | 3300050492 | Bacteria | 828 |
| 1104 | nmdc:mga05p37_1007111_c1 | 3300050507 | Bacteria | 884 |
| 1105 | nmdc:mga05p37_178825_c1 | 3300050507 | Bacteria | 2582 |
| 1106 | nmdc:mga05p37_2198235_c1 | 3300050507 | Bacteria | 512 |
| 1107 | nmdc:mga05p37_241638_c1 | 3300050507 | Bacteria | 2171 |
| 1108 | nmdc:mga05p37_265726_c1 | 3300050507 | Bacteria | 2052 |
| 1109 | nmdc:mga05p37_56996_c1 | 3300050507 | Bacteria | 4812 |
| 1110 | nmdc:mga05p37_891290_c1 | 3300050507 | Bacteria | 960 |
| 1111 | nmdc:mga05p37_899848_c1 | 3300050507 | Bacteria | 954 |
| 1112 | nmdc:mga06r32_379448_c1 | 3300050510 | Bacteria | 1396 |
| 1113 | nmdc:mga08y16_1200107_c1 | 3300050511 | Bacteria | 729 |
| 1114 | nmdc:mga08y16_848177_c1 | 3300050511 | Bacteria | 903 |
| 1115 | nmdc:mga0n895_186808_c1 | 3300050512 | Bacteria | 2103 |
| 1116 | nmdc:mga0n895_1974677_c1 | 3300050512 | Bacteria | 541 |
| 1117 | nmdc:mga0n895_33411_c1 | 3300050512 | Bacteria | 4945 |
| 1118 | nmdc:mga0n895_423816_c1 | 3300050512 | Bacteria | 1345 |
| 1119 | nmdc:mga0n895_46438_c1 | 3300050512 | Bacteria | 4243 |
| 1120 | nmdc:mga0n895_711644_c1 | 3300050512 | Bacteria | 1000 |
| 1121 | nmdc:mga0n895_847_c1 | 3300050512 | Bacteria | 21992 |
| 1122 | nmdc:mga0rr50_155726_c1 | 3300050513 | Bacteria | 1851 |
| 1123 | nmdc:mga0rr50_365036_c1 | 3300050513 | Bacteria | 1216 |
| 1124 | nmdc:mga0rr50_5592_c1 | 3300050513 | Bacteria | 7518 |
| 1125 | nmdc:mga0rr50_5894_c1 | 3300050513 | Bacteria | 7374 |
| 1126 | nmdc:mga0rr50_962792_c1 | 3300050513 | Bacteria | 727 |
| 1127 | nmdc:mga08x19_16693_c1 | 3300050514 | Bacteria | 4482 |
| 1128 | nmdc:mga08x19_990256_c1 | 3300050514 | Bacteria | 597 |
| 1129 | nmdc:mga0a205_1333523_c1 | 3300050515 | Bacteria | 565 |
| 1130 | nmdc:mga0a205_1452205_c1 | 3300050515 | Bacteria | 534 |
| 1131 | nmdc:mga0a205_148945_c1 | 3300050515 | Bacteria | 2240 |
| 1132 | nmdc:mga0a205_312249_c1 | 3300050515 | Bacteria | 1444 |
| 1133 | nmdc:mga0a205_337263_c1 | 3300050515 | Bacteria | 1376 |
| 1134 | nmdc:mga0a205_42197_c1 | 3300050515 | Bacteria | 4395 |
| 1135 | nmdc:mga0a205_6187_c1 | 3300050515 | Bacteria | 10805 |
| 1136 | nmdc:mga0a205_78063_c1 | 3300050515 | Bacteria | 3199 |
| 1137 | nmdc:mga0a205_93158_c1 | 3300050515 | Bacteria | 2911 |
| 1138 | Ga0495601_0000241 | 3300053077 | Bacteria | 29180 |
| 1139 | Ga0495601_0019881 | 3300053077 | Bacteria | 4098 |
| 1140 | Ga0495601_0213789 | 3300053077 | Bacteria | 1259 |
| 1141 | Ga0495601_0281774 | 3300053077 | Bacteria | 1083 |
| 1142 | Ga0495601_0437019 | 3300053077 | Bacteria | 847 |
| 1143 | Ga0495601_0512385 | 3300053077 | Bacteria | 773 |
| 1144 | Ga0495601_0567035 | 3300053077 | Bacteria | 730 |
| 1145 | Ga0495612_0040578 | 3300053078 | Bacteria | 1896 |
| 1146 | Ga0495612_0063787 | 3300053078 | Bacteria | 1528 |
| 1147 | Ga0495612_0195000 | 3300053078 | Bacteria | 892 |
| 1148 | Ga0495612_0195128 | 3300053078 | Bacteria | 892 |
| 1149 | Ga0495612_0292617 | 3300053078 | Unclassified | 729 |
| 1150 | Ga0495595_0041111 | 3300053084 | Bacteria | 2114 |
| 1151 | Ga0495595_0169794 | 3300053084 | Bacteria | 1079 |
| 1152 | Ga0495595_0192605 | 3300053084 | Bacteria | 1013 |
| 1153 | Ga0495595_0213821 | 3300053084 | Bacteria | 961 |
| 1154 | Ga0495619_0000316 | 3300053085 | Bacteria | 33863 |
| 1155 | Ga0495619_0013004 | 3300053085 | Bacteria | 5243 |
| 1156 | Ga0495619_0068141 | 3300053085 | Bacteria | 2377 |
| 1157 | Ga0495619_0383402 | 3300053085 | Bacteria | 971 |
| 1158 | Ga0495619_0487468 | 3300053085 | Bacteria | 848 |
| 1159 | Ga0495619_0678216 | 3300053085 | Bacteria | 702 |
| 1160 | Ga0500566_0163371 | 3300053094 | Bacteria | 1158 |
| 1161 | Ga0500657_237105 | 3300053728 | Bacteria | 559 |
| 1162 | Ga0466962_0014079 | 3300061719 | Bacteria | 3853 |
| 1163 | Ga0466962_0028724 | 3300061719 | Bacteria | 2664 |
| 1164 | Ga0466962_0051595 | 3300061719 | Bacteria | 1967 |
| 1165 | Ga0466962_0106117 | 3300061719 | Unclassified | 1351 |
| 1166 | Ga0530510_0332076 | 3300061734 | Bacteria | 1141 |
| 1167 | Ga0530510_1100268 | 3300061734 | Bacteria | 609 |
| 1168 | Ga0496100_0618928 | |||
| 1169 | Ga0070658_10030658 | |||
| 1170 | Ga0070658_11623482 | |||
| 1171 | Ga0070683_100176541 | |||
| 1172 | Ga0070683_100517700 | |||
| 1173 | Ga0070683_102128403 | |||
| 1174 | Ga0070690_100983650 | |||
| 1175 | Ga0070680_100088856 | |||
| 1176 | Ga0070680_100154856 | |||
| 1177 | Ga0070680_100256194 | |||
| 1178 | Ga0070680_100439784 | |||
| 1179 | Ga0070680_100517735 | |||
| 1180 | Ga0070682_100020779 | |||
| 1181 | Ga0070682_100110921 | |||
| 1182 | Ga0070682_100547466 | |||
| 1183 | Ga0068868_100152685 | |||
| 1184 | Ga0068868_100339838 | |||
| 1185 | Ga0068868_101772299 | |||
| 1186 | Ga0070660_100055632 | |||
| 1187 | Ga0070660_100195910 | |||
| 1188 | Ga0070691_10301628 | |||
| 1189 | Ga0070691_10450770 | |||
| 1190 | Ga0070691_10457620 | |||
| 1191 | Ga0070687_100119355 | |||
| 1192 | Ga0070661_100530815 | |||
| 1193 | Ga0070661_100539365 | |||
| 1194 | Ga0070661_100601107 | |||
| 1195 | Ga0070661_101940059 | |||
| 1196 | Ga0070692_10020730 | |||
| 1197 | Ga0070671_100029992 | |||
| 1198 | Ga0070674_100061979 | |||
| 1199 | Ga0070674_100294806 | |||
| 1200 | Ga0070673_101323316 | |||
| 1201 | Ga0070688_101528228 | |||
| 1202 | Ga0070659_100064124 | |||
| 1203 | Ga0070659_100071805 | |||
| 1204 | Ga0070659_100213213 | |||
| 1205 | Ga0070659_101789792 | |||
| 1206 | Ga0070709_10390046 | |||
| 1207 | Ga0070709_10406023 | |||
| 1208 | Ga0070709_11460248 | |||
| 1209 | Ga0070714_100162757 | |||
| 1210 | Ga0070714_100457498 | |||
| 1211 | Ga0070714_100520205 | |||
| 1212 | Ga0070714_100869971 | |||
| 1213 | Ga0070714_101457666 | |||
