F490990
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1160 | 353 | 1160 | 326 |
Family's Representative Sequence
| Representative Sequence | 3300026078|Ga0207702_10173363|Ga0207702_101733631 |
| Length | 349 |
| Sequence | VRTPSYAGLHGWAKKADNMPDTILVVVEQREGKLNRVSWETITAGQAIAAATGWSLEAAVVGSGVNSIASEVAGKKVAKVYDIESPKLEPYTPDALAAGLKQFLESRQPKLVLMPHTYQVRDFVPKLATAMGRTVISDCIGFQHEGGKLVFTRQMFQGKLAADVSFTSDAPWFVTFQNGAFRGDKAEAGAAAAAVETVNVEIADGVIRNKPQEVFKEAKQAVDLTQAEIIVAVGRGIKEQKNIEIAKNLADALGGDLAASRPICDSGWLPMDRQIGSSGQTVAPKLYLALGISGAIQHIVGMKGSRAIIAVNKDSEAPIFEIADYAVVGNLFDIVPPLIEEVKKVKAGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 98 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 135 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 136 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 137 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 139 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 140 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 141 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 209 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 211 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 212 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 216 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 217 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 218 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 222 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 223 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 224 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 225 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 232 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 235 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 237 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 240 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 241 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 242 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 243 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 244 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 245 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 246 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 247 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 248 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 249 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 250 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 251 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 252 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 253 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 254 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 255 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 256 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 257 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 258 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 259 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 290 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 291 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 292 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 293 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 294 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 295 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 298 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 299 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 300 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 301 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 302 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 303 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 304 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 345 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 346 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 347 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 349 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 350 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.88 |
| Metatranscriptomes | 1.12 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.26 |
| Nodule | 0 |
| Rhizoplane | 4.91 |
| Rhizosphere | 94.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_175413 | 2162886012 | Bacteria | 1632 |
| 2 | JGI24752J21851_1001100 | 3300001976 | Bacteria | 3706 |
| 3 | JGI24743J22301_10004790 | 3300001991 | Bacteria | 2224 |
| 4 | JGI24034J26672_10002560 | 3300002239 | Unclassified | 2500 |
| 5 | JGI24751J29686_10000704 | 3300002459 | Bacteria | 8154 |
| 6 | JGI25406J46586_10006285 | 3300003203 | Bacteria | 5480 |
| 7 | rootL2_10275660 | 3300003322 | Bacteria | 2715 |
| 8 | Ga0058863_10071160 | 3300004799 | Bacteria | 3018 |
| 9 | Ga0058861_10063203 | 3300004800 | Bacteria | 2565 |
| 10 | Ga0058862_12859213 | 3300004803 | Bacteria | 3198 |
| 11 | Ga0065712_10086452 | 3300005290 | Bacteria | 2601 |
| 12 | Ga0065707_10004371 | 3300005295 | Bacteria | 3617 |
| 13 | Ga0070658_10026605 | 3300005327 | Unclassified | 4642 |
| 14 | Ga0070658_10200115 | 3300005327 | Unclassified | 1685 |
| 15 | Ga0070676_10283478 | 3300005328 | Bacteria | 1117 |
| 16 | Ga0070683_100014673 | 3300005329 | Bacteria | 6862 |
| 17 | Ga0070683_100035951 | 3300005329 | Bacteria | 4531 |
| 18 | Ga0070683_100049622 | 3300005329 | Bacteria | 3883 |
| 19 | Ga0070683_100073338 | 3300005329 | Unclassified | 3196 |
| 20 | Ga0070690_100136925 | 3300005330 | Bacteria | 1659 |
| 21 | Ga0070670_100017910 | 3300005331 | Bacteria | 6081 |
| 22 | Ga0070670_100028745 | 3300005331 | Bacteria | 4786 |
| 23 | Ga0070670_100185509 | 3300005331 | Bacteria | 1806 |
| 24 | Ga0070670_100219703 | 3300005331 | Bacteria | 1653 |
| 25 | Ga0068869_100002638 | 3300005334 | Bacteria | 10837 |
| 26 | Ga0068869_100011661 | 3300005334 | Bacteria | 5774 |
| 27 | Ga0068869_100108457 | 3300005334 | Bacteria | 2109 |
| 28 | Ga0068869_100270622 | 3300005334 | Bacteria | 1363 |
| 29 | Ga0070666_10062094 | 3300005335 | Unclassified | 2530 |
| 30 | Ga0070680_100002009 | 3300005336 | Bacteria | 14989 |
| 31 | Ga0070680_100045686 | 3300005336 | Bacteria | 3561 |
| 32 | Ga0070682_100009784 | 3300005337 | Bacteria | 5428 |
| 33 | Ga0070682_100026601 | 3300005337 | Bacteria | 3464 |
| 34 | Ga0070682_100188497 | 3300005337 | Unclassified | 1446 |
| 35 | Ga0068868_100001549 | 3300005338 | Bacteria | 15707 |
| 36 | Ga0068868_100002221 | 3300005338 | Bacteria | 13412 |
| 37 | Ga0068868_100005847 | 3300005338 | Bacteria | 8671 |
| 38 | Ga0068868_100026930 | 3300005338 | Bacteria | 4383 |
| 39 | Ga0068868_100041733 | 3300005338 | Bacteria | 3575 |
| 40 | Ga0068868_100049830 | 3300005338 | Unclassified | 3287 |
| 41 | Ga0070660_100108420 | 3300005339 | Unclassified | 2207 |
| 42 | Ga0070660_100116335 | 3300005339 | Bacteria | 2132 |
| 43 | Ga0070689_100001794 | 3300005340 | Bacteria | 13790 |
| 44 | Ga0070689_100211075 | 3300005340 | Bacteria | 1589 |
| 45 | Ga0070689_100255251 | 3300005340 | Bacteria | 1448 |
| 46 | Ga0070689_100316094 | 3300005340 | Bacteria | 1303 |
| 47 | Ga0070689_100378163 | 3300005340 | Bacteria | 1193 |
| 48 | Ga0070687_100124473 | 3300005343 | Bacteria | 1479 |
| 49 | Ga0070687_100170452 | 3300005343 | Bacteria | 1295 |
| 50 | Ga0070661_100005410 | 3300005344 | Bacteria | 8804 |
| 51 | Ga0070661_100023061 | 3300005344 | Unclassified | 4460 |
| 52 | Ga0070661_100051750 | 3300005344 | Unclassified | 3006 |
| 53 | Ga0070668_100379771 | 3300005347 | Bacteria | 1202 |
| 54 | Ga0070669_100026243 | 3300005353 | Bacteria | 4190 |
| 55 | Ga0070669_100084244 | 3300005353 | Unclassified | 2372 |
| 56 | Ga0070675_100000540 | 3300005354 | Bacteria | 25910 |
| 57 | Ga0070675_100119228 | 3300005354 | Bacteria | 2241 |
| 58 | Ga0070675_100306670 | 3300005354 | Bacteria | 1400 |
| 59 | Ga0070675_100334793 | 3300005354 | Bacteria | 1340 |
| 60 | Ga0070671_100263159 | 3300005355 | Unclassified | 1466 |
| 61 | Ga0070671_100444554 | 3300005355 | Bacteria | 1112 |
| 62 | Ga0070674_100014116 | 3300005356 | Bacteria | 4959 |
| 63 | Ga0070673_100017192 | 3300005364 | Bacteria | 5135 |
| 64 | Ga0070688_100039145 | 3300005365 | Unclassified | 2900 |
| 65 | Ga0070659_100060263 | 3300005366 | Unclassified | 2997 |
| 66 | Ga0070659_100311291 | 3300005366 | Bacteria | 1315 |
| 67 | Ga0070667_100024129 | 3300005367 | Bacteria | 5050 |
| 68 | Ga0070709_10000305 | 3300005434 | Bacteria | 31117 |
| 69 | Ga0070709_10012180 | 3300005434 | Unclassified | 4809 |
| 70 | Ga0070709_10019978 | 3300005434 | Unclassified | 3882 |
| 71 | Ga0070709_10038707 | 3300005434 | Bacteria | 2922 |
| 72 | Ga0070709_10080178 | 3300005434 | Unclassified | 2128 |
| 73 | Ga0070709_10113547 | 3300005434 | Unclassified | 1824 |
| 74 | Ga0070709_10136093 | 3300005434 | Bacteria | 1683 |
| 75 | Ga0070709_10178317 | 3300005434 | Bacteria | 1490 |
| 76 | Ga0070714_100000183 | 3300005435 | Bacteria | 49970 |
| 77 | Ga0070714_100026899 | 3300005435 | Unclassified | 4758 |
| 78 | Ga0070714_100076345 | 3300005435 | Unclassified | 2909 |
| 79 | Ga0070714_100121156 | 3300005435 | Bacteria | 2327 |
| 80 | Ga0070714_100136572 | 3300005435 | Bacteria | 2197 |
| 81 | Ga0070714_100210082 | 3300005435 | Bacteria | 1784 |
| 82 | Ga0070714_100238223 | 3300005435 | Bacteria | 1679 |
| 83 | Ga0070714_100249898 | 3300005435 | Unclassified | 1639 |
| 84 | Ga0070714_100366743 | 3300005435 | Unclassified | 1355 |
| 85 | Ga0070713_100000922 | 3300005436 | Bacteria | 18743 |
| 86 | Ga0070713_100005356 | 3300005436 | Bacteria | 8760 |
| 87 | Ga0070713_100007574 | 3300005436 | Bacteria | 7632 |
| 88 | Ga0070713_100008454 | 3300005436 | Bacteria | 7301 |
| 89 | Ga0070713_100009238 | 3300005436 | Bacteria | 7041 |
| 90 | Ga0070713_100028090 | 3300005436 | Bacteria | 4439 |
| 91 | Ga0070713_100058345 | 3300005436 | Unclassified | 3219 |
| 92 | Ga0070713_100082674 | 3300005436 | Unclassified | 2743 |
| 93 | Ga0070713_100098069 | 3300005436 | Bacteria | 2533 |
| 94 | Ga0070713_100106406 | 3300005436 | Unclassified | 2438 |
| 95 | Ga0070713_100110831 | 3300005436 | Bacteria | 2392 |
| 96 | Ga0070713_100172013 | 3300005436 | Bacteria | 1941 |
| 97 | Ga0070713_100192653 | 3300005436 | Bacteria | 1838 |
| 98 | Ga0070713_100302161 | 3300005436 | Unclassified | 1473 |
| 99 | Ga0070710_10043572 | 3300005437 | Bacteria | 2486 |
| 100 | Ga0070710_10043877 | 3300005437 | Unclassified | 2479 |
| 101 | Ga0070710_10149788 | 3300005437 | Bacteria | 1438 |
| 102 | Ga0070701_10123076 | 3300005438 | Bacteria | 1464 |
| 103 | Ga0070711_100001220 | 3300005439 | Bacteria | 13868 |
| 104 | Ga0070711_100010822 | 3300005439 | Bacteria | 5656 |
| 105 | Ga0070711_100016954 | 3300005439 | Bacteria | 4632 |
| 106 | Ga0070711_100068847 | 3300005439 | Bacteria | 2488 |
| 107 | Ga0070711_100110863 | 3300005439 | Unclassified | 2014 |
| 108 | Ga0070711_100112889 | 3300005439 | Bacteria | 1997 |
| 109 | Ga0070711_100113762 | 3300005439 | Bacteria | 1990 |
| 110 | Ga0070711_100135456 | 3300005439 | Unclassified | 1840 |
| 111 | Ga0070711_100423185 | 3300005439 | Unclassified | 1086 |
| 112 | Ga0070694_100001871 | 3300005444 | Bacteria | 12458 |
| 113 | Ga0070708_100000848 | 3300005445 | Bacteria | 23002 |
| 114 | Ga0070708_100002910 | 3300005445 | Bacteria | 13306 |
| 115 | Ga0070708_100009912 | 3300005445 | Bacteria | 7700 |
| 116 | Ga0070708_100011561 | 3300005445 | Bacteria | 7186 |
| 117 | Ga0070708_100039959 | 3300005445 | Unclassified | 4107 |
| 118 | Ga0070708_100048892 | 3300005445 | Bacteria | 3741 |
| 119 | Ga0070708_100079355 | 3300005445 | Unclassified | 2969 |
| 120 | Ga0070663_100062859 | 3300005455 | Unclassified | 2678 |
| 121 | Ga0070663_100407052 | 3300005455 | Bacteria | 1113 |
| 122 | Ga0070678_100031915 | 3300005456 | Unclassified | 3639 |
| 123 | Ga0070678_100075469 | 3300005456 | Unclassified | 2536 |
| 124 | Ga0070678_100304677 | 3300005456 | Bacteria | 1355 |
| 125 | Ga0070662_100008886 | 3300005457 | Bacteria | 6550 |
| 126 | Ga0070662_100018694 | 3300005457 | Bacteria | 4692 |
| 127 | Ga0070662_100253760 | 3300005457 | Bacteria | 1415 |
| 128 | Ga0070681_10000692 | 3300005458 | Bacteria | 27984 |
| 129 | Ga0070681_10005994 | 3300005458 | Bacteria | 11779 |
| 130 | Ga0070681_10008099 | 3300005458 | Bacteria | 10281 |
| 131 | Ga0070681_10021208 | 3300005458 | Bacteria | 6510 |
| 132 | Ga0070681_10028494 | 3300005458 | Bacteria | 5615 |
| 133 | Ga0070681_10035282 | 3300005458 | Bacteria | 5025 |
| 134 | Ga0070681_10055803 | 3300005458 | Bacteria | 3932 |
| 135 | Ga0070681_10058881 | 3300005458 | Bacteria | 3821 |
| 136 | Ga0070681_10075687 | 3300005458 | Unclassified | 3326 |
| 137 | Ga0070681_10111730 | 3300005458 | Unclassified | 2671 |
| 138 | Ga0070681_10149409 | 3300005458 | Bacteria | 2264 |
| 139 | Ga0070681_10165457 | 3300005458 | Bacteria | 2134 |
| 140 | Ga0070681_10176878 | 3300005458 | Bacteria | 2056 |
| 141 | Ga0070681_10304639 | 3300005458 | Bacteria | 1503 |
| 142 | Ga0070681_10368853 | 3300005458 | Bacteria | 1346 |
| 143 | Ga0070681_10539954 | 3300005458 | Bacteria | 1079 |
| 144 | Ga0068867_100008095 | 3300005459 | Bacteria | 7429 |
| 145 | Ga0068867_100125831 | 3300005459 | Unclassified | 1986 |
| 146 | Ga0070706_100000381 | 3300005467 | Bacteria | 53192 |
| 147 | Ga0070706_100000609 | 3300005467 | Bacteria | 41393 |
| 148 | Ga0070706_100006382 | 3300005467 | Bacteria | 11139 |
| 149 | Ga0070706_100027489 | 3300005467 | Bacteria | 5236 |
| 150 | Ga0070706_100027595 | 3300005467 | Bacteria | 5225 |
| 151 | Ga0070706_100061794 | 3300005467 | Bacteria | 3460 |
| 152 | Ga0070706_100086089 | 3300005467 | Unclassified | 2912 |
| 153 | Ga0070707_100000144 | 3300005468 | Bacteria | 67480 |