| 1214 | Ga0070714_101481058 | |||
| 1215 | Ga0070714_102193712 | |||
| 1216 | Ga0070713_100089645 | |||
| 1217 | Ga0070713_100216781 | |||
| 1218 | Ga0070713_101537750 | |||
| 1219 | Ga0070710_10002761 | |||
| 1220 | Ga0070710_10017693 | |||
| 1221 | Ga0070710_10393843 | |||
| 1222 | Ga0070710_11381646 | |||
| 1223 | Ga0070701_10124779 | |||
| 1224 | Ga0070711_100004862 | |||
| 1225 | Ga0070711_100022994 | |||
| 1226 | Ga0070711_100094527 | |||
| 1227 | Ga0070711_100655452 | |||
| 1228 | Ga0070711_100833137 | |||
| 1229 | Ga0070705_100015859 | |||
| 1230 | Ga0070705_100057102 | |||
| 1231 | Ga0070705_100197467 | |||
| 1232 | Ga0070700_100938978 | |||
| 1233 | Ga0070694_100180183 | |||
| 1234 | Ga0070694_100621581 | |||
| 1235 | Ga0070694_101154606 | |||
| 1236 | Ga0070708_100056097 | |||
| 1237 | Ga0070708_100309276 | |||
| 1238 | Ga0070708_100344827 | |||
| 1239 | Ga0070708_100347540 | |||
| 1240 | Ga0070708_100439973 | |||
| 1241 | Ga0070708_100750821 | |||
| 1242 | Ga0070708_101181280 | |||
| 1243 | Ga0070708_101467463 | |||
| 1244 | Ga0070663_101658693 | |||
| 1245 | Ga0070678_100032856 | |||
| 1246 | Ga0070678_100048228 | |||
| 1247 | Ga0070662_100792985 | |||
| 1248 | Ga0070681_10047558 | |||
| 1249 | Ga0070681_10052941 | |||
| 1250 | Ga0070681_10145078 | |||
| 1251 | Ga0070681_10185218 | |||
| 1252 | Ga0070681_10203974 | |||
| 1253 | Ga0070681_10396908 | |||
| 1254 | Ga0070681_10798238 | |||
| 1255 | Ga0070681_11124179 | |||
| 1256 | Ga0068867_100014353 | |||
| 1257 | Ga0068867_101249541 | |||
| 1258 | Ga0070706_100030095 | |||
| 1259 | Ga0070706_100123927 | |||
| 1260 | Ga0070706_100232365 | |||
| 1261 | Ga0070706_100540909 | |||
| 1262 | Ga0070706_100690009 | |||
| 1263 | Ga0070706_100983059 | |||
| 1264 | Ga0070707_100003358 | |||
| 1265 | Ga0070707_100068131 | |||
| 1266 | Ga0070707_100084272 | |||
| 1267 | Ga0070707_100132241 | |||
| 1268 | Ga0070707_100191630 | |||
| 1269 | Ga0070707_100536680 | |||
| 1270 | Ga0070707_100606791 | |||
| 1271 | Ga0070707_100751381 | |||
| 1272 | Ga0070698_100172912 | |||
| 1273 | Ga0070698_100250121 | |||
| 1274 | Ga0070698_100261911 | |||
| 1275 | Ga0070698_100340366 | |||
| 1276 | Ga0070698_100498514 | |||
| 1277 | Ga0070698_100827233 | |||
| 1278 | Ga0070698_100960727 | |||
| 1279 | Ga0070698_101534049 | |||
| 1280 | Ga0070699_100020255 | |||
| 1281 | Ga0070699_100173887 | |||
| 1282 | Ga0070699_100410773 | |||
| 1283 | Ga0070699_100576053 | |||
| 1284 | Ga0070699_100786420 | |||
| 1285 | Ga0070699_101033586 | |||
| 1286 | Ga0070699_101309337 | |||
| 1287 | Ga0070679_100044965 | |||
| 1288 | Ga0070679_100059757 | |||
| 1289 | Ga0070679_100096020 | |||
| 1290 | Ga0070679_100103675 | |||
| 1291 | Ga0070679_100335690 | |||
| 1292 | Ga0070679_100558819 | |||
| 1293 | Ga0070679_101417089 | |||
| 1294 | Ga0070684_100068875 | |||
| 1295 | Ga0070684_100082221 | |||
| 1296 | Ga0070684_100118564 | |||
| 1297 | Ga0070684_100299318 | |||
| 1298 | Ga0070684_100439659 | |||
| 1299 | Ga0070697_100531250 | |||
| 1300 | Ga0070697_100658859 | |||
| 1301 | Ga0070697_100823937 | |||
| 1302 | Ga0070697_100932779 | |||
| 1303 | Ga0070697_100936808 | |||
| 1304 | Ga0070697_101165037 | |||
| 1305 | Ga0068853_100582670 | |||
| 1306 | Ga0068853_101923225 | |||
| 1307 | Ga0070686_100146968 | |||
| 1308 | Ga0070686_100905263 | |||
| 1309 | Ga0070695_100000089 | |||
| 1310 | Ga0070695_100336009 | |||
| 1311 | Ga0070695_100434179 | |||
| 1312 | Ga0070695_101042226 | |||
| 1313 | Ga0070695_101267605 | |||
| 1314 | Ga0070696_100071671 | |||
| 1315 | Ga0070696_100449293 | |||
| 1316 | Ga0070693_100012449 | |||
| 1317 | Ga0070693_100152966 | |||
| 1318 | Ga0070693_100160414 | |||
| 1319 | Ga0070704_100292503 | |||
| 1320 | Ga0070704_100498279 | |||
| 1321 | Ga0070704_101049953 | |||
| 1322 | Ga0070704_101373095 | |||
| 1323 | Ga0068855_100204709 | |||
| 1324 | Ga0068855_100209079 | |||
| 1325 | Ga0068855_100299850 | |||
| 1326 | Ga0068855_100368425 | |||
| 1327 | Ga0068855_101967557 | |||
| 1328 | Ga0070664_100693626 | |||
| 1329 | Ga0070664_101321282 | |||
| 1330 | Ga0068857_101600205 | |||
| 1331 | Ga0068854_100033746 | |||
| 1332 | Ga0068854_100131082 | |||
| 1333 | Ga0068854_100597323 | |||
| 1334 | Ga0068854_102130955 | |||
| 1335 | Ga0068856_100077083 | |||
| 1336 | Ga0068856_100097263 | |||
| 1337 | Ga0068856_100180435 | |||
| 1338 | Ga0068856_100858777 | |||
| 1339 | Ga0070702_100021704 | |||
| 1340 | Ga0070702_100631966 | |||
| 1341 | Ga0070702_100849695 | |||
| 1342 | Ga0068852_100072272 | |||
| 1343 | Ga0068852_100612322 | |||
| 1344 | Ga0068861_100153027 | |||
| 1345 | Ga0068861_100208323 | |||
| 1346 | Ga0068861_100558847 | |||
| 1347 | Ga0068861_101297458 | |||
| 1348 | Ga0068863_100954715 | |||
| 1349 | Ga0068860_100521222 | |||
| 1350 | Ga0068862_101321161 | |||
| 1351 | Ga0081455_10036207 | |||
| 1352 | Ga0081455_10092588 | |||
| 1353 | Ga0081540_1000025 | |||
| 1354 | Ga0081539_10000181 | |||
| 1355 | Ga0070717_10002047 | |||
| 1356 | Ga0070717_10007748 | |||
| 1357 | Ga0070717_10801535 | |||
| 1358 | Ga0070717_10896914 | |||
| 1359 | Ga0075363_100046677 | |||
| 1360 | Ga0070715_10002718 | |||
| 1361 | Ga0070715_10006384 | |||
| 1362 | Ga0070715_10013029 | |||
| 1363 | Ga0070715_10486552 | |||
| 1364 | Ga0070716_100047323 | |||
| 1365 | Ga0070716_100111927 | |||
| 1366 | Ga0070716_100306116 | |||
| 1367 | Ga0070716_100313724 | |||
| 1368 | Ga0070712_100059604 | |||
| 1369 | Ga0070712_100106201 | |||
| 1370 | Ga0070712_100108563 | |||
| 1371 | Ga0070712_100278882 | |||
| 1372 | Ga0070712_100569287 | |||
| 1373 | Ga0070712_101222769 | |||
| 1374 | Ga0070712_101288942 | |||
| 1375 | Ga0097621_100369031 | |||
| 1376 | Ga0068871_100896649 | |||
| 1377 | Ga0075428_100775379 | |||
| 1378 | Ga0075430_100937510 | |||
| 1379 | Ga0075430_101313302 | |||
| 1380 | Ga0075433_10002015 | |||
| 1381 | Ga0075433_10034215 | |||
| 1382 | Ga0075433_10036823 | |||
| 1383 | Ga0075433_10458227 | |||
| 1384 | Ga0075433_10472973 | |||
| 1385 | Ga0075433_11301081 | |||
| 1386 | Ga0075434_100001203 | |||
| 1387 | Ga0075434_100060788 | |||
| 1388 | Ga0075434_100117584 | |||
| 1389 | Ga0075434_100151958 | |||
| 1390 | Ga0075434_100166565 | |||
| 1391 | Ga0075434_100243666 | |||
| 1392 | Ga0068865_102025039 | |||
| 1393 | Ga0075436_100020282 | |||
| 1394 | Ga0075436_100479677 | |||
| 1395 | Ga0075435_100015464 | |||
| 1396 | Ga0075435_100063424 | |||
| 1397 | Ga0075435_100093822 | |||
| 1398 | Ga0075435_100450346 | |||
| 1399 | Ga0099794_10343880 | |||
| 1400 | Ga0105244_10190972 | |||
| 1401 | Ga0105240_10012479 | |||
| 1402 | Ga0105240_10134654 | |||
| 1403 | Ga0105240_10145628 | |||
| 1404 | Ga0105240_10778784 | |||
| 1405 | Ga0105240_10779949 | |||
| 1406 | Ga0105240_11147276 | |||
| 1407 | Ga0105240_11891084 | |||
| 1408 | Ga0111539_10833831 | |||
| 1409 | Ga0111539_11195837 | |||
| 1410 | Ga0105245_10030624 | |||
| 1411 | Ga0105245_10465794 | |||
| 1412 | Ga0105245_10566947 | |||
| 1413 | Ga0105245_10581412 | |||
| 1414 | Ga0105245_10600908 | |||
| 1415 | Ga0105247_10113068 | |||
| 1416 | Ga0105247_10409802 | |||
| 1417 | Ga0105247_10726174 | |||
| 1418 | Ga0105247_11575123 | |||
| 1419 | Ga0114129_10096592 | |||
| 1420 | Ga0114129_10136922 | |||
| 1421 | Ga0114129_10317035 | |||
| 1422 | Ga0114129_10456845 | |||
| 1423 | Ga0114129_10576550 | |||
| 1424 | Ga0114129_11862442 | |||
| 1425 | Ga0114129_11890026 | |||
| 1426 | Ga0114129_12328186 | |||
| 1427 | Ga0105243_10112064 | |||
| 1428 | Ga0105243_10310081 | |||
| 1429 | Ga0105243_10705862 | |||
| 1430 | Ga0105243_12145201 | |||
| 1431 | Ga0105241_10032826 | |||
| 1432 | Ga0105241_10224103 | |||
| 1433 | Ga0105241_10900274 | |||
| 1434 | Ga0105241_12047488 | |||
| 1435 | Ga0105242_10021162 | |||
| 1436 | Ga0105242_10125404 | |||
| 1437 | Ga0105242_10359141 | |||
| 1438 | Ga0105242_10787895 | |||
| 1439 | Ga0105242_11756183 | |||
| 1440 | Ga0105242_13024438 | |||
| 1441 | Ga0105242_13128872 | |||
| 1442 | Ga0105248_11851832 | |||
| 1443 | Ga0105248_11956041 | |||
| 1444 | Ga0105237_10035633 | |||
| 1445 | Ga0105237_10231202 | |||
| 1446 | Ga0105237_10492405 | |||
| 1447 | Ga0105237_11920209 | |||
| 1448 | Ga0105237_12664330 | |||
| 1449 | Ga0105238_10056425 | |||
| 1450 | Ga0105238_11128631 | |||
| 1451 | Ga0105249_10256515 | |||
| 1452 | Ga0105249_10704302 | |||
| 1453 | Ga0105239_10224321 | |||
| 1454 | Ga0105239_10266156 | |||
| 1455 | Ga0105239_10888159 | |||
| 1456 | Ga0105239_11307644 | |||
| 1457 | Ga0105239_11538974 | |||
| 1458 | Ga0105239_13205491 | |||
| 1459 | Ga0105246_11704771 | |||
| 1460 | Ga0157326_1036841 | |||
| 1461 | Ga0157373_11013879 | |||
| 1462 | Ga0157371_10402642 | |||
| 1463 | Ga0157371_10744811 | |||
| 1464 | Ga0157370_10020230 | |||
| 1465 | Ga0157370_10470046 | |||
| 1466 | Ga0157370_11066679 | |||
| 1467 | Ga0157369_10024234 | |||
| 1468 | Ga0157369_10063581 | |||
| 1469 | Ga0157369_10252720 | |||
| 1470 | Ga0157369_10796099 | |||
| 1471 | Ga0157374_10096015 | |||
| 1472 | Ga0157374_10116033 | |||
| 1473 | Ga0157374_10345674 | |||
| 1474 | Ga0157374_10845553 | |||
| 1475 | Ga0157378_10230150 | |||
| 1476 | Ga0157378_10524999 | |||
| 1477 | Ga0157378_12894836 | |||
| 1478 | Ga0157378_13265246 | |||
| 1479 | Ga0163162_10430571 | |||
| 1480 | Ga0163162_10839389 | |||
| 1481 | Ga0157372_10019517 | |||
| 1482 | Ga0157372_10056656 | |||
| 1483 | Ga0157372_10410902 | |||
| 1484 | Ga0157372_10484219 | |||
| 1485 | Ga0157372_10545222 | |||
| 1486 | Ga0157375_10108630 | |||
| 1487 | Ga0157375_10139524 | |||
| 1488 | Ga0157375_10936779 | |||
| 1489 | Ga0163163_10695089 | |||
| 1490 | Ga0163163_11383811 | |||
| 1491 | Ga0163163_11574275 | |||
| 1492 | Ga0157380_10214108 | |||
| 1493 | Ga0157380_10463141 | |||
| 1494 | Ga0182008_10197645 | |||
| 1495 | Ga0157377_10395524 | |||
| 1496 | Ga0157379_10008331 | |||
| 1497 | Ga0157379_10906361 | |||
| 1498 | Ga0157376_10113526 | |||
| 1499 | Ga0157376_10411777 | |||
| 1500 | Ga0182006_1307590 | |||
| 1501 | Ga0163161_10264390 | |||
| 1502 | Ga0163161_10551893 | |||
| 1503 | Ga0197907_10618113 | |||
| 1504 | Ga0206356_10612127 | |||
| 1505 | Ga0206350_10500599 | |||
| 1506 | Ga0206353_11412652 | |||
| 1507 | Ga0213873_10041712 | |||
| 1508 | Ga0213874_10444724 | |||
| 1509 | Ga0213876_10137717 | |||
| 1510 | Ga0224712_10075621 | |||
| 1511 | Ga0224712_10103381 | |||
| 1512 | Ga0224712_10276874 | |||
| 1513 | Ga0207655_1104558 | |||
| 1514 | Ga0207653_10007523 | |||
| 1515 | Ga0207692_10272424 | |||
| 1516 | Ga0207692_10291031 | |||
| 1517 | Ga0207642_10113386 | |||
| 1518 | Ga0207642_10141748 | |||
| 1519 | Ga0207688_10176465 | |||
| 1520 | Ga0207680_10504309 | |||
| 1521 | Ga0207685_10008057 | |||
| 1522 | Ga0207699_10004270 | |||
| 1523 | Ga0207699_10168458 | |||
| 1524 | Ga0207705_10359906 | |||
| 1525 | Ga0207705_11254243 | |||
| 1526 | Ga0207684_10036198 | |||
| 1527 | Ga0207684_10107995 | |||
| 1528 | Ga0207684_10109290 | |||
| 1529 | Ga0207684_10111517 | |||
| 1530 | Ga0207684_10526175 | |||
| 1531 | Ga0207684_11011141 | |||
| 1532 | Ga0207684_11103520 | |||
| 1533 | Ga0207684_11437160 | |||
| 1534 | Ga0207654_10343363 | |||
| 1535 | Ga0207707_10081698 | |||
| 1536 | Ga0207707_10092722 | |||
| 1537 | Ga0207707_10180584 | |||
| 1538 | Ga0207707_11377222 | |||
| 1539 | Ga0207695_10081352 | |||
| 1540 | Ga0207695_10328150 | |||