| 154 | Ga0070707_100018379 | 3300005468 | Bacteria | 6577 |
| 155 | Ga0070707_100054792 | 3300005468 | Bacteria | 3824 |
| 156 | Ga0070707_100087255 | 3300005468 | Bacteria | 3018 |
| 157 | Ga0070707_100299150 | 3300005468 | Bacteria | 1564 |
| 158 | Ga0070698_100000015 | 3300005471 | Bacteria | 111813 |
| 159 | Ga0070698_100000903 | 3300005471 | Bacteria | 32615 |
| 160 | Ga0070698_100037349 | 3300005471 | Bacteria | 5009 |
| 161 | Ga0070698_100176144 | 3300005471 | Unclassified | 2078 |
| 162 | Ga0070699_100045650 | 3300005518 | Unclassified | 3792 |
| 163 | Ga0070699_100195385 | 3300005518 | Bacteria | 1798 |
| 164 | Ga0070699_100286249 | 3300005518 | Bacteria | 1477 |
| 165 | Ga0070679_100009060 | 3300005530 | Bacteria | 9390 |
| 166 | Ga0070679_100017685 | 3300005530 | Bacteria | 6901 |
| 167 | Ga0070679_100036410 | 3300005530 | Unclassified | 4882 |
| 168 | Ga0070679_100041797 | 3300005530 | Bacteria | 4563 |
| 169 | Ga0070679_100049113 | 3300005530 | Bacteria | 4202 |
| 170 | Ga0070679_100059047 | 3300005530 | Bacteria | 3823 |
| 171 | Ga0070679_100068243 | 3300005530 | Bacteria | 3547 |
| 172 | Ga0070679_100157163 | 3300005530 | Unclassified | 2248 |
| 173 | Ga0070684_100002625 | 3300005535 | Bacteria | 13279 |
| 174 | Ga0070684_100002682 | 3300005535 | Bacteria | 13145 |
| 175 | Ga0070684_100007916 | 3300005535 | Bacteria | 8294 |
| 176 | Ga0070684_100016155 | 3300005535 | Bacteria | 6099 |
| 177 | Ga0070684_100042699 | 3300005535 | Bacteria | 3915 |
| 178 | Ga0070684_100054714 | 3300005535 | Bacteria | 3477 |
| 179 | Ga0070684_100127298 | 3300005535 | Unclassified | 2295 |
| 180 | Ga0070684_100168906 | 3300005535 | Bacteria | 1986 |
| 181 | Ga0070684_100176690 | 3300005535 | Bacteria | 1940 |
| 182 | Ga0070697_100000195 | 3300005536 | Bacteria | 49351 |
| 183 | Ga0070697_100001021 | 3300005536 | Bacteria | 21127 |
| 184 | Ga0070697_100003101 | 3300005536 | Bacteria | 12771 |
| 185 | Ga0070697_100006153 | 3300005536 | Bacteria | 9286 |
| 186 | Ga0070697_100010873 | 3300005536 | Bacteria | 7108 |
| 187 | Ga0070697_100026144 | 3300005536 | Unclassified | 4659 |
| 188 | Ga0070697_100032232 | 3300005536 | Bacteria | 4216 |
| 189 | Ga0070697_100086122 | 3300005536 | Bacteria | 2592 |
| 190 | Ga0070697_100118316 | 3300005536 | Unclassified | 2214 |
| 191 | Ga0068853_100004456 | 3300005539 | Bacteria | 10852 |
| 192 | Ga0068853_100016340 | 3300005539 | Bacteria | 6106 |
| 193 | Ga0068853_100051674 | 3300005539 | Unclassified | 3538 |
| 194 | Ga0068853_100071730 | 3300005539 | Bacteria | 3017 |
| 195 | Ga0068853_100093359 | 3300005539 | Bacteria | 2649 |
| 196 | Ga0070672_100041331 | 3300005543 | Bacteria | 3544 |
| 197 | Ga0070686_100022493 | 3300005544 | Unclassified | 3755 |
| 198 | Ga0070686_100104806 | 3300005544 | Unclassified | 1916 |
| 199 | Ga0070695_100070485 | 3300005545 | Unclassified | 2287 |
| 200 | Ga0070696_100011056 | 3300005546 | Bacteria | 6043 |
| 201 | Ga0070696_100167415 | 3300005546 | Bacteria | 1623 |
| 202 | Ga0070693_100008703 | 3300005547 | Bacteria | 5021 |
| 203 | Ga0070665_100027509 | 3300005548 | Bacteria | 5728 |
| 204 | Ga0070665_100590653 | 3300005548 | Bacteria | 1123 |
| 205 | Ga0068855_100001490 | 3300005563 | Bacteria | 29300 |
| 206 | Ga0068855_100002064 | 3300005563 | Bacteria | 24891 |
| 207 | Ga0068855_100004921 | 3300005563 | Bacteria | 16303 |
| 208 | Ga0068855_100013622 | 3300005563 | Bacteria | 9806 |
| 209 | Ga0068855_100020077 | 3300005563 | Bacteria | 8024 |
| 210 | Ga0068855_100055057 | 3300005563 | Bacteria | 4673 |
| 211 | Ga0068855_100108486 | 3300005563 | Bacteria | 3189 |
| 212 | Ga0068855_100337298 | 3300005563 | Bacteria | 1663 |
| 213 | Ga0068855_100368240 | 3300005563 | Bacteria | 1580 |
| 214 | Ga0068855_100612017 | 3300005563 | Bacteria | 1174 |
| 215 | Ga0070664_100017492 | 3300005564 | Bacteria | 5887 |
| 216 | Ga0070664_100106944 | 3300005564 | Bacteria | 2438 |
| 217 | Ga0070664_100147243 | 3300005564 | Unclassified | 2077 |
| 218 | Ga0068857_100001030 | 3300005577 | Bacteria | 21530 |
| 219 | Ga0068857_100003337 | 3300005577 | Bacteria | 13362 |
| 220 | Ga0068857_100096591 | 3300005577 | Unclassified | 2648 |
| 221 | Ga0068857_100215307 | 3300005577 | Unclassified | 1753 |
| 222 | Ga0068857_100239962 | 3300005577 | Bacteria | 1659 |
| 223 | Ga0068854_100004220 | 3300005578 | Bacteria | 9046 |
| 224 | Ga0068854_100012031 | 3300005578 | Bacteria | 5656 |
| 225 | Ga0068854_100123985 | 3300005578 | Bacteria | 1965 |
| 226 | Ga0068856_100000065 | 3300005614 | Bacteria | 98683 |
| 227 | Ga0068856_100000989 | 3300005614 | Bacteria | 30332 |
| 228 | Ga0068856_100002496 | 3300005614 | Bacteria | 18932 |
| 229 | Ga0068856_100012096 | 3300005614 | Bacteria | 8359 |
| 230 | Ga0068856_100023046 | 3300005614 | Bacteria | 6054 |
| 231 | Ga0068856_100028145 | 3300005614 | Bacteria | 5485 |
| 232 | Ga0068856_100052234 | 3300005614 | Bacteria | 4030 |
| 233 | Ga0068856_100057605 | 3300005614 | Unclassified | 3836 |
| 234 | Ga0068856_100120678 | 3300005614 | Bacteria | 2623 |
| 235 | Ga0068856_100158414 | 3300005614 | Bacteria | 2274 |
| 236 | Ga0068856_100220034 | 3300005614 | Bacteria | 1914 |
| 237 | Ga0068856_100477087 | 3300005614 | Bacteria | 1268 |
| 238 | Ga0070702_100009321 | 3300005615 | Bacteria | 4801 |
| 239 | Ga0068852_100052092 | 3300005616 | Unclassified | 3516 |
| 240 | Ga0068852_100102856 | 3300005616 | Bacteria | 2582 |
| 241 | Ga0068859_100000939 | 3300005617 | Bacteria | 29832 |
| 242 | Ga0068859_100005531 | 3300005617 | Bacteria | 12867 |
| 243 | Ga0068859_100162576 | 3300005617 | Bacteria | 2312 |
| 244 | Ga0068859_100244109 | 3300005617 | Bacteria | 1885 |
| 245 | Ga0068859_100417281 | 3300005617 | Bacteria | 1438 |
| 246 | Ga0068864_100000369 | 3300005618 | Bacteria | 39200 |
| 247 | Ga0068864_100008228 | 3300005618 | Bacteria | 8603 |
| 248 | Ga0068864_100032790 | 3300005618 | Unclassified | 4415 |
| 249 | Ga0068864_100198148 | 3300005618 | Unclassified | 1844 |
| 250 | Ga0068864_100243346 | 3300005618 | Bacteria | 1667 |
| 251 | Ga0068866_10003414 | 3300005718 | Bacteria | 6511 |
| 252 | Ga0068866_10009998 | 3300005718 | Unclassified | 4052 |
| 253 | Ga0068866_10149758 | 3300005718 | Bacteria | 1350 |
| 254 | Ga0068861_100009849 | 3300005719 | Bacteria | 6609 |
| 255 | Ga0068861_100172783 | 3300005719 | Bacteria | 1792 |
| 256 | Ga0068861_100360143 | 3300005719 | Bacteria | 1279 |
| 257 | Ga0068851_10005710 | 3300005834 | Bacteria | 5658 |
| 258 | Ga0068870_10000935 | 3300005840 | Bacteria | 11452 |
| 259 | Ga0068863_100006532 | 3300005841 | Bacteria | 11443 |
| 260 | Ga0068863_100023970 | 3300005841 | Bacteria | 5823 |
| 261 | Ga0068863_100050601 | 3300005841 | Bacteria | 3938 |
| 262 | Ga0068863_100160860 | 3300005841 | Bacteria | 2151 |
| 263 | Ga0068858_100002175 | 3300005842 | Bacteria | 19870 |
| 264 | Ga0068858_100005150 | 3300005842 | Bacteria | 12810 |
| 265 | Ga0068858_100024408 | 3300005842 | Bacteria | 5633 |
| 266 | Ga0068858_100027668 | 3300005842 | Bacteria | 5268 |
| 267 | Ga0068858_100078685 | 3300005842 | Bacteria | 3064 |
| 268 | Ga0068860_100061945 | 3300005843 | Bacteria | 3555 |
| 269 | Ga0068860_100065633 | 3300005843 | Unclassified | 3446 |
| 270 | Ga0068860_100091141 | 3300005843 | Bacteria | 2904 |
| 271 | Ga0068860_100110187 | 3300005843 | Bacteria | 2631 |
| 272 | Ga0068860_100170019 | 3300005843 | Bacteria | 2105 |
| 273 | Ga0068860_100355061 | 3300005843 | Bacteria | 1443 |
| 274 | Ga0068860_100488859 | 3300005843 | Bacteria | 1227 |
| 275 | Ga0068862_100015615 | 3300005844 | Bacteria | 6308 |
| 276 | Ga0068862_100024780 | 3300005844 | Bacteria | 5034 |
| 277 | Ga0081455_10008282 | 3300005937 | Bacteria | 10834 |
| 278 | Ga0081455_10301905 | 3300005937 | Bacteria | 1148 |
| 279 | Ga0081540_1026668 | 3300005983 | Unclassified | 3291 |
| 280 | Ga0081539_10001175 | 3300005985 | Bacteria | 47406 |
| 281 | Ga0070717_10001830 | 3300006028 | Bacteria | 14861 |
| 282 | Ga0070717_10002609 | 3300006028 | Bacteria | 12710 |
| 283 | Ga0070717_10004387 | 3300006028 | Bacteria | 10182 |
| 284 | Ga0070717_10007529 | 3300006028 | Bacteria | 8089 |
| 285 | Ga0070717_10016823 | 3300006028 | Bacteria | 5676 |
| 286 | Ga0070717_10035619 | 3300006028 | Bacteria | 4031 |
| 287 | Ga0070717_10047746 | 3300006028 | Bacteria | 3509 |
| 288 | Ga0070717_10061452 | 3300006028 | Bacteria | 3113 |
| 289 | Ga0070717_10111940 | 3300006028 | Bacteria | 2329 |
| 290 | Ga0070717_10165616 | 3300006028 | Bacteria | 1920 |
| 291 | Ga0070717_10216772 | 3300006028 | Bacteria | 1681 |
| 292 | Ga0070717_10224788 | 3300006028 | Bacteria | 1651 |
| 293 | Ga0070715_10005347 | 3300006163 | Unclassified | 4276 |
| 294 | Ga0070715_10018053 | 3300006163 | Bacteria | 2682 |
| 295 | Ga0070715_10032661 | 3300006163 | Bacteria | 2122 |
| 296 | Ga0070716_100008843 | 3300006173 | Bacteria | 5004 |
| 297 | Ga0070716_100082439 | 3300006173 | Bacteria | 1923 |
| 298 | Ga0070712_100001229 | 3300006175 | Bacteria | 15482 |
| 299 | Ga0070712_100005202 | 3300006175 | Bacteria | 8045 |
| 300 | Ga0070712_100006553 | 3300006175 | Bacteria | 7226 |
| 301 | Ga0070712_100006918 | 3300006175 | Bacteria | 7067 |
| 302 | Ga0070712_100007031 | 3300006175 | Bacteria | 7015 |
| 303 | Ga0070712_100010851 | 3300006175 | Bacteria | 5761 |
| 304 | Ga0070712_100015260 | 3300006175 | Bacteria | 4941 |
| 305 | Ga0070712_100191397 | 3300006175 | Bacteria | 1601 |
| 306 | Ga0097621_100000034 | 3300006237 | Bacteria | 69159 |
| 307 | Ga0097621_100000908 | 3300006237 | Bacteria | 20694 |
| 308 | Ga0097621_100010855 | 3300006237 | Bacteria | 6684 |
| 309 | Ga0097621_100039276 | 3300006237 | Bacteria | 3801 |
| 310 | Ga0097621_100049009 | 3300006237 | Bacteria | 3430 |
| 311 | Ga0097621_100049426 | 3300006237 | Unclassified | 3416 |
| 312 | Ga0097621_100076264 | 3300006237 | Bacteria | 2781 |
| 313 | Ga0097621_100247316 | 3300006237 | Bacteria | 1561 |
| 314 | Ga0097621_100444465 | 3300006237 | Unclassified | 1167 |
| 315 | Ga0068871_100000233 | 3300006358 | Bacteria | 39441 |
| 316 | Ga0068871_100000444 | 3300006358 | Bacteria | 28514 |
| 317 | Ga0068871_100003756 | 3300006358 | Bacteria | 10457 |
| 318 | Ga0068871_100005759 | 3300006358 | Bacteria | 8700 |
| 319 | Ga0068871_100009308 | 3300006358 | Bacteria | 7110 |
| 320 | Ga0068871_100080692 | 3300006358 | Bacteria | 2694 |
| 321 | Ga0068871_100091447 | 3300006358 | Bacteria | 2536 |
| 322 | Ga0068871_100252942 | 3300006358 | Unclassified | 1535 |
| 323 | Ga0075428_100000607 | 3300006844 | Bacteria | 36552 |
| 324 | Ga0075428_100069652 | 3300006844 | Bacteria | 3845 |
| 325 | Ga0075428_100131714 | 3300006844 | Bacteria | 2719 |
| 326 | Ga0075428_100224083 | 3300006844 | Bacteria | 2030 |
| 327 | Ga0075431_100017181 | 3300006847 | Bacteria | 7352 |
| 328 | Ga0075431_100120429 | 3300006847 | Bacteria | 2708 |
| 329 | Ga0075431_100130750 | 3300006847 | Bacteria | 2589 |
| 330 | Ga0075431_100210048 | 3300006847 | Bacteria | 1989 |
| 331 | Ga0075431_100227038 | 3300006847 | Bacteria | 1903 |
| 332 | Ga0075431_100303010 | 3300006847 | Bacteria | 1614 |
| 333 | Ga0075433_10149908 | 3300006852 | Bacteria | 2074 |
| 334 | Ga0075433_10171943 | 3300006852 | Bacteria | 1928 |
| 335 | Ga0075434_100001079 | 3300006871 | Bacteria | 22322 |
| 336 | Ga0075434_100038540 | 3300006871 | Bacteria | 4733 |
| 337 | Ga0075434_100147812 | 3300006871 | Bacteria | 2370 |
| 338 | Ga0075434_100188356 | 3300006871 | Bacteria | 2083 |
| 339 | Ga0068865_100002230 | 3300006881 | Bacteria | 11411 |
| 340 | Ga0068865_100006642 | 3300006881 | Bacteria | 7077 |
| 341 | Ga0068865_100044236 | 3300006881 | Unclassified | 3047 |
| 342 | Ga0075436_100001547 | 3300006914 | Bacteria | 15710 |
| 343 | Ga0075436_100003577 | 3300006914 | Bacteria | 10648 |
| 344 | Ga0075436_100006024 | 3300006914 | Bacteria | 8324 |
| 345 | Ga0075436_100007392 | 3300006914 | Bacteria | 7513 |
| 346 | Ga0075436_100080970 | 3300006914 | Unclassified | 2251 |
| 347 | Ga0075436_100142659 | 3300006914 | Bacteria | 1684 |
| 348 | Ga0097620_100000939 | 3300006931 | Bacteria | 29832 |
| 349 | Ga0097620_100005531 | 3300006931 | Bacteria | 12867 |
| 350 | Ga0097620_100162582 | 3300006931 | Bacteria | 2312 |
| 351 | Ga0097620_100244113 | 3300006931 | Bacteria | 1885 |
| 352 | Ga0097620_100417257 | 3300006931 | Bacteria | 1438 |
| 353 | Ga0075435_100010144 | 3300007076 | Bacteria | 6879 |
| 354 | Ga0099794_10144830 | 3300007265 | Bacteria | 1204 |
| 355 | Ga0105251_10100663 | 3300009011 | Unclassified | 1321 |
| 356 | Ga0105250_10009360 | 3300009092 | Bacteria | 4130 |
| 357 | Ga0105240_10000161 | 3300009093 | Bacteria | 137359 |
| 358 | Ga0105240_10006455 | 3300009093 | Bacteria | 17235 |
| 359 | Ga0105240_10034509 | 3300009093 | Bacteria | 6525 |
| 360 | Ga0105240_10065144 | 3300009093 | Bacteria | 4524 |
| 361 | Ga0105240_10116022 | 3300009093 | Bacteria | 3231 |
| 362 | Ga0105240_10128678 | 3300009093 | Bacteria | 3040 |
| 363 | Ga0105240_10152642 | 3300009093 | Unclassified | 2749 |
| 364 | Ga0105240_10206913 | 3300009093 | Bacteria | 2296 |
| 365 | Ga0105240_10239535 | 3300009093 | Bacteria | 2104 |
| 366 | Ga0105240_10322798 | 3300009093 | Bacteria | 1759 |
| 367 | Ga0105240_10338304 | 3300009093 | Bacteria | 1710 |
| 368 | Ga0105240_10735834 | 3300009093 | Bacteria | 1073 |
| 369 | Ga0111539_10000455 | 3300009094 | Bacteria | 51281 |
| 370 | Ga0111539_10026226 | 3300009094 | Bacteria | 7130 |
| 371 | Ga0111539_10036740 | 3300009094 | Bacteria | 5919 |
| 372 | Ga0111539_10060226 | 3300009094 | Bacteria | 4499 |
| 373 | Ga0111539_10147796 | 3300009094 | Bacteria | 2751 |
| 374 | Ga0111539_10214441 | 3300009094 | Bacteria | 2243 |