| 1541 | Ga0207695_10659521 | |||
| 1542 | Ga0207695_10681020 | |||
| 1543 | Ga0207695_10787886 | |||
| 1544 | Ga0207671_10127353 | |||
| 1545 | Ga0207671_10621897 | |||
| 1546 | Ga0207693_10002509 | |||
| 1547 | Ga0207693_10003726 | |||
| 1548 | Ga0207693_10005566 | |||
| 1549 | Ga0207693_10063592 | |||
| 1550 | Ga0207693_10114287 | |||
| 1551 | Ga0207693_10407127 | |||
| 1552 | Ga0207693_10781804 | |||
| 1553 | Ga0207693_10805310 | |||
| 1554 | Ga0207693_10993148 | |||
| 1555 | Ga0207663_10008683 | |||
| 1556 | Ga0207663_10029080 | |||
| 1557 | Ga0207663_10175499 | |||
| 1558 | Ga0207663_10177501 | |||
| 1559 | Ga0207663_10186613 | |||
| 1560 | Ga0207663_11441093 | |||
| 1561 | Ga0207660_10121011 | |||
| 1562 | Ga0207660_10159899 | |||
| 1563 | Ga0207660_10217036 | |||
| 1564 | Ga0207660_10265521 | |||
| 1565 | Ga0207660_10397191 | |||
| 1566 | Ga0207662_10082887 | |||
| 1567 | Ga0207657_10003380 | |||
| 1568 | Ga0207657_10242734 | |||
| 1569 | Ga0207657_11333649 | |||
| 1570 | Ga0207649_10138597 | |||
| 1571 | Ga0207649_10948431 | |||
| 1572 | Ga0207649_11260909 | |||
| 1573 | Ga0207652_10108965 | |||
| 1574 | Ga0207652_10110845 | |||
| 1575 | Ga0207652_10162728 | |||
| 1576 | Ga0207652_10226635 | |||
| 1577 | Ga0207646_10000936 | |||
| 1578 | Ga0207646_10073077 | |||
| 1579 | Ga0207646_10204141 | |||
| 1580 | Ga0207646_10209955 | |||
| 1581 | Ga0207646_10330432 | |||
| 1582 | Ga0207646_10463049 | |||
| 1583 | Ga0207646_10491441 | |||
| 1584 | Ga0207646_10899189 | |||
| 1585 | Ga0207646_11234145 | |||
| 1586 | Ga0207694_10387095 | |||
| 1587 | Ga0207694_10502094 | |||
| 1588 | Ga0207694_11587120 | |||
| 1589 | Ga0207687_10076838 | |||
| 1590 | Ga0207687_10223150 | |||
| 1591 | Ga0207687_10622236 | |||
| 1592 | Ga0207687_10790310 | |||
| 1593 | Ga0207687_11092611 | |||
| 1594 | Ga0207687_11521226 | |||
| 1595 | Ga0207700_10017365 | |||
| 1596 | Ga0207700_10020498 | |||
| 1597 | Ga0207700_10173557 | |||
| 1598 | Ga0207700_10804538 | |||
| 1599 | Ga0207700_11012966 | |||
| 1600 | Ga0207664_10059046 | |||
| 1601 | Ga0207664_10079324 | |||
| 1602 | Ga0207664_10089972 | |||
| 1603 | Ga0207664_10092539 | |||
| 1604 | Ga0207664_10115576 | |||
| 1605 | Ga0207664_10146051 | |||
| 1606 | Ga0207664_10663217 | |||
| 1607 | Ga0207664_10782853 | |||
| 1608 | Ga0207664_10923296 | |||
| 1609 | Ga0207644_10081402 | |||
| 1610 | Ga0207644_11858676 | |||
| 1611 | Ga0207690_10045471 | |||
| 1612 | Ga0207690_10194436 | |||
| 1613 | Ga0207690_10394531 | |||
| 1614 | Ga0207690_11165102 | |||
| 1615 | Ga0207690_11721983 | |||
| 1616 | Ga0207706_10016899 | |||
| 1617 | Ga0207706_10158288 | |||
| 1618 | Ga0207686_10044996 | |||
| 1619 | Ga0207686_10180031 | |||
| 1620 | Ga0207686_10208930 | |||
| 1621 | Ga0207669_10378034 | |||
| 1622 | Ga0207669_11637510 | |||
| 1623 | Ga0207704_10699347 | |||
| 1624 | Ga0207704_10842662 | |||
| 1625 | Ga0207704_11338272 | |||
| 1626 | Ga0207665_10000230 | |||
| 1627 | Ga0207665_10019435 | |||
| 1628 | Ga0207665_10048100 | |||
| 1629 | Ga0207665_10532652 | |||
| 1630 | Ga0207665_11016874 | |||
| 1631 | Ga0207691_10908111 | |||
| 1632 | Ga0207711_10632484 | |||
| 1633 | Ga0207711_10664095 | |||
| 1634 | Ga0207689_11032715 | |||
| 1635 | Ga0207661_10088614 | |||
| 1636 | Ga0207661_10471359 | |||
| 1637 | Ga0207661_10976185 | |||
| 1638 | Ga0207667_10491424 | |||
| 1639 | Ga0207667_11298931 | |||
| 1640 | Ga0207651_10254202 | |||
| 1641 | Ga0207712_10830199 | |||
| 1642 | Ga0207668_10585035 | |||
| 1643 | Ga0207668_11266904 | |||
| 1644 | Ga0207668_11628266 | |||
| 1645 | Ga0207640_10784382 | |||
| 1646 | Ga0207640_11379383 | |||
| 1647 | Ga0207640_11582434 | |||
| 1648 | Ga0207658_10136684 | |||
| 1649 | Ga0207677_10516760 | |||
| 1650 | Ga0207677_10643678 | |||
| 1651 | Ga0207639_10234939 | |||
| 1652 | Ga0207639_10420660 | |||
| 1653 | Ga0207678_10510240 | |||
| 1654 | Ga0207678_10523706 | |||
| 1655 | Ga0207708_10042459 | |||
| 1656 | Ga0207708_10046313 | |||
| 1657 | Ga0207702_10087231 | |||
| 1658 | Ga0207702_10412048 | |||
| 1659 | Ga0207702_10715240 | |||
| 1660 | Ga0207648_10252349 | |||
| 1661 | Ga0207648_10306945 | |||
| 1662 | Ga0207674_10328944 | |||
| 1663 | Ga0207675_100068242 | |||
| 1664 | Ga0207675_100140348 | |||
| 1665 | Ga0207675_100583421 | |||
| 1666 | Ga0207683_10007722 | |||
| 1667 | Ga0207683_10111769 | |||
| 1668 | Ga0207683_10402975 | |||
| 1669 | Ga0207683_10631204 | |||
| 1670 | Ga0207698_10159279 | |||
| 1671 | Ga0207698_10548287 | |||
| 1672 | Ga0207698_10860971 | |||
| 1673 | Ga0207428_10522570 | |||
| 1674 | Ga0268266_10615230 | |||
| 1675 | Ga0268265_10593213 | |||
| 1676 | Ga0265319_1047156 | |||
| 1677 | Ga0265319_1053693 | |||
| 1678 | Ga0265336_10004455 | |||
| 1679 | Ga0265338_10004047 | |||
| 1680 | Ga0265338_10011160 | |||
| 1681 | Ga0265338_10071644 | |||
| 1682 | Ga0265324_10013354 | |||
| 1683 | Ga0265316_10448734 | |||
| 1684 | Ga0307408_100521740 | |||
| 1685 | Ga0265313_10019590 | |||
| 1686 | Ga0307405_12143020 | |||
| 1687 | Ga0307410_10304009 | |||
| 1688 | Ga0307410_10740285 | |||
| 1689 | Ga0307409_100446737 | |||
| 1690 | Ga0307409_102057718 | |||
| 1691 | Ga0307415_102392727 | |||
| 1692 | Ga0373950_0004669 | |||
| 1693 | Ga0373938_0001439 | |||
| 1694 | Ga0373926_0017537 | |||
| 1695 | Ga0373929_0225702 | |||
| 1696 | Ga0373934_0011684 | |||
| 1697 | Ga0373944_0292858 | |||
| 1698 | Ga0373949_0002626 | |||
| 1699 | Ga0373949_0123305 | |||
| 1700 | Ga0373951_0038797 | |||
| 1701 | Ga0373952_0067614 | |||
| 1702 | Ga0373923_0200692 | |||
| 1703 | Ga0373932_0110406 | |||
| 1704 | Ga0373936_0031578 | |||
| 1705 | Ga0373936_0172573 | |||
| 1706 | Ga0373941_0006178 | |||
| 1707 | Ga0373956_0216848 | |||
| 1708 | Ga0373957_0184940 | |||
| 1709 | Ga0373960_0006663 | |||
| 1710 | Ga0373960_0134212 | |||
| 1711 | Ga0373960_0185347 | |||
| 1712 | Ga0373943_0002421 | |||
| 1713 | Ga0373943_0028710 | |||
| 1714 | Ga0373946_0002116 | |||
| 1715 | Ga0373946_0167905 | |||
| 1716 | Ga0373955_0074369 | |||
| 1717 | Ga0373955_0103154 | |||
| 1718 | Ga0373955_0850858 | |||
| 1719 | Ga0373955_0859157 | |||
| 1720 | Ga0373962_0002688 | |||
| 1721 | Ga0373924_0059514 | |||
| 1722 | Ga0373931_0018638 | |||
| 1723 | Ga0373935_0842581 | |||
| 1724 | Ga0373935_1398658 | |||
| 1725 | Ga0373927_0014469 | |||
| 1726 | Ga0373927_0063211 | |||
| 1727 | Ga0373933_0138581 | |||
| 1728 | Ga0373933_0384028 | |||
| 1729 | Ga0373947_0000358 | |||
| 1730 | Ga0373947_0017957 | |||
| 1731 | Ga0373937_0000364 | |||
| 1732 | Ga0373937_0696814 | |||
| 1733 | Ga0373925_0005599 | |||
| 1734 | Ga0395899_0007078 | |||
| 1735 | Ga0395899_0037763 | |||
| 1736 | Ga0395899_0404662 | |||
| 1737 | Ga0395899_0520906 | |||
| 1738 | Ga0395900_0008224 | |||
| 1739 | Ga0395900_0084886 | |||
| 1740 | Ga0395900_0159853 | |||
| 1741 | Ga0395900_0202406 | |||
| 1742 | Ga0395900_0363159 | |||
| 1743 | Ga0395900_0412002 | |||
| 1744 | Ga0395900_0486073 | |||
| 1745 | Ga0395900_0524699 | |||
| 1746 | Ga0395900_0573444 | |||
| 1747 | Ga0395900_0584668 | |||
| 1748 | Ga0395900_0615922 | |||
| 1749 | Ga0395900_0812093 | |||
| 1750 | Ga0395898_0010596 | |||
| 1751 | Ga0395898_0120165 | |||
| 1752 | Ga0395898_0138381 | |||
| 1753 | Ga0395898_0186974 | |||
| 1754 | Ga0395898_0188085 | |||
| 1755 | Ga0395898_0191172 | |||
| 1756 | Ga0395898_0254243 | |||
| 1757 | Ga0395898_0368039 | |||
| 1758 | Ga0395898_0432031 | |||
| 1759 | Ga0395898_0435617 | |||
| 1760 | Ga0395898_0669570 | |||
| 1761 | Ga0395898_1597140 | |||
| 1762 | Ga0395905_0012735 | |||
| 1763 | Ga0395905_0015099 | |||
| 1764 | Ga0395905_0150043 | |||
| 1765 | Ga0395905_0205684 | |||
| 1766 | Ga0395905_0244456 | |||
| 1767 | Ga0395905_0301824 | |||
| 1768 | Ga0436364_0191199 | |||
| 1769 | Ga0436364_0679884 | |||
| 1770 | Ga0436364_1332041 | |||
| 1771 | Ga0395901_0008511 | |||
| 1772 | Ga0395901_0017661 | |||
| 1773 | Ga0395901_0019438 | |||
| 1774 | Ga0395901_0054258 | |||
| 1775 | Ga0395901_0092066 | |||
| 1776 | Ga0395901_0160727 | |||
| 1777 | Ga0395901_0169937 | |||
| 1778 | Ga0395901_0205400 | |||
| 1779 | Ga0395901_0296266 | |||
| 1780 | Ga0395901_0444582 | |||
| 1781 | Ga0395901_0588956 | |||
| 1782 | Ga0395901_0670254 | |||
| 1783 | Ga0395901_0728767 | |||
| 1784 | Ga0395901_0745372 | |||
| 1785 | Ga0436365_0702942 | |||
| 1786 | Ga0436365_0724570 | |||
| 1787 | Ga0436365_1560342 | |||
| 1788 | Ga0436363_0683573 | |||
| 1789 | Ga0436363_1398587 | |||
| 1790 | Ga0436363_1546757 | |||
| 1791 | Ga0436362_0735388 | |||
| 1792 | Ga0451849_1029388 | |||
| 1793 | Ga0451855_0037803 | |||
| 1794 | Ga0451577_0777262 | |||
| 1795 | Ga0466969_0007451 | |||
| 1796 | Ga0466969_0009459 | |||
| 1797 | Ga0466969_0431485 | |||
| 1798 | Ga0466969_0502956 | |||
| 1799 | Ga0466972_0405425 | |||
| 1800 | Ga0466965_0043621 | |||
| 1801 | Ga0466965_0094864 | |||
| 1802 | Ga0466965_0175187 | |||
| 1803 | Ga0466965_0425553 | |||
| 1804 | Ga0466965_0629112 | |||
| 1805 | Ga0466966_0062206 | |||
| 1806 | Ga0466966_0089556 | |||
| 1807 | Ga0466961_0019609 | |||
| 1808 | Ga0466961_0019863 | |||
| 1809 | Ga0466961_0089808 | |||
| 1810 | Ga0466961_0518196 | |||
| 1811 | Ga0466963_0000976 | |||
| 1812 | Ga0466963_0003259 | |||
| 1813 | Ga0466963_0003688 | |||
| 1814 | Ga0466963_0003971 | |||
| 1815 | Ga0466963_0019898 | |||
| 1816 | Ga0466963_0024992 | |||
| 1817 | Ga0466963_0025030 | |||
| 1818 | Ga0466963_0027857 | |||
| 1819 | Ga0466963_0028906 | |||
| 1820 | Ga0466963_0036641 | |||
| 1821 | Ga0466963_0039810 | |||
| 1822 | Ga0466963_0042103 | |||
| 1823 | Ga0466963_0042869 | |||
| 1824 | Ga0466963_0131225 | |||
| 1825 | Ga0466963_0149065 | |||
| 1826 | Ga0466963_0161445 | |||
| 1827 | Ga0466963_1068509 | |||
| 1828 | Ga0466964_0034372 | |||
| 1829 | Ga0466964_0063569 | |||
| 1830 | Ga0466964_0073507 | |||
| 1831 | Ga0466964_0184428 | |||
| 1832 | Ga0466964_0299697 | |||
| 1833 | Ga0466964_0811370 | |||
| 1834 | Ga0466971_0008681 | |||
| 1835 | Ga0466971_0206481 | |||
| 1836 | Ga0466968_0032578 | |||
| 1837 | Ga0466968_0054688 | |||
| 1838 | Ga0466968_0070601 | |||
| 1839 | Ga0466968_0100368 | |||
| 1840 | Ga0466968_0105978 | |||
| 1841 | Ga0466968_0127872 | |||
| 1842 | Ga0466968_0158238 | |||
| 1843 | Ga0466968_0159104 | |||
| 1844 | Ga0466970_0102505 | |||
| 1845 | Ga0466970_0130423 | |||
| 1846 | Ga0466970_0134758 | |||
| 1847 | Ga0466970_0384914 | |||
| 1848 | Ga0466957_0000999 | |||
| 1849 | Ga0466957_0002541 | |||
| 1850 | Ga0466957_0011104 | |||
| 1851 | Ga0466957_0014542 | |||
| 1852 | Ga0466957_0047463 | |||
| 1853 | Ga0466957_0052402 | |||
| 1854 | Ga0466957_0413442 | |||
| 1855 | Ga0466957_0844113 | |||
| 1856 | Ga0466957_0916111 | |||
| 1857 | Ga0466957_1269850 | |||
| 1858 | Ga0466960_0016679 | |||
| 1859 | Ga0466960_0180054 | |||
| 1860 | Ga0466960_0449217 | |||
| 1861 | Ga0466960_0564117 | |||
| 1862 | Ga0466959_0004426 | |||
| 1863 | Ga0466959_0005274 | |||
| 1864 | Ga0466959_0061762 | |||
| 1865 | Ga0466959_0181921 | |||
| 1866 | Ga0466959_0209346 | |||
| 1867 | Ga0466959_0477766 | |||
| 1868 | Ga0466959_0923420 | |||
| 1869 | Ga0451576_1448588 | |||
| 1870 | Ga0466958_0000473 | |||
| 1871 | Ga0466958_0009653 | |||
| 1872 | Ga0466958_0013734 | |||
| 1873 | Ga0466958_0066004 | |||
| 1874 | Ga0466958_0086325 | |||
| 1875 | Ga0466958_0164591 | |||
| 1876 | Ga0466958_0189182 | |||
| 1877 | Ga0466958_0289658 | |||