| 375 | Ga0111539_10442945 | 3300009094 | Bacteria | 1512 |
| 376 | Ga0105245_10000624 | 3300009098 | Bacteria | 32143 |
| 377 | Ga0105245_10007043 | 3300009098 | Bacteria | 9863 |
| 378 | Ga0105245_10041692 | 3300009098 | Bacteria | 4092 |
| 379 | Ga0105245_10058681 | 3300009098 | Bacteria | 3464 |
| 380 | Ga0105245_10083479 | 3300009098 | Unclassified | 2925 |
| 381 | Ga0105245_10101680 | 3300009098 | Bacteria | 2661 |
| 382 | Ga0105245_10281561 | 3300009098 | Bacteria | 1625 |
| 383 | Ga0105247_10001507 | 3300009101 | Bacteria | 16650 |
| 384 | Ga0105247_10024056 | 3300009101 | Bacteria | 3668 |
| 385 | Ga0105247_10089205 | 3300009101 | Bacteria | 1955 |
| 386 | Ga0105247_10093622 | 3300009101 | Bacteria | 1910 |
| 387 | Ga0114129_10004180 | 3300009147 | Bacteria | 20396 |
| 388 | Ga0114129_10235763 | 3300009147 | Bacteria | 2462 |
| 389 | Ga0105243_10439729 | 3300009148 | Bacteria | 1221 |
| 390 | Ga0105241_10002126 | 3300009174 | Bacteria | 14978 |
| 391 | Ga0105241_10025623 | 3300009174 | Bacteria | 4384 |
| 392 | Ga0105241_10117677 | 3300009174 | Unclassified | 2136 |
| 393 | Ga0105241_10154538 | 3300009174 | Bacteria | 1880 |
| 394 | Ga0105242_10016443 | 3300009176 | Bacteria | 5752 |
| 395 | Ga0105242_10053867 | 3300009176 | Bacteria | 3286 |
| 396 | Ga0105242_10099580 | 3300009176 | Unclassified | 2460 |
| 397 | Ga0105242_10115686 | 3300009176 | Bacteria | 2293 |
| 398 | Ga0105242_10188353 | 3300009176 | Bacteria | 1825 |
| 399 | Ga0105242_10376543 | 3300009176 | Unclassified | 1318 |
| 400 | Ga0105248_10005836 | 3300009177 | Bacteria | 13532 |
| 401 | Ga0105248_10072101 | 3300009177 | Unclassified | 3882 |
| 402 | Ga0105248_10081845 | 3300009177 | Bacteria | 3630 |
| 403 | Ga0105248_10091853 | 3300009177 | Unclassified | 3419 |
| 404 | Ga0105248_10112311 | 3300009177 | Bacteria | 3073 |
| 405 | Ga0105248_10270875 | 3300009177 | Bacteria | 1912 |
| 406 | Ga0105237_10008538 | 3300009545 | Bacteria | 11072 |
| 407 | Ga0105237_10019697 | 3300009545 | Bacteria | 6965 |
| 408 | Ga0105237_10029884 | 3300009545 | Bacteria | 5535 |
| 409 | Ga0105237_10151073 | 3300009545 | Bacteria | 2319 |
| 410 | Ga0105237_10164956 | 3300009545 | Bacteria | 2214 |
| 411 | Ga0105238_10000464 | 3300009551 | Bacteria | 42663 |
| 412 | Ga0105238_10016655 | 3300009551 | Bacteria | 7446 |
| 413 | Ga0105238_10049855 | 3300009551 | Bacteria | 4215 |
| 414 | Ga0105238_10091729 | 3300009551 | Bacteria | 3025 |
| 415 | Ga0105238_10155748 | 3300009551 | Bacteria | 2260 |
| 416 | Ga0105238_10200457 | 3300009551 | Unclassified | 1971 |
| 417 | Ga0105249_10004737 | 3300009553 | Bacteria | 11742 |
| 418 | Ga0105249_10090776 | 3300009553 | Bacteria | 2857 |
| 419 | Ga0105249_10100646 | 3300009553 | Bacteria | 2718 |
| 420 | Ga0105249_10406595 | 3300009553 | Bacteria | 1393 |
| 421 | Ga0105239_10053632 | 3300010375 | Bacteria | 4422 |
| 422 | Ga0105239_10054173 | 3300010375 | Bacteria | 4399 |
| 423 | Ga0105239_10086301 | 3300010375 | Bacteria | 3459 |
| 424 | Ga0105239_10248862 | 3300010375 | Unclassified | 1996 |
| 425 | Ga0105246_10001854 | 3300011119 | Bacteria | 12705 |
| 426 | Ga0105246_10034407 | 3300011119 | Unclassified | 3376 |
| 427 | Ga0105246_10070999 | 3300011119 | Bacteria | 2451 |
| 428 | Ga0157373_10001119 | 3300013100 | Bacteria | 20585 |
| 429 | Ga0157373_10017190 | 3300013100 | Bacteria | 5267 |
| 430 | Ga0157373_10043524 | 3300013100 | Unclassified | 3207 |
| 431 | Ga0157373_10049631 | 3300013100 | Bacteria | 2990 |
| 432 | Ga0157373_10058555 | 3300013100 | Unclassified | 2731 |
| 433 | Ga0157373_10177962 | 3300013100 | Bacteria | 1497 |
| 434 | Ga0157371_10012556 | 3300013102 | Bacteria | 6470 |
| 435 | Ga0157371_10013207 | 3300013102 | Bacteria | 6286 |
| 436 | Ga0157370_10016231 | 3300013104 | Bacteria | 7545 |
| 437 | Ga0157370_10158393 | 3300013104 | Bacteria | 2107 |
| 438 | Ga0157370_10289527 | 3300013104 | Bacteria | 1513 |
| 439 | Ga0157370_10469306 | 3300013104 | Bacteria | 1157 |
| 440 | Ga0157369_10000264 | 3300013105 | Bacteria | 70855 |
| 441 | Ga0157369_10010181 | 3300013105 | Bacteria | 10729 |
| 442 | Ga0157369_10014322 | 3300013105 | Bacteria | 8957 |
| 443 | Ga0157369_10078699 | 3300013105 | Bacteria | 3532 |
| 444 | Ga0157369_10102065 | 3300013105 | Bacteria | 3057 |
| 445 | Ga0157369_10150938 | 3300013105 | Unclassified | 2455 |
| 446 | Ga0157369_10225621 | 3300013105 | Bacteria | 1960 |
| 447 | Ga0157369_10256053 | 3300013105 | Bacteria | 1826 |
| 448 | Ga0157369_10284298 | 3300013105 | Bacteria | 1722 |
| 449 | Ga0157369_10354439 | 3300013105 | Bacteria | 1524 |
| 450 | Ga0157369_10362392 | 3300013105 | Bacteria | 1505 |
| 451 | Ga0157369_10365070 | 3300013105 | Bacteria | 1499 |
| 452 | Ga0157369_10418488 | 3300013105 | Bacteria | 1389 |
| 453 | Ga0157374_10000249 | 3300013296 | Bacteria | 49808 |
| 454 | Ga0157374_10000496 | 3300013296 | Bacteria | 35685 |
| 455 | Ga0157374_10001107 | 3300013296 | Bacteria | 23202 |
| 456 | Ga0157374_10005920 | 3300013296 | Bacteria | 10330 |
| 457 | Ga0157374_10024491 | 3300013296 | Bacteria | 5412 |
| 458 | Ga0157374_10033131 | 3300013296 | Bacteria | 4712 |
| 459 | Ga0157374_10078774 | 3300013296 | Bacteria | 3121 |
| 460 | Ga0157374_10088066 | 3300013296 | Bacteria | 2956 |
| 461 | Ga0157374_10125558 | 3300013296 | Bacteria | 2480 |
| 462 | Ga0157374_10229305 | 3300013296 | Bacteria | 1824 |
| 463 | Ga0157378_10000008 | 3300013297 | Bacteria | 162605 |
| 464 | Ga0157378_10000145 | 3300013297 | Bacteria | 66719 |
| 465 | Ga0157378_10002765 | 3300013297 | Bacteria | 15636 |
| 466 | Ga0157378_10003358 | 3300013297 | Bacteria | 14239 |
| 467 | Ga0157378_10045872 | 3300013297 | Bacteria | 3884 |
| 468 | Ga0157378_10093841 | 3300013297 | Unclassified | 2732 |
| 469 | Ga0157378_10124723 | 3300013297 | Bacteria | 2378 |
| 470 | Ga0157378_10255933 | 3300013297 | Unclassified | 1678 |
| 471 | Ga0163162_10000777 | 3300013306 | Bacteria | 29697 |
| 472 | Ga0163162_10024543 | 3300013306 | Bacteria | 5952 |
| 473 | Ga0163162_10092330 | 3300013306 | Bacteria | 3111 |
| 474 | Ga0163162_10145019 | 3300013306 | Bacteria | 2490 |
| 475 | Ga0163162_10288342 | 3300013306 | Bacteria | 1773 |
| 476 | Ga0157372_10000436 | 3300013307 | Bacteria | 45959 |
| 477 | Ga0157372_10000611 | 3300013307 | Bacteria | 39068 |
| 478 | Ga0157372_10001696 | 3300013307 | Bacteria | 23852 |
| 479 | Ga0157372_10004250 | 3300013307 | Bacteria | 15312 |
| 480 | Ga0157372_10008298 | 3300013307 | Bacteria | 11043 |
| 481 | Ga0157372_10019394 | 3300013307 | Bacteria | 7330 |
| 482 | Ga0157372_10049516 | 3300013307 | Bacteria | 4671 |
| 483 | Ga0157372_10065331 | 3300013307 | Bacteria | 4084 |
| 484 | Ga0157372_10078438 | 3300013307 | Unclassified | 3732 |
| 485 | Ga0157372_10122925 | 3300013307 | Unclassified | 2983 |
| 486 | Ga0157372_10187711 | 3300013307 | Bacteria | 2394 |
| 487 | Ga0157372_10247006 | 3300013307 | Unclassified | 2071 |
| 488 | Ga0157375_10003580 | 3300013308 | Bacteria | 13482 |
| 489 | Ga0157375_10015367 | 3300013308 | Bacteria | 6850 |
| 490 | Ga0157375_10030491 | 3300013308 | Bacteria | 5085 |
| 491 | Ga0157375_10043801 | 3300013308 | Bacteria | 4343 |
| 492 | Ga0157375_10356373 | 3300013308 | Bacteria | 1629 |
| 493 | Ga0163163_10020441 | 3300014325 | Bacteria | 6234 |
| 494 | Ga0163163_10025274 | 3300014325 | Bacteria | 5662 |
| 495 | Ga0163163_10059974 | 3300014325 | Bacteria | 3765 |
| 496 | Ga0163163_10072291 | 3300014325 | Bacteria | 3438 |
| 497 | Ga0163163_10110393 | 3300014325 | Unclassified | 2778 |
| 498 | Ga0163163_10124386 | 3300014325 | Bacteria | 2615 |
| 499 | Ga0163163_10157889 | 3300014325 | Bacteria | 2313 |
| 500 | Ga0163163_10360639 | 3300014325 | Bacteria | 1510 |
| 501 | Ga0163163_10387049 | 3300014325 | Bacteria | 1456 |
| 502 | Ga0163163_10475204 | 3300014325 | Bacteria | 1311 |
| 503 | Ga0157380_10006237 | 3300014326 | Bacteria | 8375 |
| 504 | Ga0157380_10535390 | 3300014326 | Bacteria | 1146 |
| 505 | Ga0182008_10044746 | 3300014497 | Unclassified | 2202 |
| 506 | Ga0157377_10007969 | 3300014745 | Bacteria | 5144 |
| 507 | Ga0157379_10001812 | 3300014968 | Bacteria | 17646 |
| 508 | Ga0157379_10012865 | 3300014968 | Bacteria | 7318 |
| 509 | Ga0157379_10026975 | 3300014968 | Bacteria | 5112 |
| 510 | Ga0157379_10055120 | 3300014968 | Bacteria | 3552 |
| 511 | Ga0157379_10060793 | 3300014968 | Bacteria | 3378 |
| 512 | Ga0157379_10175320 | 3300014968 | Bacteria | 1936 |
| 513 | Ga0157376_10004063 | 3300014969 | Bacteria | 10125 |
| 514 | Ga0157376_10042115 | 3300014969 | Unclassified | 3742 |
| 515 | Ga0157376_10049476 | 3300014969 | Unclassified | 3482 |
| 516 | Ga0157376_10202439 | 3300014969 | Unclassified | 1828 |
| 517 | Ga0157376_10272741 | 3300014969 | Bacteria | 1590 |
| 518 | Ga0182006_1021588 | 3300015261 | Unclassified | 2683 |
| 519 | Ga0182006_1072942 | 3300015261 | Unclassified | 1268 |
| 520 | Ga0182007_10002409 | 3300015262 | Bacteria | 9337 |
| 521 | Ga0182007_10039680 | 3300015262 | Bacteria | 1574 |
| 522 | Ga0182005_1009264 | 3300015265 | Unclassified | 2869 |
| 523 | Ga0163161_10051815 | 3300017792 | Bacteria | 2975 |
| 524 | Ga0206354_10265616 | 3300020081 | Bacteria | 1731 |
| 525 | Ga0213873_10020908 | 3300021358 | Bacteria | 1534 |
| 526 | Ga0213872_10010735 | 3300021361 | Bacteria | 4351 |
| 527 | Ga0213872_10014357 | 3300021361 | Bacteria | 3695 |
| 528 | Ga0213871_10004023 | 3300021441 | Bacteria | 2899 |
| 529 | Ga0224712_10026682 | 3300022467 | Bacteria | 2045 |
| 530 | Ga0224712_10044458 | 3300022467 | Bacteria | 1694 |
| 531 | Ga0224570_100565 | 3300022730 | Bacteria | 2931 |
| 532 | Ga0224572_1000257 | 3300024225 | Bacteria | 5423 |
| 533 | Ga0228598_1001074 | 3300024227 | Bacteria | 6015 |
| 534 | Ga0228598_1001256 | 3300024227 | Bacteria | 5575 |
| 535 | Ga0207656_10036251 | 3300025321 | Unclassified | 2069 |
| 536 | Ga0207692_10063997 | 3300025898 | Bacteria | 1913 |
| 537 | Ga0207642_10005304 | 3300025899 | Bacteria | 4198 |
| 538 | Ga0207642_10018358 | 3300025899 | Bacteria | 2683 |
| 539 | Ga0207710_10075068 | 3300025900 | Bacteria | 1557 |
| 540 | Ga0207688_10003069 | 3300025901 | Bacteria | 9113 |
| 541 | Ga0207647_10002063 | 3300025904 | Bacteria | 15352 |
| 542 | Ga0207647_10016048 | 3300025904 | Bacteria | 5118 |
| 543 | Ga0207647_10049796 | 3300025904 | Unclassified | 2597 |
| 544 | Ga0207647_10098194 | 3300025904 | Bacteria | 1740 |
| 545 | Ga0207685_10003074 | 3300025905 | Unclassified | 3980 |
| 546 | Ga0207685_10038958 | 3300025905 | Bacteria | 1761 |
| 547 | Ga0207699_10009701 | 3300025906 | Bacteria | 4805 |
| 548 | Ga0207699_10012015 | 3300025906 | Bacteria | 4393 |
| 549 | Ga0207699_10050642 | 3300025906 | Unclassified | 2450 |
| 550 | Ga0207699_10067586 | 3300025906 | Bacteria | 2173 |
| 551 | Ga0207699_10094136 | 3300025906 | Unclassified | 1887 |
| 552 | Ga0207699_10146111 | 3300025906 | Bacteria | 1559 |
| 553 | Ga0207699_10252550 | 3300025906 | Bacteria | 1216 |
| 554 | Ga0207699_10334304 | 3300025906 | Bacteria | 1066 |
| 555 | Ga0207645_10000901 | 3300025907 | Bacteria | 24637 |
| 556 | Ga0207645_10006268 | 3300025907 | Bacteria | 8547 |
| 557 | Ga0207643_10000172 | 3300025908 | Bacteria | 44395 |
| 558 | Ga0207705_10045267 | 3300025909 | Bacteria | 3163 |
| 559 | Ga0207684_10000768 | 3300025910 | Bacteria | 37301 |
| 560 | Ga0207684_10005976 | 3300025910 | Bacteria | 11136 |
| 561 | Ga0207684_10016448 | 3300025910 | Bacteria | 6351 |
| 562 | Ga0207684_10017175 | 3300025910 | Bacteria | 6210 |
| 563 | Ga0207684_10062474 | 3300025910 | Unclassified | 3163 |
| 564 | Ga0207684_10094980 | 3300025910 | Unclassified | 2544 |
| 565 | Ga0207684_10103525 | 3300025910 | Bacteria | 2434 |
| 566 | Ga0207654_10029582 | 3300025911 | Bacteria | 3001 |
| 567 | Ga0207654_10032668 | 3300025911 | Bacteria | 2878 |
| 568 | Ga0207654_10057441 | 3300025911 | Bacteria | 2261 |
| 569 | Ga0207707_10000266 | 3300025912 | Bacteria | 56336 |
| 570 | Ga0207707_10003379 | 3300025912 | Bacteria | 14162 |
| 571 | Ga0207707_10007460 | 3300025912 | Bacteria | 9528 |
| 572 | Ga0207707_10011097 | 3300025912 | Bacteria | 7834 |
| 573 | Ga0207707_10021147 | 3300025912 | Bacteria | 5686 |
| 574 | Ga0207707_10065929 | 3300025912 | Bacteria | 3153 |
| 575 | Ga0207707_10101188 | 3300025912 | Bacteria | 2518 |
| 576 | Ga0207707_10177050 | 3300025912 | Bacteria | 1863 |
| 577 | Ga0207695_10000693 | 3300025913 | Bacteria | 66031 |
| 578 | Ga0207695_10003740 | 3300025913 | Bacteria | 21155 |
| 579 | Ga0207695_10007402 | 3300025913 | Bacteria | 13995 |
| 580 | Ga0207695_10016105 | 3300025913 | Bacteria | 8770 |
| 581 | Ga0207695_10037550 | 3300025913 | Bacteria | 5226 |
| 582 | Ga0207695_10115452 | 3300025913 | Bacteria | 2659 |
| 583 | Ga0207695_10178963 | 3300025913 | Bacteria | 2042 |
| 584 | Ga0207695_10373813 | 3300025913 | Unclassified | 1311 |
| 585 | Ga0207695_10480551 | 3300025913 | Bacteria | 1124 |
| 586 | Ga0207671_10027073 | 3300025914 | Bacteria | 4289 |
| 587 | Ga0207671_10064810 | 3300025914 | Bacteria | 2716 |
| 588 | Ga0207671_10133740 | 3300025914 | Bacteria | 1905 |
| 589 | Ga0207693_10000067 | 3300025915 | Bacteria | 91025 |
| 590 | Ga0207693_10000098 | 3300025915 | Bacteria | 77389 |
| 591 | Ga0207693_10000884 | 3300025915 | Bacteria | 26840 |
| 592 | Ga0207693_10001517 | 3300025915 | Bacteria | 20489 |
| 593 | Ga0207693_10012227 | 3300025915 | Bacteria | 6935 |
| 594 | Ga0207693_10016140 | 3300025915 | Bacteria | 5974 |
| 595 | Ga0207693_10020519 | 3300025915 | Bacteria | 5255 |
| 596 | Ga0207693_10044284 | 3300025915 | Bacteria | 3498 |
| 597 | Ga0207693_10079310 | 3300025915 | Bacteria | 2569 |