| 1878 | Ga0466958_0844275 | |||
| 1879 | Ga0466967_0000270 | |||
| 1880 | Ga0466967_0002301 | |||
| 1881 | Ga0466967_0012958 | |||
| 1882 | Ga0466967_0014116 | |||
| 1883 | Ga0466967_0014987 | |||
| 1884 | Ga0466967_0015687 | |||
| 1885 | Ga0466967_0031484 | |||
| 1886 | Ga0466967_0033693 | |||
| 1887 | Ga0466967_0067230 | |||
| 1888 | Ga0466967_0068999 | |||
| 1889 | Ga0466967_0076564 | |||
| 1890 | Ga0466967_0092675 | |||
| 1891 | Ga0466967_0095075 | |||
| 1892 | Ga0466967_0107801 | |||
| 1893 | Ga0466967_0245581 | |||
| 1894 | Ga0466967_0256932 | |||
| 1895 | Ga0466967_0496448 | |||
| 1896 | Ga0466967_0646496 | |||
| 1897 | Ga0466967_0857272 | |||
| 1898 | Ga0466967_1206105 | |||
| 1899 | Ga0466967_1403421 | |||
| 1900 | Ga0466967_1438033 | |||
| 1901 | Ga0466967_1486521 | |||
| 1902 | Ga0466967_1566912 | |||
| 1903 | Ga0466967_2318396 | |||
| 1904 | Ga0495617_285845 | |||
| 1905 | Ga0495592_0000050 | |||
| 1906 | Ga0495592_0078434 | |||
| 1907 | Ga0495592_0281853 | |||
| 1908 | Ga0495603_0095085 | |||
| 1909 | Ga0495603_0141334 | |||
| 1910 | Ga0495629_0000079 | |||
| 1911 | Ga0495629_0015231 | |||
| 1912 | Ga0495629_0024820 | |||
| 1913 | Ga0495629_0079362 | |||
| 1914 | Ga0495629_0299993 | |||
| 1915 | Ga0495641_0000395 | |||
| 1916 | Ga0495641_0005449 | |||
| 1917 | Ga0495641_0036094 | |||
| 1918 | Ga0495641_0168103 | |||
| 1919 | Ga0495641_0181441 | |||
| 1920 | Ga0495641_0230975 | |||
| 1921 | Ga0495651_0000004 | |||
| 1922 | Ga0495651_0203014 | |||
| 1923 | Ga0495651_0460820 | |||
| 1924 | Ga0495651_0860475 | |||
| 1925 | Ga0495653_0002246 | |||
| 1926 | Ga0495653_0073719 | |||
| 1927 | Ga0495653_0083989 | |||
| 1928 | Ga0495653_0277779 | |||
| 1929 | Ga0495653_0479634 | |||
| 1930 | Ga0495653_0530415 | |||
| 1931 | Ga0495580_0021128 | |||
| 1932 | Ga0495580_0635193 | |||
| 1933 | Ga0495580_0798300 | |||
| 1934 | Ga0495582_0000498 | |||
| 1935 | Ga0495582_0001645 | |||
| 1936 | Ga0495582_0020615 | |||
| 1937 | Ga0495582_0066708 | |||
| 1938 | Ga0495582_0377667 | |||
| 1939 | Ga0495605_0090480 | |||
| 1940 | Ga0495639_0001414 | |||
| 1941 | Ga0495639_0002465 | |||
| 1942 | Ga0495662_0000357 | |||
| 1943 | Ga0495662_0008908 | |||
| 1944 | Ga0495664_0021650 | |||
| 1945 | Ga0495664_0091286 | |||
| 1946 | Ga0495664_0106514 | |||
| 1947 | Ga0495664_0335336 | |||
| 1948 | Ga0495584_0172812 | |||
| 1949 | Ga0495594_0083209 | |||
| 1950 | Ga0495594_0278029 | |||
| 1951 | Ga0495594_0657669 | |||
| 1952 | Ga0495607_0087075 | |||
| 1953 | Ga0495607_0384161 | |||
| 1954 | Ga0495608_0010189 | |||
| 1955 | Ga0495608_0046698 | |||
| 1956 | Ga0495608_0269036 | |||
| 1957 | Ga0495608_0289718 | |||
| 1958 | Ga0495608_0338226 | |||
| 1959 | Ga0495616_0418587 | |||
| 1960 | Ga0495618_0002772 | |||
| 1961 | Ga0495618_0071632 | |||
| 1962 | Ga0495618_0233126 | |||
| 1963 | Ga0495618_0361920 | |||
| 1964 | Ga0495618_0417489 | |||
| 1965 | Ga0495618_0480434 | |||
| 1966 | Ga0495628_0001466 | |||
| 1967 | Ga0495628_0336856 | |||
| 1968 | Ga0495628_0523930 | |||
| 1969 | Ga0495628_0997128 | |||
| 1970 | Ga0495628_0999330 | |||
| 1971 | Ga0495630_0012040 | |||
| 1972 | Ga0495630_0068308 | |||
| 1973 | Ga0495630_0106295 | |||
| 1974 | Ga0495630_0121502 | |||
| 1975 | Ga0495644_0080914 | |||
| 1976 | Ga0495644_0293969 | |||
| 1977 | Ga0495644_0306392 | |||
| 1978 | Ga0495644_0424101 | |||
| 1979 | Ga0495663_0020477 | |||
| 1980 | Ga0495666_0005352 | |||
| 1981 | Ga0495666_0007050 | |||
| 1982 | Ga0495642_0040718 | |||
| 1983 | Ga0495642_0109508 | |||
| 1984 | Ga0495642_0304997 | |||
| 1985 | Ga0495642_0526630 | |||
| 1986 | Ga0495652_0000512 | |||
| 1987 | Ga0495652_0095428 | |||
| 1988 | Ga0495652_0544886 | |||
| 1989 | Ga0495665_0009774 | |||
| 1990 | Ga0495665_0017319 | |||
| 1991 | Ga0495665_0073213 | |||
| 1992 | Ga0495640_0005660 | |||
| 1993 | Ga0495640_0021002 | |||
| 1994 | Ga0495640_0050158 | |||
| 1995 | Ga0495640_0535140 | |||
| 1996 | Ga0495586_0026830 | |||
| 1997 | Ga0495586_0197260 | |||
| 1998 | Ga0495587_0000103 | |||
| 1999 | Ga0495587_0016237 | |||
| 2000 | Ga0495587_0158570 | |||
| 2001 | Ga0495587_0631420 | |||
| 2002 | Ga0495609_0065862 | |||
| 2003 | Ga0495609_0161728 | |||
| 2004 | Ga0495645_0000028 | |||
| 2005 | Ga0495645_0245080 | |||
| 2006 | Ga0495645_0574941 | |||
| 2007 | Ga0495633_0421094 | |||
| 2008 | Ga0495667_0022355 | |||
| 2009 | Ga0495667_0038516 | |||
| 2010 | Ga0495667_0162994 | |||
| 2011 | Ga0495667_0642442 | |||
| 2012 | Ga0495656_0032907 | |||
| 2013 | Ga0495656_0491903 | |||
| 2014 | Ga0495634_0011663 | |||
| 2015 | Ga0495634_0030047 | |||
| 2016 | Ga0495634_0059295 | |||
| 2017 | Ga0495634_0421466 | |||
| 2018 | Ga0495634_0778374 | |||
| 2019 | Ga0495634_0790517 | |||
| 2020 | Ga0495611_0084236 | |||
| 2021 | Ga0495635_0030663 | |||
| 2022 | Ga0495635_0101212 | |||
| 2023 | Ga0495635_0111098 | |||
| 2024 | Ga0495659_0045754 | |||
| 2025 | Ga0495588_0147858 | |||
| 2026 | Ga0495588_0694907 | |||
| 2027 | Ga0495588_0753874 | |||
| 2028 | Ga0495657_0045213 | |||
| 2029 | Ga0495657_0164039 | |||
| 2030 | Ga0495657_0181426 | |||
| 2031 | Ga0495657_0338906 | |||
| 2032 | Ga0495599_0000059 | |||
| 2033 | Ga0495599_0003876 | |||
| 2034 | Ga0495599_0045100 | |||
| 2035 | Ga0495599_0167274 | |||
| 2036 | Ga0495599_0723638 | |||
| 2037 | Ga0495623_0000082 | |||
| 2038 | Ga0495623_0645138 | |||
| 2039 | Ga0495646_0001107 | |||
| 2040 | Ga0495646_0131137 | |||
| 2041 | Ga0495646_0683157 | |||
| 2042 | Ga0495647_0000192 | |||
| 2043 | Ga0495647_0000915 | |||
| 2044 | Ga0495647_0058566 | |||
| 2045 | Ga0495647_0068729 | |||
| 2046 | Ga0495658_0001639 | |||
| 2047 | Ga0495658_0012654 | |||
| 2048 | Ga0495658_0130514 | |||
| 2049 | Ga0495613_0006549 | |||
| 2050 | Ga0495613_0018045 | |||
| 2051 | Ga0495613_0061843 | |||
| 2052 | Ga0495613_0348627 | |||
| 2053 | Ga0495613_0542272 | |||
| 2054 | Ga0495613_0564630 | |||
| 2055 | Ga0495613_0839508 | |||
| 2056 | Ga0495624_0016141 | |||
| 2057 | Ga0495624_0020887 | |||
| 2058 | Ga0495624_0021625 | |||
| 2059 | Ga0495624_0021818 | |||
| 2060 | Ga0495671_0436888 | |||
| 2061 | Ga0495589_0071323 | |||
| 2062 | Ga0495589_0096817 | |||
| 2063 | Ga0495589_0273691 | |||
| 2064 | Ga0495600_0035122 | |||
| 2065 | Ga0495600_0063462 | |||
| 2066 | Ga0495600_0066737 | |||
| 2067 | Ga0495600_0104747 | |||
| 2068 | Ga0495600_0693338 | |||
| 2069 | Ga0495581_0005444 | |||
| 2070 | Ga0495581_0013745 | |||
| 2071 | Ga0495581_0031069 | |||
| 2072 | Ga0495604_0000489 | |||
| 2073 | Ga0495604_0083791 | |||
| 2074 | Ga0495604_0195935 | |||
| 2075 | Ga0495604_0675777 | |||
| 2076 | Ga0495604_0714389 | |||
| 2077 | Ga0495636_0046193 | |||
| 2078 | Ga0495674_0012179 | |||
| 2079 | Ga0495674_0032490 | |||
| 2080 | Ga0495674_0239846 | |||
| 2081 | Ga0495674_0456987 | |||
| 2082 | Ga0495674_0570525 | |||
| 2083 | Ga0495674_0622308 | |||
| 2084 | Ga0495674_1030097 | |||
| 2085 | Ga0495676_0014130 | |||
| 2086 | Ga0495676_0061383 | |||
| 2087 | Ga0495676_0071264 | |||
| 2088 | Ga0495676_0394964 | |||
| 2089 | Ga0495676_0428716 | |||
| 2090 | Ga0495680_0014870 | |||
| 2091 | Ga0495680_0015545 | |||
| 2092 | Ga0495680_0022819 | |||
| 2093 | Ga0495680_0132702 | |||
| 2094 | Ga0495680_0171467 | |||
| 2095 | Ga0495680_0620374 | |||
| 2096 | Ga0495675_0000020 | |||
| 2097 | Ga0495677_0085792 | |||
| 2098 | Ga0495679_029221 | |||
| 2099 | Ga0495685_101848 | |||
| 2100 | Ga0495684_0010136 | |||
| 2101 | Ga0495684_0014390 | |||
| 2102 | Ga0495684_0042889 | |||
| 2103 | Ga0495684_0221776 | |||
| 2104 | Ga0495684_0392372 | |||
| 2105 | Ga0495593_0002867 | |||
| 2106 | Ga0495593_0003732 | |||
| 2107 | Ga0495593_0178751 | |||
| 2108 | Ga0495602_0002220 | |||
| 2109 | Ga0495602_0394382 | |||
| 2110 | Ga0495602_0411899 | |||
| 2111 | Ga0495602_0773535 | |||
| 2112 | Ga0495614_0012211 | |||
| 2113 | Ga0496100_0001246 | |||
| 2114 | Ga0496100_0009574 | |||
| 2115 | Ga0496100_0066333 | |||
| 2116 | Ga0496100_0100749 | |||
| 2117 | Ga0496100_0913174 | |||
| 2118 | Ga0496100_1176967 | |||
| 2119 | Ga0496100_1319307 | |||
| 2120 | Ga0496100_1661759 | |||
| 2121 | Ga0496101_0001915 | |||
| 2122 | Ga0496101_0010442 | |||
| 2123 | Ga0496101_0019660 | |||
| 2124 | Ga0496101_0042900 | |||
| 2125 | Ga0496101_0051870 | |||
| 2126 | Ga0496101_0096254 | |||
| 2127 | Ga0496101_0244165 | |||
| 2128 | Ga0496101_0421492 | |||
| 2129 | Ga0496101_0662881 | |||
| 2130 | Ga0496101_0705366 | |||
| 2131 | Ga0496102_0005766 | |||
| 2132 | Ga0496102_0203083 | |||
| 2133 | Ga0496102_0301868 | |||
| 2134 | Ga0496102_0631837 | |||
| 2135 | Ga0496102_0705569 | |||
| 2136 | Ga0496102_1087374 | |||
| 2137 | Ga0496102_1171585 | |||
| 2138 | Ga0496102_1519274 | |||
| 2139 | Ga0496103_0019267 | |||
| 2140 | Ga0496103_0039249 | |||
| 2141 | Ga0496103_0046759 | |||
| 2142 | Ga0496103_0049449 | |||
| 2143 | Ga0496103_0158791 | |||
| 2144 | Ga0496103_0498258 | |||
| 2145 | Ga0496104_0001405 | |||
| 2146 | Ga0496104_0006013 | |||
| 2147 | Ga0496104_0064981 | |||
| 2148 | Ga0496104_0085084 | |||
| 2149 | Ga0496104_0186041 | |||
| 2150 | Ga0496104_0733074 | |||
| 2151 | Ga0496104_0837319 | |||
| 2152 | Ga0496105_0004151 | |||
| 2153 | Ga0496105_0005415 | |||
| 2154 | Ga0496105_0016110 | |||
| 2155 | Ga0496105_0075992 | |||
| 2156 | Ga0496105_0091688 | |||
| 2157 | Ga0496105_0429086 | |||
| 2158 | Ga0496106_0001651 | |||
| 2159 | Ga0496106_0030857 | |||
| 2160 | Ga0496106_0063649 | |||
| 2161 | Ga0496106_0080080 | |||
| 2162 | Ga0496106_0124447 | |||
| 2163 | Ga0496106_0446812 | |||
| 2164 | Ga0496106_0451964 | |||
| 2165 | Ga0496106_0915193 | |||
| 2166 | Ga0496107_0005046 | |||
| 2167 | Ga0496107_0005295 | |||
| 2168 | Ga0496107_0041830 | |||
| 2169 | Ga0496107_0059600 | |||
| 2170 | Ga0496107_0069876 | |||
| 2171 | Ga0496107_0122079 | |||
| 2172 | Ga0496107_0396836 | |||
| 2173 | Ga0496107_0491744 | |||
| 2174 | Ga0496107_0518920 | |||
| 2175 | Ga0496107_0617469 | |||
| 2176 | Ga0496107_1273177 | |||
| 2177 | Ga0496108_0004075 | |||
| 2178 | Ga0496108_0032976 | |||
| 2179 | Ga0496108_0060508 | |||
| 2180 | Ga0496108_0076240 | |||
| 2181 | Ga0496108_0208203 | |||
| 2182 | Ga0496108_0383281 | |||
| 2183 | Ga0496108_0782237 | |||
| 2184 | Ga0496108_1021057 | |||
| 2185 | Ga0496109_0002734 | |||
| 2186 | Ga0496109_0007262 | |||
| 2187 | Ga0496109_0009989 | |||
| 2188 | Ga0496109_0043212 | |||
| 2189 | Ga0496109_0050159 | |||
| 2190 | Ga0496109_0060232 | |||
| 2191 | Ga0496109_0534003 | |||
| 2192 | Ga0496109_0732081 | |||
| 2193 | Ga0496109_0757198 | |||
| 2194 | Ga0496109_1011873 | |||
| 2195 | Ga0496110_0005994 | |||
| 2196 | Ga0496110_0006906 | |||
| 2197 | Ga0496110_0019184 | |||
| 2198 | Ga0496110_0058623 | |||
| 2199 | Ga0496110_0082412 | |||
| 2200 | Ga0496110_0128935 | |||
| 2201 | Ga0496110_0289918 | |||
| 2202 | Ga0496110_0492530 | |||
| 2203 | Ga0496110_1087812 | |||
| 2204 | Ga0496110_1659595 | |||
| 2205 | Ga0496111_0002987 | |||
| 2206 | Ga0496111_0005014 | |||
| 2207 | Ga0496111_0048505 | |||
| 2208 | Ga0496111_0062217 | |||
| 2209 | Ga0496111_0063794 | |||
| 2210 | Ga0496111_0122762 | |||
| 2211 | Ga0496111_0128535 | |||
| 2212 | Ga0496111_0156796 | |||
| 2213 | Ga0496111_0235060 | |||
| 2214 | Ga0496112_0025273 | |||
| 2215 | Ga0496112_0025598 | |||
| 2216 | Ga0496112_0027137 | |||
| 2217 | Ga0496112_0034002 | |||
| 2218 | Ga0496112_0035931 | |||
| 2219 | Ga0496112_0041343 | |||