| 598 | Ga0207693_10112274 | 3300025915 | Bacteria | 2138 |
| 599 | Ga0207693_10237676 | 3300025915 | Bacteria | 1430 |
| 600 | Ga0207663_10007568 | 3300025916 | Bacteria | 5637 |
| 601 | Ga0207663_10014875 | 3300025916 | Bacteria | 4276 |
| 602 | Ga0207663_10031992 | 3300025916 | Bacteria | 3119 |
| 603 | Ga0207663_10041091 | 3300025916 | Bacteria | 2816 |
| 604 | Ga0207663_10087264 | 3300025916 | Unclassified | 2060 |
| 605 | Ga0207663_10089454 | 3300025916 | Unclassified | 2039 |
| 606 | Ga0207663_10095862 | 3300025916 | Bacteria | 1980 |
| 607 | Ga0207660_10002995 | 3300025917 | Bacteria | 11061 |
| 608 | Ga0207660_10061997 | 3300025917 | Bacteria | 2693 |
| 609 | Ga0207660_10074438 | 3300025917 | Unclassified | 2479 |
| 610 | Ga0207660_10178146 | 3300025917 | Unclassified | 1649 |
| 611 | Ga0207660_10285284 | 3300025917 | Bacteria | 1311 |
| 612 | Ga0207662_10002090 | 3300025918 | Bacteria | 9922 |
| 613 | Ga0207662_10174525 | 3300025918 | Bacteria | 1380 |
| 614 | Ga0207657_10000660 | 3300025919 | Bacteria | 36719 |
| 615 | Ga0207657_10002292 | 3300025919 | Bacteria | 20729 |
| 616 | Ga0207657_10016937 | 3300025919 | Bacteria | 7013 |
| 617 | Ga0207649_10001125 | 3300025920 | Bacteria | 16224 |
| 618 | Ga0207649_10023104 | 3300025920 | Bacteria | 3598 |
| 619 | Ga0207649_10156878 | 3300025920 | Unclassified | 1573 |
| 620 | Ga0207652_10001598 | 3300025921 | Bacteria | 19947 |
| 621 | Ga0207652_10003545 | 3300025921 | Bacteria | 12882 |
| 622 | Ga0207652_10038171 | 3300025921 | Bacteria | 4069 |
| 623 | Ga0207652_10064198 | 3300025921 | Unclassified | 3177 |
| 624 | Ga0207652_10106214 | 3300025921 | Bacteria | 2485 |
| 625 | Ga0207652_10139802 | 3300025921 | Unclassified | 2165 |
| 626 | Ga0207646_10000298 | 3300025922 | Bacteria | 67489 |
| 627 | Ga0207646_10004709 | 3300025922 | Bacteria | 14704 |
| 628 | Ga0207646_10045908 | 3300025922 | Bacteria | 3920 |
| 629 | Ga0207646_10046574 | 3300025922 | Bacteria | 3890 |
| 630 | Ga0207646_10077799 | 3300025922 | Bacteria | 2964 |
| 631 | Ga0207646_10102475 | 3300025922 | Bacteria | 2566 |
| 632 | Ga0207646_10320823 | 3300025922 | Bacteria | 1400 |
| 633 | Ga0207681_10064112 | 3300025923 | Bacteria | 2536 |
| 634 | Ga0207681_10228297 | 3300025923 | Unclassified | 1444 |
| 635 | Ga0207694_10002762 | 3300025924 | Bacteria | 14177 |
| 636 | Ga0207694_10029240 | 3300025924 | Unclassified | 4204 |
| 637 | Ga0207694_10065154 | 3300025924 | Bacteria | 2840 |
| 638 | Ga0207694_10122260 | 3300025924 | Unclassified | 2079 |
| 639 | Ga0207694_10245779 | 3300025924 | Bacteria | 1463 |
| 640 | Ga0207650_10000059 | 3300025925 | Bacteria | 151427 |
| 641 | Ga0207659_10145002 | 3300025926 | Bacteria | 1848 |
| 642 | Ga0207659_10157992 | 3300025926 | Bacteria | 1777 |
| 643 | Ga0207687_10006015 | 3300025927 | Bacteria | 8029 |
| 644 | Ga0207687_10009003 | 3300025927 | Bacteria | 6526 |
| 645 | Ga0207687_10009700 | 3300025927 | Bacteria | 6297 |
| 646 | Ga0207687_10103813 | 3300025927 | Bacteria | 2097 |
| 647 | Ga0207700_10008946 | 3300025928 | Bacteria | 6234 |
| 648 | Ga0207700_10015310 | 3300025928 | Bacteria | 5053 |
| 649 | Ga0207700_10018505 | 3300025928 | Bacteria | 4683 |
| 650 | Ga0207700_10018692 | 3300025928 | Bacteria | 4663 |
| 651 | Ga0207700_10021041 | 3300025928 | Unclassified | 4446 |
| 652 | Ga0207700_10024988 | 3300025928 | Bacteria | 4142 |
| 653 | Ga0207700_10063197 | 3300025928 | Unclassified | 2815 |
| 654 | Ga0207700_10069925 | 3300025928 | Unclassified | 2696 |
| 655 | Ga0207700_10099797 | 3300025928 | Unclassified | 2312 |
| 656 | Ga0207700_10144330 | 3300025928 | Bacteria | 1960 |
| 657 | Ga0207700_10151979 | 3300025928 | Unclassified | 1914 |
| 658 | Ga0207700_10186426 | 3300025928 | Bacteria | 1741 |
| 659 | Ga0207700_10217945 | 3300025928 | Unclassified | 1616 |
| 660 | Ga0207700_10296062 | 3300025928 | Unclassified | 1396 |
| 661 | Ga0207664_10000212 | 3300025929 | Bacteria | 44097 |
| 662 | Ga0207664_10066656 | 3300025929 | Bacteria | 2886 |
| 663 | Ga0207664_10079541 | 3300025929 | Unclassified | 2661 |
| 664 | Ga0207664_10138936 | 3300025929 | Unclassified | 2053 |
| 665 | Ga0207664_10138971 | 3300025929 | Unclassified | 2052 |
| 666 | Ga0207664_10314724 | 3300025929 | Bacteria | 1380 |
| 667 | Ga0207664_10360700 | 3300025929 | Bacteria | 1288 |
| 668 | Ga0207664_10448275 | 3300025929 | Unclassified | 1152 |
| 669 | Ga0207690_10089161 | 3300025932 | Unclassified | 2174 |
| 670 | Ga0207706_10000098 | 3300025933 | Bacteria | 91173 |
| 671 | Ga0207706_10000723 | 3300025933 | Bacteria | 34501 |
| 672 | Ga0207686_10069416 | 3300025934 | Unclassified | 2260 |
| 673 | Ga0207686_10085966 | 3300025934 | Bacteria | 2064 |
| 674 | Ga0207670_10053185 | 3300025936 | Bacteria | 2727 |
| 675 | Ga0207670_10205381 | 3300025936 | Bacteria | 1499 |
| 676 | Ga0207670_10326769 | 3300025936 | Bacteria | 1208 |
| 677 | Ga0207704_10048954 | 3300025938 | Bacteria | 2538 |
| 678 | Ga0207704_10075112 | 3300025938 | Bacteria | 2160 |
| 679 | Ga0207665_10020494 | 3300025939 | Unclassified | 4345 |
| 680 | Ga0207665_10037720 | 3300025939 | Bacteria | 3217 |
| 681 | Ga0207665_10067103 | 3300025939 | Bacteria | 2442 |
| 682 | Ga0207665_10104350 | 3300025939 | Bacteria | 1984 |
| 683 | Ga0207691_10001129 | 3300025940 | Bacteria | 26514 |
| 684 | Ga0207711_10004346 | 3300025941 | Bacteria | 12093 |
| 685 | Ga0207711_10035400 | 3300025941 | Bacteria | 4232 |
| 686 | Ga0207711_10074950 | 3300025941 | Bacteria | 2944 |
| 687 | Ga0207711_10114209 | 3300025941 | Bacteria | 2405 |
| 688 | Ga0207711_10143206 | 3300025941 | Bacteria | 2152 |
| 689 | Ga0207689_10000353 | 3300025942 | Bacteria | 43010 |
| 690 | Ga0207689_10038519 | 3300025942 | Unclassified | 3959 |
| 691 | Ga0207689_10098949 | 3300025942 | Bacteria | 2396 |
| 692 | Ga0207689_10141747 | 3300025942 | Bacteria | 1980 |
| 693 | Ga0207661_10021989 | 3300025944 | Bacteria | 4792 |
| 694 | Ga0207661_10096946 | 3300025944 | Bacteria | 2468 |
| 695 | Ga0207679_10000415 | 3300025945 | Bacteria | 30616 |
| 696 | Ga0207679_10031074 | 3300025945 | Bacteria | 3735 |
| 697 | Ga0207679_10216949 | 3300025945 | Bacteria | 1608 |
| 698 | Ga0207667_10000413 | 3300025949 | Bacteria | 57875 |
| 699 | Ga0207667_10006238 | 3300025949 | Bacteria | 14469 |
| 700 | Ga0207667_10012296 | 3300025949 | Bacteria | 9876 |
| 701 | Ga0207667_10018332 | 3300025949 | Bacteria | 7852 |
| 702 | Ga0207667_10066067 | 3300025949 | Bacteria | 3771 |
| 703 | Ga0207667_10083898 | 3300025949 | Bacteria | 3299 |
| 704 | Ga0207667_10148903 | 3300025949 | Unclassified | 2409 |
| 705 | Ga0207667_10326491 | 3300025949 | Bacteria | 1567 |
| 706 | Ga0207667_10348265 | 3300025949 | Bacteria | 1511 |
| 707 | Ga0207712_10007011 | 3300025961 | Bacteria | 7108 |
| 708 | Ga0207712_10142518 | 3300025961 | Bacteria | 1841 |
| 709 | Ga0207712_10198434 | 3300025961 | Bacteria | 1589 |
| 710 | Ga0207712_10268382 | 3300025961 | Bacteria | 1387 |
| 711 | Ga0207668_10008891 | 3300025972 | Bacteria | 6007 |
| 712 | Ga0207640_10060567 | 3300025981 | Bacteria | 2503 |
| 713 | Ga0207640_10079021 | 3300025981 | Unclassified | 2241 |
| 714 | Ga0207640_10089505 | 3300025981 | Bacteria | 2128 |
| 715 | Ga0207640_10149792 | 3300025981 | Unclassified | 1712 |
| 716 | Ga0207677_10001543 | 3300026023 | Bacteria | 12182 |
| 717 | Ga0207677_10001745 | 3300026023 | Bacteria | 11515 |
| 718 | Ga0207677_10003837 | 3300026023 | Bacteria | 7995 |
| 719 | Ga0207677_10004382 | 3300026023 | Bacteria | 7564 |
| 720 | Ga0207677_10011658 | 3300026023 | Bacteria | 5018 |
| 721 | Ga0207677_10078138 | 3300026023 | Bacteria | 2362 |
| 722 | Ga0207677_10192605 | 3300026023 | Bacteria | 1614 |
| 723 | Ga0207703_10006204 | 3300026035 | Bacteria | 9564 |
| 724 | Ga0207703_10007234 | 3300026035 | Bacteria | 8827 |
| 725 | Ga0207703_10010063 | 3300026035 | Bacteria | 7414 |
| 726 | Ga0207703_10050625 | 3300026035 | Unclassified | 3363 |
| 727 | Ga0207703_10069955 | 3300026035 | Bacteria | 2896 |
| 728 | Ga0207703_10105216 | 3300026035 | Bacteria | 2398 |
| 729 | Ga0207703_10373062 | 3300026035 | Bacteria | 1318 |
| 730 | Ga0207639_10016209 | 3300026041 | Bacteria | 5266 |
| 731 | Ga0207639_10038468 | 3300026041 | Unclassified | 3559 |
| 732 | Ga0207639_10077952 | 3300026041 | Bacteria | 2614 |
| 733 | Ga0207678_10000581 | 3300026067 | Bacteria | 33440 |
| 734 | Ga0207678_10006094 | 3300026067 | Bacteria | 10728 |
| 735 | Ga0207708_10353370 | 3300026075 | Bacteria | 1206 |
| 736 | Ga0207702_10000209 | 3300026078 | Bacteria | 69358 |
| 737 | Ga0207702_10001199 | 3300026078 | Bacteria | 26302 |
| 738 | Ga0207702_10003037 | 3300026078 | Bacteria | 15597 |
| 739 | Ga0207702_10055790 | 3300026078 | Bacteria | 3352 |
| 740 | Ga0207702_10073539 | 3300026078 | Unclassified | 2948 |
| 741 | Ga0207702_10099952 | 3300026078 | Unclassified | 2558 |
| 742 | Ga0207702_10173363 | 3300026078 | Bacteria | 1980 |
| 743 | Ga0207702_10222748 | 3300026078 | Bacteria | 1758 |
| 744 | Ga0207702_10313036 | 3300026078 | Unclassified | 1493 |
| 745 | Ga0207702_10396022 | 3300026078 | Bacteria | 1331 |
| 746 | Ga0207702_10432168 | 3300026078 | Bacteria | 1275 |
| 747 | Ga0207641_10000025 | 3300026088 | Bacteria | 247727 |
| 748 | Ga0207641_10008027 | 3300026088 | Bacteria | 8749 |
| 749 | Ga0207641_10020912 | 3300026088 | Bacteria | 5379 |
| 750 | Ga0207641_10059041 | 3300026088 | Bacteria | 3266 |
| 751 | Ga0207641_10063347 | 3300026088 | Bacteria | 3158 |
| 752 | Ga0207641_10068485 | 3300026088 | Bacteria | 3044 |
| 753 | Ga0207648_10003458 | 3300026089 | Bacteria | 16561 |
| 754 | Ga0207648_10047694 | 3300026089 | Bacteria | 3753 |
| 755 | Ga0207676_10000252 | 3300026095 | Bacteria | 46432 |
| 756 | Ga0207676_10002695 | 3300026095 | Bacteria | 12631 |
| 757 | Ga0207676_10008202 | 3300026095 | Bacteria | 7432 |
| 758 | Ga0207676_10032451 | 3300026095 | Bacteria | 3935 |
| 759 | Ga0207674_10000162 | 3300026116 | Bacteria | 79631 |
| 760 | Ga0207674_10003030 | 3300026116 | Bacteria | 20822 |
| 761 | Ga0207674_10042580 | 3300026116 | Bacteria | 4688 |
| 762 | Ga0207674_10078029 | 3300026116 | Bacteria | 3317 |
| 763 | Ga0207674_10127467 | 3300026116 | Unclassified | 2510 |
| 764 | Ga0207674_10214815 | 3300026116 | Bacteria | 1872 |
| 765 | Ga0207675_100017450 | 3300026118 | Bacteria | 6700 |
| 766 | Ga0207675_100027963 | 3300026118 | Bacteria | 5251 |
| 767 | Ga0207675_100078474 | 3300026118 | Bacteria | 3094 |
| 768 | Ga0207683_10001306 | 3300026121 | Bacteria | 22515 |
| 769 | Ga0207683_10083016 | 3300026121 | Unclassified | 2847 |
| 770 | Ga0207698_10029146 | 3300026142 | Bacteria | 3948 |
| 771 | Ga0207428_10000435 | 3300027907 | Bacteria | 51355 |
| 772 | Ga0207428_10000846 | 3300027907 | Bacteria | 34463 |
| 773 | Ga0207428_10041335 | 3300027907 | Bacteria | 3733 |
| 774 | Ga0265356_1000857 | 3300028017 | Bacteria | 4995 |
| 775 | Ga0268266_10010266 | 3300028379 | Bacteria | 8199 |
| 776 | Ga0268264_10025084 | 3300028381 | Unclassified | 4872 |
| 777 | Ga0268264_10050987 | 3300028381 | Bacteria | 3447 |
| 778 | Ga0268264_10063001 | 3300028381 | Bacteria | 3116 |
| 779 | Ga0268264_10066451 | 3300028381 | Bacteria | 3041 |
| 780 | Ga0268264_10096896 | 3300028381 | Bacteria | 2556 |
| 781 | Ga0268264_10307434 | 3300028381 | Bacteria | 1495 |
| 782 | Ga0265338_10004251 | 3300028800 | Bacteria | 19463 |
| 783 | Ga0265338_10024675 | 3300028800 | Bacteria | 6135 |
| 784 | Ga0265338_10148870 | 3300028800 | Unclassified | 1821 |
| 785 | Ga0265338_10196671 | 3300028800 | Bacteria | 1524 |
| 786 | Ga0265762_1000116 | 3300030760 | Bacteria | 11753 |
| 787 | Ga0265762_1001781 | 3300030760 | Bacteria | 3913 |
| 788 | Ga0265760_10002278 | 3300031090 | Bacteria | 5612 |
| 789 | Ga0265760_10002457 | 3300031090 | Bacteria | 5408 |
| 790 | Ga0265760_10018115 | 3300031090 | Bacteria | 2025 |
| 791 | Ga0265330_10005484 | 3300031235 | Bacteria | 6330 |
| 792 | Ga0265325_10025527 | 3300031241 | Bacteria | 3207 |
| 793 | Ga0265325_10047993 | 3300031241 | Unclassified | 2208 |
| 794 | Ga0265339_10018777 | 3300031249 | Bacteria | 4071 |
| 795 | Ga0265339_10019646 | 3300031249 | Bacteria | 3963 |
| 796 | Ga0265339_10159198 | 3300031249 | Bacteria | 1137 |
| 797 | Ga0265316_10041782 | 3300031344 | Bacteria | 3667 |
| 798 | Ga0265316_10048446 | 3300031344 | Bacteria | 3354 |
| 799 | Ga0265316_10113095 | 3300031344 | Bacteria | 2055 |
| 800 | Ga0307408_100012830 | 3300031548 | Bacteria | 5558 |
| 801 | Ga0307408_100110828 | 3300031548 | Bacteria | 2108 |
| 802 | Ga0307408_100152467 | 3300031548 | Bacteria | 1826 |
| 803 | Ga0307408_100194934 | 3300031548 | Bacteria | 1635 |
| 804 | Ga0307408_100287197 | 3300031548 | Bacteria | 1372 |
| 805 | Ga0265314_10004435 | 3300031711 | Bacteria | 13025 |
| 806 | Ga0265314_10080937 | 3300031711 | Bacteria | 2142 |
| 807 | Ga0265314_10169979 | 3300031711 | Bacteria | 1317 |
| 808 | Ga0265342_10061692 | 3300031712 | Bacteria | 2208 |
| 809 | Ga0307405_10036139 | 3300031731 | Bacteria | 2957 |
| 810 | Ga0307405_10077866 | 3300031731 | Bacteria | 2156 |
| 811 | Ga0307410_10004067 | 3300031852 | Bacteria | 7481 |
| 812 | Ga0307410_10135625 | 3300031852 | Bacteria | 1814 |
| 813 | Ga0307406_10081672 | 3300031901 | Bacteria | 2150 |
| 814 | Ga0307407_10156535 | 3300031903 | Bacteria | 1487 |
| 815 | Ga0307407_10181292 | 3300031903 | Bacteria | 1396 |
| 816 | Ga0307412_10046266 | 3300031911 | Bacteria | 2850 |
| 817 | Ga0307409_100030864 | 3300031995 | Bacteria | 3858 |
| 818 | Ga0307416_100003885 | 3300032002 | Bacteria | 8894 |
| 819 | Ga0307416_100040415 | 3300032002 | Bacteria | 3623 |