| 2220 | Ga0496112_0084521 | |||
| 2221 | Ga0496112_0099930 | |||
| 2222 | Ga0496112_0150133 | |||
| 2223 | Ga0496112_0165281 | |||
| 2224 | Ga0496112_0255522 | |||
| 2225 | Ga0496112_0284251 | |||
| 2226 | Ga0496113_0016574 | |||
| 2227 | Ga0496113_0017158 | |||
| 2228 | Ga0496113_0059425 | |||
| 2229 | Ga0496113_0065375 | |||
| 2230 | Ga0496113_0114162 | |||
| 2231 | Ga0496113_0139969 | |||
| 2232 | Ga0496113_0188689 | |||
| 2233 | Ga0496113_0267360 | |||
| 2234 | Ga0496114_0002140 | |||
| 2235 | Ga0496114_0002672 | |||
| 2236 | Ga0496114_0018746 | |||
| 2237 | Ga0496114_0019365 | |||
| 2238 | Ga0496114_0027986 | |||
| 2239 | Ga0496114_0033035 | |||
| 2240 | Ga0496114_0101199 | |||
| 2241 | Ga0496114_0521347 | |||
| 2242 | Ga0496114_0640457 | |||
| 2243 | Ga0496114_1616071 | |||
| 2244 | Ga0496115_0000585 | |||
| 2245 | Ga0496115_0007297 | |||
| 2246 | Ga0496115_0080930 | |||
| 2247 | Ga0496115_0204876 | |||
| 2248 | Ga0496115_0261855 | |||
| 2249 | Ga0496115_0426383 | |||
| 2250 | Ga0496115_0813921 | |||
| 2251 | Ga0496120_0314546 | |||
| 2252 | Ga0501034_0010198 | |||
| 2253 | Ga0501067_0015440 | |||
| 2254 | Ga0501067_0027925 | |||
| 2255 | Ga0501067_0085159 | |||
| 2256 | Ga0501067_0138575 | |||
| 2257 | Ga0501067_0229271 | |||
| 2258 | Ga0501067_0273825 | |||
| 2259 | Ga0501067_0306430 | |||
| 2260 | Ga0501067_0332949 | |||
| 2261 | Ga0501068_0034577 | |||
| 2262 | Ga0501068_0045001 | |||
| 2263 | Ga0501069_0030920 | |||
| 2264 | Ga0501069_0054018 | |||
| 2265 | Ga0501069_0219751 | |||
| 2266 | Ga0501069_0235980 | |||
| 2267 | Ga0501070_0914725 | |||
| 2268 | Ga0501071_0807987 | |||
| 2269 | Ga0501074_0206166 | |||
| 2270 | nmdc:mga0yw44_496849_c1 | |||
| 2271 | nmdc:mga05p37_1007111_c1 | |||
| 2272 | nmdc:mga05p37_178825_c1 | |||
| 2273 | nmdc:mga05p37_2198235_c1 | |||
| 2274 | nmdc:mga05p37_241638_c1 | |||
| 2275 | nmdc:mga05p37_265726_c1 | |||
| 2276 | nmdc:mga05p37_56996_c1 | |||
| 2277 | nmdc:mga05p37_891290_c1 | |||
| 2278 | nmdc:mga05p37_899848_c1 | |||
| 2279 | nmdc:mga06r32_379448_c1 | |||
| 2280 | nmdc:mga08y16_1200107_c1 | |||
| 2281 | nmdc:mga08y16_848177_c1 | |||
| 2282 | nmdc:mga0n895_186808_c1 | |||
| 2283 | nmdc:mga0n895_1974677_c1 | |||
| 2284 | nmdc:mga0n895_33411_c1 | |||
| 2285 | nmdc:mga0n895_423816_c1 | |||
| 2286 | nmdc:mga0n895_46438_c1 | |||
| 2287 | nmdc:mga0n895_711644_c1 | |||
| 2288 | nmdc:mga0n895_847_c1 | |||
| 2289 | nmdc:mga0rr50_155726_c1 | |||
| 2290 | nmdc:mga0rr50_365036_c1 | |||
| 2291 | nmdc:mga0rr50_5592_c1 | |||
| 2292 | nmdc:mga0rr50_5894_c1 | |||
| 2293 | nmdc:mga0rr50_962792_c1 | |||
| 2294 | nmdc:mga08x19_16693_c1 | |||
| 2295 | nmdc:mga08x19_990256_c1 | |||
| 2296 | nmdc:mga0a205_1333523_c1 | |||
| 2297 | nmdc:mga0a205_1452205_c1 | |||
| 2298 | nmdc:mga0a205_148945_c1 | |||
| 2299 | nmdc:mga0a205_312249_c1 | |||
| 2300 | nmdc:mga0a205_337263_c1 | |||
| 2301 | nmdc:mga0a205_42197_c1 | |||
| 2302 | nmdc:mga0a205_6187_c1 | |||
| 2303 | nmdc:mga0a205_78063_c1 | |||
| 2304 | nmdc:mga0a205_93158_c1 | |||
| 2305 | Ga0495601_0000241 | |||
| 2306 | Ga0495601_0019881 | |||
| 2307 | Ga0495601_0213789 | |||
| 2308 | Ga0495601_0281774 | |||
| 2309 | Ga0495601_0437019 | |||
| 2310 | Ga0495601_0512385 | |||
| 2311 | Ga0495601_0567035 | |||
| 2312 | Ga0495612_0040578 | |||
| 2313 | Ga0495612_0063787 | |||
| 2314 | Ga0495612_0195000 | |||
| 2315 | Ga0495612_0195128 | |||
| 2316 | Ga0495612_0292617 | |||
| 2317 | Ga0495595_0041111 | |||
| 2318 | Ga0495595_0169794 | |||
| 2319 | Ga0495595_0192605 | |||
| 2320 | Ga0495595_0213821 | |||
| 2321 | Ga0495619_0000316 | |||
| 2322 | Ga0495619_0013004 | |||
| 2323 | Ga0495619_0068141 | |||
| 2324 | Ga0495619_0383402 | |||
| 2325 | Ga0495619_0487468 | |||
| 2326 | Ga0495619_0678216 | |||
| 2327 | Ga0500566_0163371 | |||
| 2328 | Ga0500657_237105 | |||
| 2329 | Ga0466962_0014079 | |||
| 2330 | Ga0466962_0028724 | |||
| 2331 | Ga0466962_0051595 | |||
| 2332 | Ga0466962_0106117 | |||
| 2333 | Ga0530510_0332076 | |||
| 2334 | Ga0530510_1100268 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zux-assembly2.cif.gz_e | saga dub module ubp8/sgf11/sus1/sgf73 bound to ubiqitinated nucleosome | 0.6824 | 35 | 85 |
| 2ida-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.6626 | 1 | 100 |
| 3jcr-assembly1.cif.gz_V | 3d structure determination of the human*u4/u6.u5* tri-snrnp complex | 0.6621 | 5 | 85 |
| 2ida-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.6573 | 1 | 100 |
| 2idh-assembly5.cif.gz_E | crystal structure of human fe65 ww domain | 0.6504 | 60 | 84 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1MCC9_211_290_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.7233 | 35 | 86 | 3.30.40.10 |
| 2idaA01 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.6997 | 1 | 82 | 3.30.40.10 |
| af_I1MWZ8_9_130_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.6983 | 34 | 85 | 3.30.40.10 |
| af_K7TY00_53_173_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.6817 | 23 | 84 | 3.30.40.10 |
| af_A3KQ59_36_124_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.67 | 5 | 85 | 3.30.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Y4B2C0-F1-model_v4 | UBP-type domain-containing protein | 0.877 | 33 | 82 |
GO:0008270
|
| AF-A0A2V6ISE0-F1-model_v4 | UBP-type domain-containing protein | 0.8738 | 34 | 84 |
GO:0008270
|
| AF-A0A1H3IX77-F1-model_v4 | Ubiquitin-hydrolase Zn-finger-containing protein | 0.8733 | 34 | 82 |
GO:0008270
GO:0016787 |
| AF-A0A7W0S772-F1-model_v4 | UBP-type zinc finger domain-containing protein | 0.8691 | 34 | 85 |
GO:0008270
|
| AF-A0A7H0I4M0-F1-model_v4 | UBP-type zinc finger domain-containing protein | 0.8587 | 34 | 83 |
GO:0008270
|