| 820 | Ga0307416_100047412 | 3300032002 | Bacteria | 3401 |
| 821 | Ga0307416_100061300 | 3300032002 | Bacteria | 3069 |
| 822 | Ga0307416_100081440 | 3300032002 | Bacteria | 2737 |
| 823 | Ga0307416_100117482 | 3300032002 | Bacteria | 2361 |
| 824 | Ga0307416_100354754 | 3300032002 | Bacteria | 1486 |
| 825 | Ga0307416_100463725 | 3300032002 | Bacteria | 1323 |
| 826 | Ga0307411_10006952 | 3300032005 | Bacteria | 5711 |
| 827 | Ga0307411_10125471 | 3300032005 | Bacteria | 1866 |
| 828 | Ga0307411_10282574 | 3300032005 | Bacteria | 1322 |
| 829 | Ga0307415_100010919 | 3300032126 | Bacteria | 5168 |
| 830 | Ga0307415_100503072 | 3300032126 | Bacteria | 1060 |
| 831 | Ga0316212_1003932 | 3300033547 | Bacteria | 2157 |
| 832 | Ga0373926_0017457 | 3300035083 | Bacteria | 2463 |
| 833 | Ga0373923_0001393 | 3300035111 | Bacteria | 6891 |
| 834 | Ga0373923_0038824 | 3300035111 | Bacteria | 1953 |
| 835 | Ga0373923_0090879 | 3300035111 | Unclassified | 1335 |
| 836 | Ga0373936_0000319 | 3300035113 | Bacteria | 16274 |
| 837 | Ga0373936_0090408 | 3300035113 | Bacteria | 1283 |
| 838 | Ga0373945_0001313 | 3300035116 | Bacteria | 7543 |
| 839 | Ga0373945_0060547 | 3300035116 | Bacteria | 1412 |
| 840 | Ga0373956_0007158 | 3300035119 | Bacteria | 4491 |
| 841 | Ga0373956_0073444 | 3300035119 | Unclassified | 1563 |
| 842 | Ga0373943_0000016 | 3300035170 | Bacteria | 58099 |
| 843 | Ga0373943_0016294 | 3300035170 | Bacteria | 3387 |
| 844 | Ga0373943_0040390 | 3300035170 | Bacteria | 2252 |
| 845 | Ga0373946_0019422 | 3300035171 | Bacteria | 2618 |
| 846 | Ga0373924_0000248 | 3300035410 | Bacteria | 16512 |
| 847 | Ga0373924_0003372 | 3300035410 | Bacteria | 5486 |
| 848 | Ga0373924_0031217 | 3300035410 | Bacteria | 2141 |
| 849 | Ga0373931_0007410 | 3300035691 | Bacteria | 5167 |
| 850 | Ga0373931_0032147 | 3300035691 | Bacteria | 2714 |
| 851 | Ga0373931_0045293 | 3300035691 | Unclassified | 2323 |
| 852 | Ga0373935_0000864 | 3300035692 | Bacteria | 16342 |
| 853 | Ga0373935_0003124 | 3300035692 | Bacteria | 9554 |
| 854 | Ga0373935_0006632 | 3300035692 | Bacteria | 6916 |
| 855 | Ga0373935_0010148 | 3300035692 | Bacteria | 5641 |
| 856 | Ga0373935_0032320 | 3300035692 | Unclassified | 3252 |
| 857 | Ga0373927_0000034 | 3300035695 | Bacteria | 103921 |
| 858 | Ga0373927_0058122 | 3300035695 | Unclassified | 2501 |
| 859 | Ga0373927_0072792 | 3300035695 | Unclassified | 2225 |
| 860 | Ga0373927_0078965 | 3300035695 | Bacteria | 2131 |
| 861 | Ga0373927_0111053 | 3300035695 | Bacteria | 1786 |
| 862 | Ga0373933_0015818 | 3300035724 | Bacteria | 4210 |
| 863 | Ga0373947_0000035 | 3300035725 | Bacteria | 68883 |
| 864 | Ga0373947_0017382 | 3300035725 | Bacteria | 4137 |
| 865 | Ga0373947_0039779 | 3300035725 | Bacteria | 2799 |
| 866 | Ga0373947_0087873 | 3300035725 | Bacteria | 1934 |
| 867 | Ga0373937_0000090 | 3300036401 | Bacteria | 84561 |
| 868 | Ga0373937_0049245 | 3300036401 | Bacteria | 3859 |
| 869 | Ga0373937_0076551 | 3300036401 | Bacteria | 3090 |
| 870 | Ga0373937_0440853 | 3300036401 | Unclassified | 1236 |
| 871 | Ga0373937_0647934 | 3300036401 | Bacteria | 1002 |
| 872 | Ga0373925_0000714 | 3300037068 | Bacteria | 31008 |
| 873 | Ga0373925_0005732 | 3300037068 | Bacteria | 9234 |
| 874 | Ga0373925_0006084 | 3300037068 | Bacteria | 8925 |
| 875 | Ga0373925_0021655 | 3300037068 | Bacteria | 4685 |
| 876 | Ga0373925_0048158 | 3300037068 | Bacteria | 3175 |
| 877 | Ga0373925_0127295 | 3300037068 | Bacteria | 1983 |
| 878 | Ga0373925_0178622 | 3300037068 | Unclassified | 1679 |
| 879 | Ga0373925_0226782 | 3300037068 | Bacteria | 1493 |
| 880 | Ga0395900_0460942 | 3300037418 | Bacteria | 1226 |
| 881 | Ga0395898_0049727 | 3300037466 | Bacteria | 4107 |
| 882 | Ga0395898_0177640 | 3300037466 | Bacteria | 2035 |
| 883 | Ga0395905_0003951 | 3300037471 | Bacteria | 15596 |
| 884 | Ga0395905_0026624 | 3300037471 | Bacteria | 5452 |
| 885 | Ga0395905_0070863 | 3300037471 | Bacteria | 3267 |
| 886 | Ga0395905_0090299 | 3300037471 | Bacteria | 2872 |
| 887 | Ga0395905_0092192 | 3300037471 | Unclassified | 2841 |
| 888 | Ga0436364_0366631 | 3300037853 | Bacteria | 1687 |
| 889 | Ga0395901_0219459 | 3300038443 | Unclassified | 1988 |
| 890 | Ga0436360_0174134 | 3300039438 | Unclassified | 3345 |
| 891 | Ga0436361_0534152 | 3300039447 | Bacteria | 2191 |
| 892 | Ga0436361_0620753 | 3300039447 | Bacteria | 4828 |
| 893 | Ga0436361_0635090 | 3300039447 | Bacteria | 20791 |
| 894 | Ga0436361_0706896 | 3300039447 | Bacteria | 2278 |
| 895 | Ga0436363_0375979 | 3300039450 | Bacteria | 2267 |
| 896 | Ga0436363_1252730 | 3300039450 | Bacteria | 2815 |
| 897 | Ga0436363_1383135 | 3300039450 | Unclassified | 2016 |
| 898 | Ga0436363_1663027 | 3300039450 | Bacteria | 1869 |
| 899 | Ga0436362_0906121 | 3300039453 | Bacteria | 1536 |
| 900 | Ga0436362_1104320 | 3300039453 | Bacteria | 2121 |
| 901 | Ga0436362_1148430 | 3300039453 | Bacteria | 7068 |
| 902 | Ga0451853_2499464 | 3300041512 | Bacteria | 1342 |
| 903 | Ga0439462_0031366 | 3300042015 | Bacteria | 1407 |
| 904 | Ga0451577_0001555 | 3300042876 | Bacteria | 30103 |
| 905 | Ga0451577_0113458 | 3300042876 | Bacteria | 2426 |
| 906 | Ga0466969_0056413 | 3300044656 | Bacteria | 1918 |
| 907 | Ga0466963_0005503 | 3300044694 | Bacteria | 7414 |
| 908 | Ga0466963_0049233 | 3300044694 | Unclassified | 2786 |
| 909 | Ga0466963_0049475 | 3300044694 | Bacteria | 2780 |
| 910 | Ga0453684_0000289 | 3300044712 | Bacteria | 215476 |
| 911 | Ga0453684_0019897 | 3300044712 | Bacteria | 10181 |
| 912 | Ga0466957_0018353 | 3300044842 | Bacteria | 4108 |
| 913 | Ga0466957_0095683 | 3300044842 | Bacteria | 1865 |
| 914 | Ga0466957_0132345 | 3300044842 | Bacteria | 1599 |
| 915 | Ga0466959_0033530 | 3300045049 | Unclassified | 3797 |
| 916 | Ga0466959_0035415 | 3300045049 | Bacteria | 3692 |
| 917 | Ga0466959_0209135 | 3300045049 | Bacteria | 1356 |
| 918 | Ga0451576_0035560 | 3300045051 | Bacteria | 5283 |
| 919 | Ga0451576_0420030 | 3300045051 | Bacteria | 1403 |
| 920 | Ga0451576_0531076 | 3300045051 | Bacteria | 1236 |
| 921 | Ga0466958_0026948 | 3300045836 | Bacteria | 3398 |
| 922 | Ga0466958_0147300 | 3300045836 | Unclassified | 1484 |
| 923 | Ga0466967_0055328 | 3300045976 | Bacteria | 3495 |
| 924 | Ga0466967_0114172 | 3300045976 | Bacteria | 2486 |
| 925 | Ga0495592_0139215 | 3300046454 | Bacteria | 1690 |
| 926 | Ga0495629_0021849 | 3300046459 | Bacteria | 4566 |
| 927 | Ga0495629_0077853 | 3300046459 | Bacteria | 2315 |
| 928 | Ga0495580_0000354 | 3300046472 | Bacteria | 37390 |
| 929 | Ga0495580_0001606 | 3300046472 | Bacteria | 19867 |
| 930 | Ga0495580_0002290 | 3300046472 | Bacteria | 16705 |
| 931 | Ga0495580_0004272 | 3300046472 | Bacteria | 12014 |
| 932 | Ga0495580_0004478 | 3300046472 | Bacteria | 11736 |
| 933 | Ga0495580_0019736 | 3300046472 | Bacteria | 5004 |
| 934 | Ga0495580_0022694 | 3300046472 | Bacteria | 4614 |
| 935 | Ga0495580_0023751 | 3300046472 | Bacteria | 4497 |
| 936 | Ga0495580_0025920 | 3300046472 | Unclassified | 4279 |
| 937 | Ga0495580_0046482 | 3300046472 | Bacteria | 3079 |
| 938 | Ga0495580_0051886 | 3300046472 | Bacteria | 2898 |
| 939 | Ga0495580_0078652 | 3300046472 | Bacteria | 2300 |
| 940 | Ga0495580_0092740 | 3300046472 | Bacteria | 2102 |
| 941 | Ga0495580_0098837 | 3300046472 | Unclassified | 2030 |
| 942 | Ga0495580_0132859 | 3300046472 | Bacteria | 1726 |
| 943 | Ga0495664_0049533 | 3300046477 | Unclassified | 2494 |
| 944 | Ga0495594_0008908 | 3300046499 | Bacteria | 5175 |
| 945 | Ga0495630_0001984 | 3300046517 | Bacteria | 14253 |
| 946 | Ga0495630_0011837 | 3300046517 | Bacteria | 6322 |
| 947 | Ga0495630_0026718 | 3300046517 | Bacteria | 4276 |
| 948 | Ga0495630_0074146 | 3300046517 | Unclassified | 2563 |
| 949 | Ga0495630_0120901 | 3300046517 | Bacteria | 1987 |
| 950 | Ga0495666_0112078 | 3300046526 | Unclassified | 1281 |
| 951 | Ga0495665_0014305 | 3300046531 | Unclassified | 4281 |
| 952 | Ga0495587_0077896 | 3300046536 | Bacteria | 1924 |
| 953 | Ga0495667_0043718 | 3300046559 | Bacteria | 2968 |
| 954 | Ga0495635_0179857 | 3300046663 | Unclassified | 1438 |
| 955 | Ga0495657_0220848 | 3300046675 | Unclassified | 1149 |
| 956 | Ga0495599_0060721 | 3300046678 | Bacteria | 2364 |
| 957 | Ga0495623_0039822 | 3300046679 | Bacteria | 3002 |
| 958 | Ga0495658_0013179 | 3300046683 | Bacteria | 4206 |
| 959 | Ga0495658_0035332 | 3300046683 | Unclassified | 2749 |
| 960 | Ga0495669_0000991 | 3300046684 | Bacteria | 11866 |
| 961 | Ga0495669_0002685 | 3300046684 | Bacteria | 7283 |
| 962 | Ga0495669_0074677 | 3300046684 | Bacteria | 1550 |
| 963 | Ga0495613_0000670 | 3300046689 | Bacteria | 27111 |
| 964 | Ga0495613_0177997 | 3300046689 | Bacteria | 1507 |
| 965 | Ga0495613_0178872 | 3300046689 | Bacteria | 1503 |
| 966 | Ga0495613_0202417 | 3300046689 | Bacteria | 1399 |
| 967 | Ga0495600_0016234 | 3300046809 | Bacteria | 4722 |
| 968 | Ga0495600_0126297 | 3300046809 | Bacteria | 1664 |
| 969 | Ga0495600_0133668 | 3300046809 | Bacteria | 1612 |
| 970 | Ga0495581_0029073 | 3300047315 | Bacteria | 3204 |
| 971 | Ga0495604_0028162 | 3300047317 | Bacteria | 4469 |
| 972 | Ga0495604_0032592 | 3300047317 | Unclassified | 4129 |
| 973 | Ga0495604_0042957 | 3300047317 | Bacteria | 3541 |
| 974 | Ga0495636_0048202 | 3300047318 | Bacteria | 1780 |
| 975 | Ga0495674_0016645 | 3300047319 | Bacteria | 6860 |
| 976 | Ga0495674_0078187 | 3300047319 | Bacteria | 2843 |
| 977 | Ga0495672_0055485 | 3300047320 | Bacteria | 2312 |
| 978 | Ga0495675_0013233 | 3300047444 | Bacteria | 5207 |
| 979 | Ga0495675_0090400 | 3300047444 | Bacteria | 1922 |
| 980 | Ga0495677_0090568 | 3300047445 | Bacteria | 1152 |
| 981 | Ga0495684_0009482 | 3300047471 | Bacteria | 7511 |
| 982 | Ga0495684_0187855 | 3300047471 | Bacteria | 1529 |
| 983 | Ga0495602_0103606 | 3300048088 | Bacteria | 2329 |
| 984 | Ga0495614_0108478 | 3300048089 | Unclassified | 1218 |
| 985 | Ga0496100_0038130 | 3300048903 | Bacteria | 3043 |
| 986 | Ga0496101_0057320 | 3300048904 | Bacteria | 2818 |
| 987 | Ga0496101_0109408 | 3300048904 | Bacteria | 2079 |
| 988 | Ga0496101_0243345 | 3300048904 | Bacteria | 1400 |
| 989 | Ga0496101_0281897 | 3300048904 | Bacteria | 1299 |
| 990 | Ga0496102_0002608 | 3300048905 | Bacteria | 15350 |
| 991 | Ga0496102_0026380 | 3300048905 | Bacteria | 5182 |
| 992 | Ga0496102_0028897 | 3300048905 | Bacteria | 4956 |
| 993 | Ga0496102_0042036 | 3300048905 | Unclassified | 4142 |
| 994 | Ga0496102_0107895 | 3300048905 | Unclassified | 2593 |
| 995 | Ga0496102_0224927 | 3300048905 | Bacteria | 1769 |
| 996 | Ga0496103_0063905 | 3300048906 | Bacteria | 2293 |
| 997 | Ga0496103_0137086 | 3300048906 | Unclassified | 1564 |
| 998 | Ga0496104_0008792 | 3300048907 | Bacteria | 8978 |
| 999 | Ga0496104_0091926 | 3300048907 | Bacteria | 2901 |
| 1000 | Ga0496104_0163570 | 3300048907 | Bacteria | 2134 |
| 1001 | Ga0496104_0299112 | 3300048907 | Bacteria | 1521 |
| 1002 | Ga0496104_0326605 | 3300048907 | Unclassified | 1447 |
| 1003 | Ga0496104_0457469 | 3300048907 | Bacteria | 1188 |
| 1004 | Ga0496105_0000584 | 3300048908 | Bacteria | 24242 |
| 1005 | Ga0496105_0053823 | 3300048908 | Bacteria | 3324 |
| 1006 | Ga0496106_0085428 | 3300048909 | Bacteria | 2430 |
| 1007 | Ga0496106_0353486 | 3300048909 | Bacteria | 1180 |
| 1008 | Ga0496107_0139938 | 3300048910 | Bacteria | 1789 |
| 1009 | Ga0496108_0000203 | 3300048911 | Bacteria | 54921 |
| 1010 | Ga0496108_0135570 | 3300048911 | Bacteria | 2118 |
| 1011 | Ga0496108_0306696 | 3300048911 | Unclassified | 1383 |
| 1012 | Ga0496109_0000080 | 3300048912 | Bacteria | 100056 |
| 1013 | Ga0496109_0000228 | 3300048912 | Bacteria | 54849 |
| 1014 | Ga0496109_0031502 | 3300048912 | Bacteria | 4759 |
| 1015 | Ga0496110_0000145 | 3300048913 | Bacteria | 41800 |
| 1016 | Ga0496110_0023501 | 3300048913 | Bacteria | 5244 |
| 1017 | Ga0496110_0076017 | 3300048913 | Bacteria | 2985 |
| 1018 | Ga0496110_0179781 | 3300048913 | Unclassified | 1921 |
| 1019 | Ga0496110_0479489 | 3300048913 | Bacteria | 1133 |
| 1020 | Ga0496111_0003439 | 3300048914 | Bacteria | 9791 |
| 1021 | Ga0496111_0060610 | 3300048914 | Unclassified | 2743 |
| 1022 | Ga0496111_0115526 | 3300048914 | Bacteria | 1979 |
| 1023 | Ga0496111_0187711 | 3300048914 | Bacteria | 1537 |
| 1024 | Ga0496112_0000048 | 3300048915 | Bacteria | 84789 |
| 1025 | Ga0496112_0001123 | 3300048915 | Bacteria | 19904 |
| 1026 | Ga0496112_0002435 | 3300048915 | Bacteria | 14999 |
| 1027 | Ga0496112_0004578 | 3300048915 | Bacteria | 11754 |
| 1028 | Ga0496112_0006190 | 3300048915 | Bacteria | 10470 |
| 1029 | Ga0496112_0008072 | 3300048915 | Bacteria | 9398 |
| 1030 | Ga0496112_0063880 | 3300048915 | Bacteria | 3632 |
| 1031 | Ga0496112_0129203 | 3300048915 | Bacteria | 2498 |
| 1032 | Ga0496112_0173849 | 3300048915 | Bacteria | 2119 |
| 1033 | Ga0496112_0212238 | 3300048915 | Bacteria | 1893 |
| 1034 | Ga0496113_0001316 | 3300048916 | Bacteria | 13730 |
| 1035 | Ga0496113_0002647 | 3300048916 | Bacteria | 10487 |
| 1036 | Ga0496114_0021153 | 3300048917 | Bacteria | 5289 |
| 1037 | Ga0496115_0051371 | 3300048918 | Bacteria | 3306 |
| 1038 | Ga0496115_0086899 | 3300048918 | Bacteria | 2552 |
| 1039 | Ga0496115_0260447 | 3300048918 | Bacteria | 1426 |
| 1040 | Ga0496115_0357787 | 3300048918 | Bacteria | 1190 |
| 1041 | Ga0496115_0471910 | 3300048918 | Unclassified | 1011 |
| 1042 | Ga0496126_0006296 | 3300048929 | Bacteria | 13254 |
| 1043 | Ga0501031_0038147 | 3300049568 | Bacteria | 3136 |
| 1044 | Ga0501031_0065791 | 3300049568 | Bacteria | 2362 |
| 1045 | Ga0501032_0018387 | 3300049569 | Bacteria | 4897 |
| 1046 | Ga0501034_0013627 | 3300049571 | Bacteria | 8363 |
| 1047 | Ga0501034_0040164 | 3300049571 | Bacteria | 4737 |
| 1048 | Ga0501034_0072287 | 3300049571 | Bacteria | 3458 |
| 1049 | Ga0501034_0305587 | 3300049571 | Bacteria | 1526 |
| 1050 | Ga0501036_0030799 | 3300049572 | Bacteria | 4533 |
| 1051 | Ga0501036_0062073 | 3300049572 | Bacteria | 3165 |
| 1052 | Ga0501036_0194759 | 3300049572 | Bacteria | 1705 |
| 1053 | Ga0501036_0395569 | 3300049572 | Bacteria | 1153 |
| 1054 | Ga0501037_0108903 | 3300049573 | Bacteria | 1996 |
| 1055 | Ga0501038_0034756 | 3300049574 | Bacteria | 4429 |
| 1056 | Ga0501038_0057722 | 3300049574 | Bacteria | 3332 |
| 1057 | Ga0501038_0057746 | 3300049574 | Bacteria | 3331 |
| 1058 | Ga0501039_0003109 | 3300049575 | Bacteria | 12405 |
| 1059 | Ga0501039_0089362 | 3300049575 | Bacteria | 2401 |
| 1060 | Ga0501040_0201743 | 3300049576 | Bacteria | 1412 |
| 1061 | Ga0501041_0072689 | 3300049577 | Bacteria | 2113 |
| 1062 | Ga0501041_0205129 | 3300049577 | Bacteria | 1236 |
| 1063 | Ga0501042_0014107 | 3300049578 | Bacteria | 5449 |
| 1064 | Ga0501043_0015240 | 3300049579 | Bacteria | 6020 |
| 1065 | Ga0501043_0243822 | 3300049579 | Bacteria | 1385 |
| 1066 | Ga0501046_0028314 | 3300049580 | Bacteria | 4564 |
| 1067 | Ga0501046_0029522 | 3300049580 | Bacteria | 4457 |
| 1068 | Ga0501047_0017959 | 3300049581 | Bacteria | 6779 |
| 1069 | Ga0501047_0061399 | 3300049581 | Bacteria | 3626 |
| 1070 | Ga0501047_0287344 | 3300049581 | Bacteria | 1488 |
| 1071 | Ga0501047_0400480 | 3300049581 | Bacteria | 1205 |
| 1072 | Ga0501048_0090923 | 3300049582 | Bacteria | 2153 |
| 1073 | Ga0501048_0135043 | 3300049582 | Bacteria | 1743 |
| 1074 | Ga0501048_0335269 | 3300049582 | Bacteria | 1078 |
| 1075 | Ga0501068_0019437 | 3300049584 | Bacteria | 3945 |
| 1076 | Ga0501068_0056767 | 3300049584 | Bacteria | 2373 |
| 1077 | Ga0501070_0141430 | 3300049586 | Bacteria | 1987 |
| 1078 | Ga0501071_0016257 | 3300049587 | Bacteria | 5116 |
| 1079 | Ga0501071_0138459 | 3300049587 | Bacteria | 1812 |
| 1080 | Ga0501072_0068282 | 3300049588 | Bacteria | 2806 |
| 1081 | Ga0501072_0070436 | 3300049588 | Bacteria | 2762 |
| 1082 | Ga0501072_0076605 | 3300049588 | Bacteria | 2646 |
| 1083 | Ga0501072_0187445 | 3300049588 | Bacteria | 1650 |
| 1084 | Ga0501073_0097468 | 3300049589 | Bacteria | 2042 |
| 1085 | Ga0501074_0140727 | 3300049590 | Bacteria | 1726 |
| 1086 | Ga0501075_0000178 | 3300049591 | Bacteria | 33062 |
| 1087 | Ga0501075_0031140 | 3300049591 | Bacteria | 3958 |
| 1088 | Ga0501075_0044998 | 3300049591 | Bacteria | 3312 |
| 1089 | Ga0501075_0048456 | 3300049591 | Bacteria | 3193 |
| 1090 | Ga0501076_0411308 | 3300049592 | Bacteria | 1113 |
| 1091 | Ga0501079_0022743 | 3300049741 | Bacteria | 4811 |
| 1092 | Ga0501079_0108957 | 3300049741 | Bacteria | 2151 |
| 1093 | Ga0501079_0215736 | 3300049741 | Bacteria | 1499 |
| 1094 | Ga0501080_0066274 | 3300049742 | Bacteria | 3358 |
| 1095 | Ga0501080_0102524 | 3300049742 | Bacteria | 2654 |
| 1096 | Ga0501081_0396110 | 3300049743 | Bacteria | 1022 |
| 1097 | Ga0501083_0001858 | 3300049744 | Bacteria | 14484 |
| 1098 | Ga0501083_0006674 | 3300049744 | Bacteria | 8187 |
| 1099 | Ga0501083_0215208 | 3300049744 | Bacteria | 1252 |
| 1100 | Ga0501035_0120812 | 3300049822 | Bacteria | 2290 |
| 1101 | Ga0501044_0033918 | 3300049823 | Bacteria | 5358 |
| 1102 | Ga0501045_0010280 | 3300049824 | Bacteria | 6555 |
| 1103 | Ga0501045_0188994 | 3300049824 | Bacteria | 1535 |
| 1104 | nmdc:mga05p37_234728_c1 | 3300050507 | Bacteria | 2208 |
| 1105 | nmdc:mga05p37_403642_c1 | 3300050507 | Bacteria | 1595 |
| 1106 | nmdc:mga05p37_55969_c1 | 3300050507 | Bacteria | 4855 |
| 1107 | nmdc:mga05p37_7249_c1 | 3300050507 | Bacteria | 3068 |
| 1108 | nmdc:mga05p37_7276_c1 | 3300050507 | Bacteria | 13060 |
| 1109 | nmdc:mga05p37_98700_c1 | 3300050507 | Bacteria | 3597 |
| 1110 | nmdc:mga06r32_13473_c1 | 3300050510 | Bacteria | 7408 |
| 1111 | nmdc:mga06r32_135894_c1 | 3300050510 | Bacteria | 2433 |
| 1112 | nmdc:mga06r32_141739_c1 | 3300050510 | Bacteria | 2380 |
| 1113 | nmdc:mga06r32_304824_c1 | 3300050510 | Bacteria | 1578 |
| 1114 | nmdc:mga08y16_10941_c1 | 3300050511 | Bacteria | 9530 |
| 1115 | nmdc:mga08y16_12992_c1 | 3300050511 | Bacteria | 8762 |
| 1116 | nmdc:mga08y16_12_c1 | 3300050511 | Bacteria | 438455 |
| 1117 | nmdc:mga08y16_217501_c1 | 3300050511 | Bacteria | 1978 |
| 1118 | nmdc:mga08y16_240155_c1 | 3300050511 | Bacteria | 1873 |
| 1119 | nmdc:mga08y16_300757_c1 | 3300050511 | Bacteria | 1654 |
| 1120 | nmdc:mga0n895_12161_c1 | 3300050512 | Bacteria | 7705 |
| 1121 | nmdc:mga0n895_22018_c1 | 3300050512 | Bacteria | 5971 |
| 1122 | nmdc:mga0n895_37706_c1 | 3300050512 | Bacteria | 4678 |
| 1123 | nmdc:mga0rr50_189626_c1 | 3300050513 | Bacteria | 1684 |
| 1124 | nmdc:mga0rr50_2479_c1 | 3300050513 | Bacteria | 10422 |
| 1125 | nmdc:mga0rr50_52962_c1 | 3300050513 | Unclassified | 3017 |
| 1126 | nmdc:mga0rr50_7501_c1 | 3300050513 | Bacteria | 6732 |
| 1127 | nmdc:mga08x19_1403_c1 | 3300050514 | Bacteria | 14894 |
| 1128 | nmdc:mga08x19_18118_c1 | 3300050514 | Bacteria | 4314 |
| 1129 | nmdc:mga08x19_24788_c1 | 3300050514 | Bacteria | 3732 |
| 1130 | nmdc:mga08x19_7007_c1 | 3300050514 | Bacteria | 6693 |
| 1131 | nmdc:mga08x19_74010_c1 | 3300050514 | Bacteria | 2225 |
| 1132 | nmdc:mga0a205_312391_c1 | 3300050515 | Bacteria | 1444 |
| 1133 | nmdc:mga0a205_358808_c1 | 3300050515 | Bacteria | 1324 |
| 1134 | nmdc:mga0a205_46822_c1 | 3300050515 | Bacteria | 4171 |
| 1135 | nmdc:mga0a205_57878_c1 | 3300050515 | Bacteria | 3743 |
| 1136 | nmdc:mga0a205_61308_c1 | 3300050515 | Bacteria | 3633 |
| 1137 | Ga0495601_0001213 | 3300053077 | Bacteria | 14137 |
| 1138 | Ga0495601_0004055 | 3300053077 | Bacteria | 8445 |
| 1139 | Ga0495612_0025640 | 3300053078 | Bacteria | 2368 |
| 1140 | Ga0495612_0113032 | 3300053078 | Bacteria | 1164 |
| 1141 | Ga0495595_0098264 | 3300053084 | Bacteria | 1411 |
| 1142 | Ga0495619_0022944 | 3300053085 | Bacteria | 3995 |
| 1143 | Ga0500555_003375 | 3300053103 | Bacteria | 4553 |
| 1144 | Ga0500556_0006751 | 3300053104 | Bacteria | 3263 |
| 1145 | Ga0500616_0000358 | 3300053153 | Bacteria | 64893 |
| 1146 | Ga0501084_0008312 | 3300054114 | Bacteria | 8565 |
| 1147 | Ga0501084_0055804 | 3300054114 | Unclassified | 3305 |
| 1148 | Ga0590071_002424 | 3300059421 | Bacteria | 4687 |
| 1149 | Ga0590075_005018 | 3300059424 | Bacteria | 3129 |
| 1150 | Ga0587073_0005958 | 3300059492 | Unclassified | 1849 |
| 1151 | Ga0587091_009615 | 3300059511 | Unclassified | 1461 |
| 1152 | Ga0501082_0016755 | 3300060353 | Bacteria | 6310 |
| 1153 | Ga0501082_0019066 | 3300060353 | Bacteria | 5911 |
| 1154 | Ga0501082_0124815 | 3300060353 | Bacteria | 2232 |
| 1155 | Ga0501082_0149188 | 3300060353 | Bacteria | 2030 |
| 1156 | Ga0501082_0190359 | 3300060353 | Bacteria | 1785 |
| 1157 | Ga0501082_0216432 | 3300060353 | Bacteria | 1667 |
| 1158 | Ga0501082_0369400 | 3300060353 | Bacteria | 1251 |
| 1159 | Ga0501082_0436636 | 3300060353 | Bacteria | 1143 |
| 1160 | Ga0530510_0286292 | 3300061734 | Bacteria | 1232 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046689 | Ga0495613_0202417 | Ga0495613_0202417_547_1368 | 273 |
| 2 | 3300048906 | Ga0496103_0137086 | Ga0496103_0137086_621_1469 | 280 |
| 3 | 3300025906 | Ga0207699_10252550 | Ga0207699_102525502 | 282 |
| 4 | 3300006237 | Ga0097621_100010855 | Ga0097621_1000108555 | 285 |
| 5 | 3300006358 | Ga0068871_100003756 | Ga0068871_1000037564 | 285 |
| 6 | 3300053153 | Ga0500616_0000358 | Ga0500616_0000358_6555_7523 | 286 |
| 7 | 3300005458 | Ga0070681_10368853 | Ga0070681_103688532 | 291 |
| 8 | 3300031548 | Ga0307408_100194934 | Ga0307408_1001949342 | 291 |
| 9 | 3300032002 | Ga0307416_100003885 | Ga0307416_1000038852 | 291 |
| 10 | 3300036401 | Ga0373937_0647934 | Ga0373937_0647934_14_889 | 291 |
| 11 | 3300046472 | Ga0495580_0025920 | Ga0495580_0025920_3054_4043 | 291 |
| 12 | 3300009094 | Ga0111539_10060226 | Ga0111539_100602265 | 293 |
| 13 | 3300027907 | Ga0207428_10041335 | Ga0207428_100413353 | 293 |
| 14 | 3300049571 | Ga0501034_0072287 | Ga0501034_0072287_808_1770 | 294 |
| 15 | 3300044712 | Ga0453684_0019897 | Ga0453684_0019897_9001_9954 | 298 |
| 16 | 3300048916 | Ga0496113_0001316 | Ga0496113_0001316_16_918 | 300 |
| 17 | 3300005535 | Ga0070684_100042699 | Ga0070684_1000426992 | 302 |
| 18 | 3300006237 | Ga0097621_100039276 | Ga0097621_1000392762 | 302 |
| 19 | 3300025944 | Ga0207661_10021989 | Ga0207661_100219895 | 302 |
| 20 | 3300030760 | Ga0265762_1000116 | Ga0265762_10001169 | 302 |
| 21 | 3300049579 | Ga0501043_0015240 | Ga0501043_0015240_2915_3871 | 302 |
| 22 | 3300049581 | Ga0501047_0017959 | Ga0501047_0017959_4468_5424 | 302 |
| 23 | 3300049744 | Ga0501083_0006674 | Ga0501083_0006674_2158_3114 | 302 |
| 24 | 3300054114 | Ga0501084_0008312 | Ga0501084_0008312_5850_6806 | 302 |
| 25 | 3300060353 | Ga0501082_0216432 | Ga0501082_0216432_32_988 | 302 |
| 26 | 3300009177 | Ga0105248_10270875 | Ga0105248_102708752 | 303 |
| 27 | 3300025928 | Ga0207700_10024988 | Ga0207700_100249883 | 303 |
| 28 | 3300009093 | Ga0105240_10000161 | Ga0105240_1000016175 | 304 |
| 29 | 3300009094 | Ga0111539_10214441 | Ga0111539_102144412 | 304 |
| 30 | 3300025913 | Ga0207695_10000693 | Ga0207695_1000069346 | 304 |
| 31 | 3300031548 | Ga0307408_100110828 | Ga0307408_1001108281 | 304 |
| 32 | 3300035116 | Ga0373945_0060547 | Ga0373945_0060547_145_1122 | 304 |
| 33 | 3300035170 | Ga0373943_0040390 | Ga0373943_0040390_1084_2061 | 304 |
| 34 | 3300035410 | Ga0373924_0003372 | Ga0373924_0003372_1240_2217 | 304 |
| 35 | 3300035692 | Ga0373935_0006632 | Ga0373935_0006632_5828_6805 | 304 |
| 36 | 3300037068 | Ga0373925_0048158 | Ga0373925_0048158_1776_2753 | 304 |
| 37 | 3300046684 | Ga0495669_0000991 | Ga0495669_0000991_2725_3714 | 304 |
| 38 | 3300049582 | Ga0501048_0335269 | Ga0501048_0335269_13_927 | 304 |
| 39 | 3300003322 | rootL2_10275660 | rootL2_102756602 | 305 |
| 40 | 3300006358 | Ga0068871_100080692 | Ga0068871_1000806922 | 305 |
| 41 | 3300005436 | Ga0070713_100192653 | Ga0070713_1001926532 | 306 |
| 42 | 3300009094 | Ga0111539_10026226 | Ga0111539_100262262 | 306 |
| 43 | 3300009094 | Ga0111539_10036740 | Ga0111539_100367404 | 306 |
| 44 | 3300025928 | Ga0207700_10069925 | Ga0207700_100699252 | 306 |
| 45 | 3300050511 | nmdc:mga08y16_12992_c1 | nmdc:mga08y16_12992_c1_7436_8410 | 306 |
| 46 | 3300050511 | nmdc:mga08y16_217501_c1 | nmdc:mga08y16_217501_c1_623_1576 | 306 |
| 47 | 3300031731 | Ga0307405_10077866 | Ga0307405_100778661 | 307 |
| 48 | 3300032002 | Ga0307416_100081440 | Ga0307416_1000814401 | 307 |
| 49 | 3300049586 | Ga0501070_0141430 | Ga0501070_0141430_47_970 | 307 |
| 50 | 3300059421 | Ga0590071_002424 | Ga0590071_002424_2415_3374 | 307 |
| 51 | 3300059424 | Ga0590075_005018 | Ga0590075_005018_88_1047 | 307 |
| 52 | 3300009093 | Ga0105240_10239535 | Ga0105240_102395351 | 308 |
| 53 | 3300049591 | Ga0501075_0031140 | Ga0501075_0031140_844_1806 | 308 |
| 54 | 3300053104 | Ga0500556_0006751 | Ga0500556_0006751_1580_2560 | 308 |
| 55 | 3300005536 | Ga0070697_100032232 | Ga0070697_1000322325 | 309 |
| 56 | 3300031235 | Ga0265330_10005484 | Ga0265330_100054847 | 309 |
| 57 | 3300046517 | Ga0495630_0026718 | Ga0495630_0026718_304_1329 | 309 |
| 58 | 3300049742 | Ga0501080_0102524 | Ga0501080_0102524_1495_2451 | 309 |
| 59 | 3300049744 | Ga0501083_0001858 | Ga0501083_0001858_4616_5572 | 309 |
| 60 | 3300050515 | nmdc:mga0a205_46822_c1 | nmdc:mga0a205_46822_c1_2497_3456 | 309 |
| 61 | 3300060353 | Ga0501082_0436636 | Ga0501082_0436636_117_1073 | 309 |
| 62 | 3300033547 | Ga0316212_1003932 | Ga0316212_10039324 | 310 |
| 63 | 3300044694 | Ga0466963_0049475 | Ga0466963_0049475_345_1319 | 310 |
| 64 | 3300047320 | Ga0495672_0055485 | Ga0495672_0055485_658_1629 | 310 |
| 65 | 3300049574 | Ga0501038_0057746 | Ga0501038_0057746_431_1387 | 310 |
| 66 | 3300005617 | Ga0068859_100162576 | Ga0068859_1001625762 | 311 |
| 67 | 3300006931 | Ga0097620_100162582 | Ga0097620_1001625822 | 311 |
| 68 | 3300009553 | Ga0105249_10406595 | Ga0105249_104065952 | 311 |
| 69 | 3300025961 | Ga0207712_10198434 | Ga0207712_101984341 | 311 |
| 70 | 3300035695 | Ga0373927_0072792 | Ga0373927_0072792_198_1193 | 311 |
| 71 | 3300037068 | Ga0373925_0021655 | Ga0373925_0021655_871_1866 | 311 |
| 72 | 3300046459 | Ga0495629_0021849 | Ga0495629_0021849_1938_2933 | 311 |
| 73 | 3300046472 | Ga0495580_0004272 | Ga0495580_0004272_2919_3914 | 311 |
| 74 | 3300046683 | Ga0495658_0013179 | Ga0495658_0013179_331_1329 | 311 |
| 75 | 3300005435 | Ga0070714_100000183 | Ga0070714_10000018322 | 312 |
| 76 | 3300005435 | Ga0070714_100210082 | Ga0070714_1002100822 | 312 |
| 77 | 3300005435 | Ga0070714_100238223 | Ga0070714_1002382232 | 312 |
| 78 | 3300005439 | Ga0070711_100016954 | Ga0070711_1000169542 | 312 |
| 79 | 3300005455 | Ga0070663_100407052 | Ga0070663_1004070521 | 312 |
| 80 | 3300006358 | Ga0068871_100009308 | Ga0068871_1000093085 | 312 |
| 81 | 3300006914 | Ga0075436_100001547 | Ga0075436_10000154710 | 312 |
| 82 | 3300009093 | Ga0105240_10322798 | Ga0105240_103227982 | 312 |
| 83 | 3300013307 | Ga0157372_10187711 | Ga0157372_101877113 | 312 |
| 84 | 3300025916 | Ga0207663_10014875 | Ga0207663_100148753 | 312 |
| 85 | 3300025929 | Ga0207664_10000212 | Ga0207664_1000021214 | 312 |
| 86 | 3300025929 | Ga0207664_10360700 | Ga0207664_103607001 | 312 |
| 87 | 3300035083 | Ga0373926_0017457 | Ga0373926_0017457_882_1871 | 312 |
| 88 | 3300035111 | Ga0373923_0001393 | Ga0373923_0001393_4202_5191 | 312 |
| 89 | 3300035113 | Ga0373936_0000319 | Ga0373936_0000319_1169_2158 | 312 |
| 90 | 3300035170 | Ga0373943_0000016 | Ga0373943_0000016_52314_53303 | 312 |
| 91 | 3300035171 | Ga0373946_0019422 | Ga0373946_0019422_340_1329 | 312 |
| 92 | 3300035410 | Ga0373924_0031217 | Ga0373924_0031217_988_1977 | 312 |
| 93 | 3300035692 | Ga0373935_0000864 | Ga0373935_0000864_9217_10206 | 312 |
| 94 | 3300035695 | Ga0373927_0000034 | Ga0373927_0000034_41985_42974 | 312 |
| 95 | 3300035724 | Ga0373933_0015818 | Ga0373933_0015818_1539_2528 | 312 |
| 96 | 3300035725 | Ga0373947_0000035 | Ga0373947_0000035_42023_43012 | 312 |
| 97 | 3300037068 | Ga0373925_0000714 | Ga0373925_0000714_9381_10370 | 312 |
| 98 | 3300046472 | Ga0495580_0022694 | Ga0495580_0022694_3200_4189 | 312 |
| 99 | 3300046517 | Ga0495630_0011837 | Ga0495630_0011837_513_1502 | 312 |
| 100 | 3300046689 | Ga0495613_0177997 | Ga0495613_0177997_55_1050 | 312 |
| 101 | 3300048088 | Ga0495602_0103606 | Ga0495602_0103606_926_1915 | 312 |
| 102 | 3300050514 | nmdc:mga08x19_7007_c1 | nmdc:mga08x19_7007_c1_4584_5579 | 312 |
| 103 | 3300005842 | Ga0068858_100005150 | Ga0068858_1000051503 | 313 |
| 104 | 3300006173 | Ga0070716_100008843 | Ga0070716_1000088435 | 313 |
| 105 | 3300006175 | Ga0070712_100006918 | Ga0070712_1000069183 | 313 |
| 106 | 3300009093 | Ga0105240_10034509 | Ga0105240_100345093 | 313 |
| 107 | 3300013297 | Ga0157378_10124723 | Ga0157378_101247232 | 313 |
| 108 | 3300014968 | Ga0157379_10012865 | Ga0157379_100128657 | 313 |
| 109 | 3300025913 | Ga0207695_10115452 | Ga0207695_101154522 | 313 |
| 110 | 3300025915 | Ga0207693_10016140 | Ga0207693_100161407 | 313 |
| 111 | 3300028800 | Ga0265338_10004251 | Ga0265338_100042515 | 313 |
| 112 | 3300035725 | Ga0373947_0039779 | Ga0373947_0039779_251_1192 | 313 |
| 113 | 3300042015 | Ga0439462_0031366 | Ga0439462_0031366_166_1107 | 313 |
| 114 | 3300048903 | Ga0496100_0038130 | Ga0496100_0038130_176_1150 | 313 |
| 115 | 3300048917 | Ga0496114_0021153 | Ga0496114_0021153_3924_4898 | 313 |
| 116 | 3300049584 | Ga0501068_0019437 | Ga0501068_0019437_980_1936 | 313 |
| 117 | 3300009094 | Ga0111539_10147796 | Ga0111539_101477963 | 314 |
| 118 | 3300046689 | Ga0495613_0178872 | Ga0495613_0178872_320_1294 | 314 |
| 119 | 3300048904 | Ga0496101_0243345 | Ga0496101_0243345_321_1295 | 314 |
| 120 | 3300050511 | nmdc:mga08y16_300757_c1 | nmdc:mga08y16_300757_c1_74_1033 | 314 |
| 121 | 3300006028 | Ga0070717_10047746 | Ga0070717_100477461 | 315 |
| 122 | 3300046675 | Ga0495657_0220848 | Ga0495657_0220848_35_1030 | 315 |
| 123 | 3300005331 | Ga0070670_100028745 | Ga0070670_1000287453 | 316 |
| 124 | 3300005467 | Ga0070706_100027595 | Ga0070706_1000275952 | 316 |
| 125 | 3300014325 | Ga0163163_10124386 | Ga0163163_101243862 | 316 |
| 126 | 3300025910 | Ga0207684_10103525 | Ga0207684_101035253 | 316 |
| 127 | 3300041512 | Ga0451853_2499464 | Ga0451853_2499464_131_1087 | 316 |
| 128 | 3300048915 | Ga0496112_0129203 | Ga0496112_0129203_668_1618 | 316 |
| 129 | 3300005340 | Ga0070689_100378163 | Ga0070689_1003781631 | 317 |
| 130 | 3300005445 | Ga0070708_100039959 | Ga0070708_1000399595 | 317 |
| 131 | 3300005471 | Ga0070698_100000903 | Ga0070698_1000009032 | 317 |
| 132 | 3300005536 | Ga0070697_100001021 | Ga0070697_10000102116 | 317 |
| 133 | 3300006028 | Ga0070717_10224788 | Ga0070717_102247882 | 317 |
| 134 | 3300013306 | Ga0163162_10092330 | Ga0163162_100923302 | 317 |
| 135 | 3300014325 | Ga0163163_10387049 | Ga0163163_103870491 | 317 |
| 136 | 3300025910 | Ga0207684_10000768 | Ga0207684_1000076830 | 317 |
| 137 | 3300025922 | Ga0207646_10102475 | Ga0207646_101024752 | 317 |
| 138 | 3300025923 | Ga0207681_10228297 | Ga0207681_102282971 | 317 |
| 139 | 3300025936 | Ga0207670_10053185 | Ga0207670_100531852 | 317 |
| 140 | 3300026088 | Ga0207641_10068485 | Ga0207641_100684852 | 317 |
| 141 | 3300032002 | Ga0307416_100040415 | Ga0307416_1000404152 | 317 |
| 142 | 3300037418 | Ga0395900_0460942 | Ga0395900_0460942_254_1216 | 317 |
| 143 | 3300046809 | Ga0495600_0133668 | Ga0495600_0133668_286_1239 | 317 |
| 144 | 3300011119 | Ga0105246_10070999 | Ga0105246_100709993 | 318 |
| 145 | 3300025926 | Ga0207659_10145002 | Ga0207659_101450022 | 318 |
| 146 | 3300049568 | Ga0501031_0038147 | Ga0501031_0038147_1779_2735 | 318 |
| 147 | 3300049569 | Ga0501032_0018387 | Ga0501032_0018387_2900_3856 | 318 |
| 148 | 3300049571 | Ga0501034_0013627 | Ga0501034_0013627_639_1595 | 318 |
| 149 | 3300049571 | Ga0501034_0040164 | Ga0501034_0040164_1172_2128 | 318 |
| 150 | 3300049571 | Ga0501034_0305587 | Ga0501034_0305587_227_1183 | 318 |
| 151 | 3300049572 | Ga0501036_0030799 | Ga0501036_0030799_1508_2464 | 318 |
| 152 | 3300049572 | Ga0501036_0062073 | Ga0501036_0062073_1743_2699 | 318 |
| 153 | 3300049573 | Ga0501037_0108903 | Ga0501037_0108903_758_1714 | 318 |
| 154 | 3300049574 | Ga0501038_0034756 | Ga0501038_0034756_3154_4110 | 318 |
| 155 | 3300049574 | Ga0501038_0057722 | Ga0501038_0057722_1292_2248 | 318 |
| 156 | 3300049575 | Ga0501039_0003109 | Ga0501039_0003109_1956_2912 | 318 |
| 157 | 3300049579 | Ga0501043_0243822 | Ga0501043_0243822_405_1361 | 318 |
| 158 | 3300049580 | Ga0501046_0028314 | Ga0501046_0028314_1095_2051 | 318 |
| 159 | 3300049580 | Ga0501046_0029522 | Ga0501046_0029522_2176_3132 | 318 |
| 160 | 3300049581 | Ga0501047_0061399 | Ga0501047_0061399_733_1689 | 318 |
| 161 | 3300049581 | Ga0501047_0287344 | Ga0501047_0287344_367_1323 | 318 |
| 162 | 3300049581 | Ga0501047_0400480 | Ga0501047_0400480_132_1088 | 318 |
| 163 | 3300049582 | Ga0501048_0135043 | Ga0501048_0135043_639_1595 | 318 |
| 164 | 3300049584 | Ga0501068_0056767 | Ga0501068_0056767_1371_2327 | 318 |
| 165 | 3300049588 | Ga0501072_0076605 | Ga0501072_0076605_376_1332 | 318 |
| 166 | 3300049589 | Ga0501073_0097468 | Ga0501073_0097468_421_1377 | 318 |
| 167 | 3300049590 | Ga0501074_0140727 | Ga0501074_0140727_201_1157 | 318 |
| 168 | 3300049742 | Ga0501080_0066274 | Ga0501080_0066274_2309_3265 | 318 |
| 169 | 3300049743 | Ga0501081_0396110 | Ga0501081_0396110_42_998 | 318 |
| 170 | 3300049822 | Ga0501035_0120812 | Ga0501035_0120812_918_1874 | 318 |
| 171 | 3300049823 | Ga0501044_0033918 | Ga0501044_0033918_1561_2517 | 318 |
| 172 | 3300005295 | Ga0065707_10004371 | Ga0065707_100043712 | 319 |
| 173 | 3300005353 | Ga0070669_100026243 | Ga0070669_1000262432 | 319 |
| 174 | 3300005354 | Ga0070675_100306670 | Ga0070675_1003066702 | 319 |
| 175 | 3300005354 | Ga0070675_100334793 | Ga0070675_1003347932 | 319 |
| 176 | 3300005458 | Ga0070681_10149409 | Ga0070681_101494092 | 319 |
| 177 | 3300005577 | Ga0068857_100239962 | Ga0068857_1002399622 | 319 |
| 178 | 3300006844 | Ga0075428_100000607 | Ga0075428_1000006077 | 319 |
| 179 | 3300006844 | Ga0075428_100224083 | Ga0075428_1002240832 | 319 |
| 180 | 3300006847 | Ga0075431_100303010 | Ga0075431_1003030102 | 319 |
| 181 | 3300006852 | Ga0075433_10149908 | Ga0075433_101499083 | 319 |
| 182 | 3300006871 | Ga0075434_100001079 | Ga0075434_1000010797 | 319 |
| 183 | 3300006914 | Ga0075436_100142659 | Ga0075436_1001426592 | 319 |
| 184 | 3300009094 | Ga0111539_10000455 | Ga0111539_1000045514 | 319 |
| 185 | 3300009147 | Ga0114129_10004180 | Ga0114129_100041808 | 319 |
| 186 | 3300009147 | Ga0114129_10235763 | Ga0114129_102357632 | 319 |
| 187 | 3300009553 | Ga0105249_10100646 | Ga0105249_101006462 | 319 |
| 188 | 3300014326 | Ga0157380_10006237 | Ga0157380_100062372 | 319 |
| 189 | 3300025926 | Ga0207659_10157992 | Ga0207659_101579922 | 319 |
| 190 | 3300026118 | Ga0207675_100027963 | Ga0207675_1000279632 | 319 |
| 191 | 3300027907 | Ga0207428_10000435 | Ga0207428_1000043513 | 319 |
| 192 | 3300031903 | Ga0307407_10156535 | Ga0307407_101565352 | 319 |
| 193 | 3300032002 | Ga0307416_100117482 | Ga0307416_1001174822 | 319 |
| 194 | 3300035113 | Ga0373936_0090408 | Ga0373936_0090408_66_1025 | 319 |
| 195 | 3300049572 | Ga0501036_0194759 | Ga0501036_0194759_218_1177 | 319 |
| 196 | 3300049578 | Ga0501042_0014107 | Ga0501042_0014107_465_1424 | 319 |
| 197 | 3300049587 | Ga0501071_0016257 | Ga0501071_0016257_2914_3873 | 319 |
| 198 | 3300049587 | Ga0501071_0138459 | Ga0501071_0138459_649_1608 | 319 |
| 199 | 3300049588 | Ga0501072_0070436 | Ga0501072_0070436_608_1567 | 319 |
| 200 | 3300049591 | Ga0501075_0044998 | Ga0501075_0044998_1118_2077 | 319 |
| 201 | 3300049591 | Ga0501075_0048456 | Ga0501075_0048456_547_1506 | 319 |
| 202 | 3300049741 | Ga0501079_0108957 | Ga0501079_0108957_788_1747 | 319 |
| 203 | 3300049824 | Ga0501045_0188994 | Ga0501045_0188994_530_1489 | 319 |
| 204 | 3300050507 | nmdc:mga05p37_55969_c1 | nmdc:mga05p37_55969_c1_3095_4054 | 319 |
| 205 | 3300050507 | nmdc:mga05p37_7276_c1 | nmdc:mga05p37_7276_c1_10023_10982 | 319 |
| 206 | 3300050510 | nmdc:mga06r32_304824_c1 | nmdc:mga06r32_304824_c1_105_1070 | 319 |
| 207 | 3300050511 | nmdc:mga08y16_12_c1 | nmdc:mga08y16_12_c1_393339_394304 | 319 |
| 208 | 3300050512 | nmdc:mga0n895_12161_c1 | nmdc:mga0n895_12161_c1_3627_4586 | 319 |
| 209 | 3300050514 | nmdc:mga08x19_74010_c1 | nmdc:mga08x19_74010_c1_412_1398 | 319 |
| 210 | 3300050515 | nmdc:mga0a205_61308_c1 | nmdc:mga0a205_61308_c1_303_1262 | 319 |
| 211 | 3300060353 | Ga0501082_0019066 | Ga0501082_0019066_4676_5641 | 319 |
| 212 | 3300060353 | Ga0501082_0369400 | Ga0501082_0369400_66_1025 | 319 |
| 213 | 3300005354 | Ga0070675_100000540 | Ga0070675_1000005408 | 320 |
| 214 | 3300005719 | Ga0068861_100360143 | Ga0068861_1003601431 | 320 |
| 215 | 3300006844 | Ga0075428_100131714 | Ga0075428_1001317142 | 320 |
| 216 | 3300028381 | Ga0268264_10096896 | Ga0268264_100968961 | 320 |
| 217 | 3300031548 | Ga0307408_100152467 | Ga0307408_1001524672 | 320 |
| 218 | 3300049568 | Ga0501031_0065791 | Ga0501031_0065791_1061_2023 | 320 |
| 219 | 3300049572 | Ga0501036_0395569 | Ga0501036_0395569_14_976 | 320 |
| 220 | 3300049575 | Ga0501039_0089362 | Ga0501039_0089362_646_1608 | 320 |
| 221 | 3300049577 | Ga0501041_0072689 | Ga0501041_0072689_444_1406 | 320 |
| 222 | 3300049582 | Ga0501048_0090923 | Ga0501048_0090923_815_1777 | 320 |
| 223 | 3300049588 | Ga0501072_0068282 | Ga0501072_0068282_1081_2043 | 320 |
| 224 | 3300049588 | Ga0501072_0187445 | Ga0501072_0187445_657_1619 | 320 |
| 225 | 3300049741 | Ga0501079_0022743 | Ga0501079_0022743_472_1434 | 320 |
| 226 | 3300049741 | Ga0501079_0215736 | Ga0501079_0215736_282_1247 | 320 |
| 227 | 3300049824 | Ga0501045_0010280 | Ga0501045_0010280_4348_5310 | 320 |
| 228 | 3300060353 | Ga0501082_0124815 | Ga0501082_0124815_36_998 | 320 |
| 229 | 3300060353 | Ga0501082_0190359 | Ga0501082_0190359_214_1176 | 320 |
| 230 | 3300005436 | Ga0070713_100005356 | Ga0070713_1000053565 | 321 |
| 231 | 3300005617 | Ga0068859_100244109 | Ga0068859_1002441092 | 321 |
| 232 | 3300006847 | Ga0075431_100120429 | Ga0075431_1001204292 | 321 |
| 233 | 3300006847 | Ga0075431_100210048 | Ga0075431_1002100482 | 321 |
| 234 | 3300006931 | Ga0097620_100244113 | Ga0097620_1002441132 | 321 |
| 235 | 3300009101 | Ga0105247_10089205 | Ga0105247_100892052 | 321 |
| 236 | 3300013104 | Ga0157370_10469306 | Ga0157370_104693061 | 321 |
| 237 | 3300025900 | Ga0207710_10075068 | Ga0207710_100750681 | 321 |
| 238 | 3300025906 | Ga0207699_10067586 | Ga0207699_100675862 | 321 |
| 239 | 3300025910 | Ga0207684_10016448 | Ga0207684_100164481 | 321 |
| 240 | 3300031903 | Ga0307407_10181292 | Ga0307407_101812922 | 321 |
| 241 | 3300031911 | Ga0307412_10046266 | Ga0307412_100462662 | 321 |
| 242 | 3300035111 | Ga0373923_0038824 | Ga0373923_0038824_681_1646 | 321 |
| 243 | 3300046459 | Ga0495629_0077853 | Ga0495629_0077853_913_1878 | 321 |
| 244 | 3300046517 | Ga0495630_0001984 | Ga0495630_0001984_3760_4725 | 321 |
| 245 | 3300046559 | Ga0495667_0043718 | Ga0495667_0043718_978_1943 | 321 |
| 246 | 3300046689 | Ga0495613_0000670 | Ga0495613_0000670_16858_17823 | 321 |
| 247 | 3300046809 | Ga0495600_0016234 | Ga0495600_0016234_1907_2872 | 321 |
| 248 | 3300047315 | Ga0495581_0029073 | Ga0495581_0029073_1356_2321 | 321 |
| 249 | 3300047317 | Ga0495604_0042957 | Ga0495604_0042957_631_1596 | 321 |
| 250 | 3300047319 | Ga0495674_0016645 | Ga0495674_0016645_5098_6063 | 321 |
| 251 | 3300047471 | Ga0495684_0009482 | Ga0495684_0009482_2398_3363 | 321 |
| 252 | 3300050510 | nmdc:mga06r32_135894_c1 | nmdc:mga06r32_135894_c1_966_1931 | 321 |
| 253 | 3300050510 | nmdc:mga06r32_141739_c1 | nmdc:mga06r32_141739_c1_663_1628 | 321 |
| 254 | 3300050515 | nmdc:mga0a205_312391_c1 | nmdc:mga0a205_312391_c1_458_1423 | 321 |
| 255 | 3300053077 | Ga0495601_0001213 | Ga0495601_0001213_4078_5043 | 321 |
| 256 | 3300053084 | Ga0495595_0098264 | Ga0495595_0098264_82_1047 | 321 |
| 257 | 3300053085 | Ga0495619_0022944 | Ga0495619_0022944_2384_3349 | 321 |
| 258 | 3300005843 | Ga0068860_100170019 | Ga0068860_1001700192 | 322 |
| 259 | 3300009551 | Ga0105238_10155748 | Ga0105238_101557483 | 322 |
| 260 | 3300025927 | Ga0207687_10103813 | Ga0207687_101038132 | 322 |
| 261 | 3300025934 | Ga0207686_10085966 | Ga0207686_100859662 | 322 |
| 262 | 3300031548 | Ga0307408_100287197 | Ga0307408_1002871972 | 322 |
| 263 | 3300032005 | Ga0307411_10125471 | Ga0307411_101254712 | 322 |
| 264 | 3300032126 | Ga0307415_100503072 | Ga0307415_1005030721 | 322 |
| 265 | 3300046454 | Ga0495592_0139215 | Ga0495592_0139215_687_1667 | 322 |
| 266 | 3300005331 | Ga0070670_100185509 | Ga0070670_1001855092 | 323 |
| 267 | 3300005340 | Ga0070689_100211075 | Ga0070689_1002110752 | 323 |
| 268 | 3300005340 | Ga0070689_100316094 | Ga0070689_1003160941 | 323 |
| 269 | 3300005347 | Ga0070668_100379771 | Ga0070668_1003797712 | 323 |
| 270 | 3300005471 | Ga0070698_100037349 | Ga0070698_1000373493 | 323 |
| 271 | 3300006844 | Ga0075428_100069652 | Ga0075428_1000696522 | 323 |
| 272 | 3300006852 | Ga0075433_10171943 | Ga0075433_101719432 | 323 |
| 273 | 3300006914 | Ga0075436_100006024 | Ga0075436_1000060243 | 323 |
| 274 | 3300006914 | Ga0075436_100007392 | Ga0075436_1000073922 | 323 |
| 275 | 3300009101 | Ga0105247_10024056 | Ga0105247_100240563 | 323 |
| 276 | 3300009176 | Ga0105242_10115686 | Ga0105242_101156862 | 323 |
| 277 | 3300009176 | Ga0105242_10188353 | Ga0105242_101883532 | 323 |
| 278 | 3300013105 | Ga0157369_10284298 | Ga0157369_102842982 | 323 |
| 279 | 3300013308 | Ga0157375_10043801 | Ga0157375_100438016 | 323 |
| 280 | 3300014325 | Ga0163163_10157889 | Ga0163163_101578894 | 323 |
| 281 | 3300014325 | Ga0163163_10475204 | Ga0163163_104752041 | 323 |
| 282 | 3300025912 | Ga0207707_10177050 | Ga0207707_101770501 | 323 |
| 283 | 3300025922 | Ga0207646_10320823 | Ga0207646_103208231 | 323 |
| 284 | 3300025936 | Ga0207670_10326769 | Ga0207670_103267692 | 323 |
| 285 | 3300026075 | Ga0207708_10353370 | Ga0207708_103533701 | 323 |
| 286 | 3300046477 | Ga0495664_0049533 | Ga0495664_0049533_519_1496 | 323 |
| 287 | 3300046536 | Ga0495587_0077896 | Ga0495587_0077896_622_1599 | 323 |
| 288 | 3300046663 | Ga0495635_0179857 | Ga0495635_0179857_117_1094 | 323 |
| 289 | 3300047317 | Ga0495604_0032592 | Ga0495604_0032592_18_995 | 323 |
| 290 | 3300047444 | Ga0495675_0013233 | Ga0495675_0013233_3984_4961 | 323 |
| 291 | 3300048907 | Ga0496104_0091926 | Ga0496104_0091926_1832_2803 | 323 |
| 292 | 3300048915 | Ga0496112_0212238 | Ga0496112_0212238_509_1486 | 323 |
| 293 | 3300049591 | Ga0501075_0000178 | Ga0501075_0000178_670_1641 | 323 |
| 294 | 3300049744 | Ga0501083_0215208 | Ga0501083_0215208_122_1093 | 323 |
| 295 | 3300050507 | nmdc:mga05p37_403642_c1 | nmdc:mga05p37_403642_c1_221_1192 | 323 |
| 296 | 3300050511 | nmdc:mga08y16_240155_c1 | nmdc:mga08y16_240155_c1_847_1818 | 323 |
| 297 | 3300050515 | nmdc:mga0a205_358808_c1 | nmdc:mga0a205_358808_c1_217_1188 | 323 |
| 298 | 3300060353 | Ga0501082_0016755 | Ga0501082_0016755_54_1025 | 323 |
| 299 | 3300003203 | JGI25406J46586_10006285 | JGI25406J46586_100062853 | 324 |
| 300 | 3300005458 | Ga0070681_10075687 | Ga0070681_100756875 | 324 |
| 301 | 3300005614 | Ga0068856_100120678 | Ga0068856_1001206783 | 324 |
| 302 | 3300005985 | Ga0081539_10001175 | Ga0081539_100011756 | 324 |
| 303 | 3300006847 | Ga0075431_100227038 | Ga0075431_1002270382 | 324 |
| 304 | 3300009177 | Ga0105248_10112311 | Ga0105248_101123113 | 324 |
| 305 | 3300014326 | Ga0157380_10535390 | Ga0157380_105353902 | 324 |
| 306 | 3300025941 | Ga0207711_10143206 | Ga0207711_101432063 | 324 |
| 307 | 3300031712 | Ga0265342_10061692 | Ga0265342_100616922 | 324 |
| 308 | 3300044656 | Ga0466969_0056413 | Ga0466969_0056413_704_1687 | 324 |
| 309 | 3300045049 | Ga0466959_0209135 | Ga0466959_0209135_97_1080 | 324 |
| 310 | 3300048929 | Ga0496126_0006296 | Ga0496126_0006296_6703_7683 | 324 |
| 311 | 3300049576 | Ga0501040_0201743 | Ga0501040_0201743_402_1382 | 324 |
| 312 | 3300050513 | nmdc:mga0rr50_189626_c1 | nmdc:mga0rr50_189626_c1_330_1310 | 324 |
| 313 | 3300060353 | Ga0501082_0149188 | Ga0501082_0149188_836_1810 | 324 |
| 314 | 3300061734 | Ga0530510_0286292 | Ga0530510_0286292_208_1188 | 324 |
| 315 | 3300005328 | Ga0070676_10283478 | Ga0070676_102834781 | 325 |
| 316 | 3300005338 | Ga0068868_100041733 | Ga0068868_1000417332 | 325 |
| 317 | 3300005355 | Ga0070671_100444554 | Ga0070671_1004445541 | 325 |
| 318 | 3300005366 | Ga0070659_100311291 | Ga0070659_1003112912 | 325 |
| 319 | 3300005434 | Ga0070709_10000305 | Ga0070709_1000030526 | 325 |
| 320 | 3300005434 | Ga0070709_10080178 | Ga0070709_100801784 | 325 |
| 321 | 3300005435 | Ga0070714_100249898 | Ga0070714_1002498982 | 325 |
| 322 | 3300005435 | Ga0070714_100366743 | Ga0070714_1003667432 | 325 |
| 323 | 3300005436 | Ga0070713_100000922 | Ga0070713_10000092217 | 325 |
| 324 | 3300005436 | Ga0070713_100008454 | Ga0070713_1000084548 | 325 |
| 325 | 3300005436 | Ga0070713_100302161 | Ga0070713_1003021612 | 325 |
| 326 | 3300005438 | Ga0070701_10123076 | Ga0070701_101230762 | 325 |
| 327 | 3300005439 | Ga0070711_100135456 | Ga0070711_1001354562 | 325 |
| 328 | 3300005444 | Ga0070694_100001871 | Ga0070694_1000018713 | 325 |
| 329 | 3300005458 | Ga0070681_10304639 | Ga0070681_103046392 | 325 |
| 330 | 3300005468 | Ga0070707_100000144 | Ga0070707_10000014421 | 325 |
| 331 | 3300005535 | Ga0070684_100176690 | Ga0070684_1001766902 | 325 |
| 332 | 3300005548 | Ga0070665_100590653 | Ga0070665_1005906531 | 325 |
| 333 | 3300005563 | Ga0068855_100108486 | Ga0068855_1001084864 | 325 |
| 334 | 3300005563 | Ga0068855_100337298 | Ga0068855_1003372982 | 325 |
| 335 | 3300005564 | Ga0070664_100106944 | Ga0070664_1001069441 | 325 |
| 336 | 3300005578 | Ga0068854_100123985 | Ga0068854_1001239852 | 325 |
| 337 | 3300005618 | Ga0068864_100243346 | Ga0068864_1002433462 | 325 |
| 338 | 3300005841 | Ga0068863_100023970 | Ga0068863_1000239707 | 325 |
| 339 | 3300005842 | Ga0068858_100078685 | Ga0068858_1000786852 | 325 |
| 340 | 3300005843 | Ga0068860_100091141 | Ga0068860_1000911414 | 325 |
| 341 | 3300005937 | Ga0081455_10008282 | Ga0081455_100082826 | 325 |
| 342 | 3300005937 | Ga0081455_10301905 | Ga0081455_103019051 | 325 |
| 343 | 3300006028 | Ga0070717_10216772 | Ga0070717_102167722 | 325 |
| 344 | 3300006175 | Ga0070712_100006553 | Ga0070712_1000065534 | 325 |
| 345 | 3300006175 | Ga0070712_100010851 | Ga0070712_1000108515 | 325 |
| 346 | 3300006358 | Ga0068871_100005759 | Ga0068871_1000057595 | 325 |
| 347 | 3300006847 | Ga0075431_100017181 | Ga0075431_1000171816 | 325 |
| 348 | 3300006847 | Ga0075431_100130750 | Ga0075431_1001307502 | 325 |
| 349 | 3300009094 | Ga0111539_10442945 | Ga0111539_104429452 | 325 |
| 350 | 3300009098 | Ga0105245_10041692 | Ga0105245_100416922 | 325 |
| 351 | 3300009174 | Ga0105241_10025623 | Ga0105241_100256237 | 325 |
| 352 | 3300009176 | Ga0105242_10016443 | Ga0105242_100164433 | 325 |
| 353 | 3300009177 | Ga0105248_10081845 | Ga0105248_100818453 | 325 |
| 354 | 3300009551 | Ga0105238_10091729 | Ga0105238_100917293 | 325 |
| 355 | 3300009553 | Ga0105249_10090776 | Ga0105249_100907762 | 325 |
| 356 | 3300010375 | Ga0105239_10086301 | Ga0105239_100863012 | 325 |
| 357 | 3300013296 | Ga0157374_10033131 | Ga0157374_100331316 | 325 |
| 358 | 3300013296 | Ga0157374_10088066 | Ga0157374_100880662 | 325 |
| 359 | 3300013297 | Ga0157378_10000145 | Ga0157378_1000014531 | 325 |
| 360 | 3300013306 | Ga0163162_10145019 | Ga0163162_101450192 | 325 |
| 361 | 3300014325 | Ga0163163_10072291 | Ga0163163_100722915 | 325 |
| 362 | 3300014969 | Ga0157376_10202439 | Ga0157376_102024393 | 325 |
| 363 | 3300021361 | Ga0213872_10010735 | Ga0213872_100107354 | 325 |
| 364 | 3300021361 | Ga0213872_10014357 | Ga0213872_100143573 | 325 |
| 365 | 3300021441 | Ga0213871_10004023 | Ga0213871_100040233 | 325 |
| 366 | 3300025906 | Ga0207699_10009701 | Ga0207699_100097014 | 325 |
| 367 | 3300025906 | Ga0207699_10094136 | Ga0207699_100941364 | 325 |
| 368 | 3300025911 | Ga0207654_10057441 | Ga0207654_100574411 | 325 |
| 369 | 3300025915 | Ga0207693_10000067 | Ga0207693_100000675 | 325 |
| 370 | 3300025915 | Ga0207693_10020519 | Ga0207693_100205194 | 325 |
| 371 | 3300025922 | Ga0207646_10000298 | Ga0207646_1000029820 | 325 |
| 372 | 3300025927 | Ga0207687_10009003 | Ga0207687_100090033 | 325 |
| 373 | 3300025928 | Ga0207700_10018505 | Ga0207700_100185052 | 325 |
| 374 | 3300025928 | Ga0207700_10021041 | Ga0207700_100210414 | 325 |
| 375 | 3300025928 | Ga0207700_10217945 | Ga0207700_102179452 | 325 |
| 376 | 3300025929 | Ga0207664_10079541 | Ga0207664_100795414 | 325 |
| 377 | 3300025929 | Ga0207664_10314724 | Ga0207664_103147242 | 325 |
| 378 | 3300025941 | Ga0207711_10074950 | Ga0207711_100749502 | 325 |
| 379 | 3300025945 | Ga0207679_10216949 | Ga0207679_102169491 | 325 |
| 380 | 3300025949 | Ga0207667_10066067 | Ga0207667_100660674 | 325 |
| 381 | 3300025949 | Ga0207667_10326491 | Ga0207667_103264912 | 325 |
| 382 | 3300025961 | Ga0207712_10142518 | Ga0207712_101425182 | 325 |
| 383 | 3300026035 | Ga0207703_10105216 | Ga0207703_101052162 | 325 |
| 384 | 3300026088 | Ga0207641_10063347 | Ga0207641_100633471 | 325 |
| 385 | 3300026095 | Ga0207676_10032451 | Ga0207676_100324517 | 325 |
| 386 | 3300027907 | Ga0207428_10000846 | Ga0207428_1000084621 | 325 |
| 387 | 3300028381 | Ga0268264_10066451 | Ga0268264_100664513 | 325 |
| 388 | 3300031548 | Ga0307408_100012830 | Ga0307408_1000128306 | 325 |
| 389 | 3300031731 | Ga0307405_10036139 | Ga0307405_100361392 | 325 |
| 390 | 3300031852 | Ga0307410_10004067 | Ga0307410_100040673 | 325 |
| 391 | 3300031852 | Ga0307410_10135625 | Ga0307410_101356252 | 325 |
| 392 | 3300031901 | Ga0307406_10081672 | Ga0307406_100816724 | 325 |
| 393 | 3300031995 | Ga0307409_100030864 | Ga0307409_1000308643 | 325 |
| 394 | 3300032002 | Ga0307416_100061300 | Ga0307416_1000613003 | 325 |
| 395 | 3300032002 | Ga0307416_100354754 | Ga0307416_1003547542 | 325 |
| 396 | 3300032002 | Ga0307416_100463725 | Ga0307416_1004637252 | 325 |
| 397 | 3300032005 | Ga0307411_10006952 | Ga0307411_100069526 | 325 |
| 398 | 3300032005 | Ga0307411_10282574 | Ga0307411_102825741 | 325 |
| 399 | 3300032126 | Ga0307415_100010919 | Ga0307415_1000109194 | 325 |
| 400 | 3300037466 | Ga0395898_0177640 | Ga0395898_0177640_187_1173 | 325 |
| 401 | 3300037471 | Ga0395905_0003951 | Ga0395905_0003951_10031_11020 | 325 |
| 402 | 3300037471 | Ga0395905_0026624 | Ga0395905_0026624_614_1600 | 325 |
| 403 | 3300037471 | Ga0395905_0070863 | Ga0395905_0070863_568_1554 | 325 |
| 404 | 3300037471 | Ga0395905_0092192 | Ga0395905_0092192_1688_2674 | 325 |
| 405 | 3300038443 | Ga0395901_0219459 | Ga0395901_0219459_94_1080 | 325 |
| 406 | 3300039438 | Ga0436360_0174134 | Ga0436360_0174134_324_1313 | 325 |
| 407 | 3300039447 | Ga0436361_0534152 | Ga0436361_0534152_33_1022 | 325 |
| 408 | 3300039447 | Ga0436361_0620753 | Ga0436361_0620753_3775_4764 | 325 |
| 409 | 3300039447 | Ga0436361_0635090 | Ga0436361_0635090_5532_6521 | 325 |
| 410 | 3300039447 | Ga0436361_0706896 | Ga0436361_0706896_33_1022 | 325 |
| 411 | 3300039453 | Ga0436362_0906121 | Ga0436362_0906121_276_1265 | 325 |
| 412 | 3300045051 | Ga0451576_0531076 | Ga0451576_0531076_151_1137 | 325 |
| 413 | 3300046472 | Ga0495580_0098837 | Ga0495580_0098837_269_1255 | 325 |
| 414 | 3300046472 | Ga0495580_0132859 | Ga0495580_0132859_671_1657 | 325 |
| 415 | 3300046517 | Ga0495630_0120901 | Ga0495630_0120901_986_1966 | 325 |
| 416 | 3300046684 | Ga0495669_0002685 | Ga0495669_0002685_5750_6736 | 325 |
| 417 | 3300046684 | Ga0495669_0074677 | Ga0495669_0074677_437_1426 | 325 |
| 418 | 3300047318 | Ga0495636_0048202 | Ga0495636_0048202_15_1004 | 325 |
| 419 | 3300047445 | Ga0495677_0090568 | Ga0495677_0090568_57_1043 | 325 |
| 420 | 3300047471 | Ga0495684_0187855 | Ga0495684_0187855_396_1376 | 325 |
| 421 | 3300048907 | Ga0496104_0299112 | Ga0496104_0299112_297_1283 | 325 |
| 422 | 3300048912 | Ga0496109_0000080 | Ga0496109_0000080_48979_49962 | 325 |
| 423 | 3300048912 | Ga0496109_0031502 | Ga0496109_0031502_3362_4348 | 325 |
| 424 | 3300048914 | Ga0496111_0115526 | Ga0496111_0115526_45_1031 | 325 |
| 425 | 3300048918 | Ga0496115_0260447 | Ga0496115_0260447_310_1296 | 325 |
| 426 | 3300048918 | Ga0496115_0471910 | Ga0496115_0471910_11_1000 | 325 |
| 427 | 3300049577 | Ga0501041_0205129 | Ga0501041_0205129_210_1193 | 325 |
| 428 | 3300049592 | Ga0501076_0411308 | Ga0501076_0411308_103_1086 | 325 |
| 429 | 3300050507 | nmdc:mga05p37_234728_c1 | nmdc:mga05p37_234728_c1_523_1506 | 325 |
| 430 | 3300050507 | nmdc:mga05p37_7249_c1 | nmdc:mga05p37_7249_c1_1857_2840 | 325 |
| 431 | 3300050510 | nmdc:mga06r32_13473_c1 | nmdc:mga06r32_13473_c1_1684_2667 | 325 |
| 432 | 3300050511 | nmdc:mga08y16_10941_c1 | nmdc:mga08y16_10941_c1_3914_4897 | 325 |
| 433 | 3300050514 | nmdc:mga08x19_24788_c1 | nmdc:mga08x19_24788_c1_2563_3549 | 325 |
| 434 | 3300053103 | Ga0500555_003375 | Ga0500555_003375_709_1692 | 325 |
| 435 | 3300005436 | Ga0070713_100058345 | Ga0070713_1000583452 | 326 |
| 436 | 3300005439 | Ga0070711_100112889 | Ga0070711_1001128891 | 326 |
| 437 | 3300005439 | Ga0070711_100113762 | Ga0070711_1001137622 | 326 |
| 438 | 3300005458 | Ga0070681_10035282 | Ga0070681_100352827 | 326 |
| 439 | 3300005458 | Ga0070681_10176878 | Ga0070681_101768783 | 326 |
| 440 | 3300005530 | Ga0070679_100009060 | Ga0070679_1000090604 | 326 |
| 441 | 3300006175 | Ga0070712_100001229 | Ga0070712_1000012292 | 326 |
| 442 | 3300009093 | Ga0105240_10338304 | Ga0105240_103383042 | 326 |
| 443 | 3300013105 | Ga0157369_10362392 | Ga0157369_103623922 | 326 |
| 444 | 3300025915 | Ga0207693_10001517 | Ga0207693_1000151710 | 326 |
| 445 | 3300025916 | Ga0207663_10031992 | Ga0207663_100319922 | 326 |
| 446 | 3300025916 | Ga0207663_10041091 | Ga0207663_100410912 | 326 |
| 447 | 3300037068 | Ga0373925_0178622 | Ga0373925_0178622_73_1059 | 326 |
| 448 | 3300044694 | Ga0466963_0049233 | Ga0466963_0049233_544_1539 | 326 |
| 449 | 3300044842 | Ga0466957_0018353 | Ga0466957_0018353_334_1329 | 326 |
| 450 | 3300045976 | Ga0466967_0114172 | Ga0466967_0114172_750_1745 | 326 |
| 451 | 3300046472 | Ga0495580_0001606 | Ga0495580_0001606_2947_3933 | 326 |
| 452 | 3300046472 | Ga0495580_0002290 | Ga0495580_0002290_15484_16470 | 326 |
| 453 | 3300046472 | Ga0495580_0023751 | Ga0495580_0023751_2917_3903 | 326 |
| 454 | 3300046472 | Ga0495580_0092740 | Ga0495580_0092740_1047_2033 | 326 |
| 455 | 3300048915 | Ga0496112_0173849 | Ga0496112_0173849_864_1850 | 326 |
| 456 | 2162886012 | MBSR1b_contig_175413 | MBSR1b_0646.00001650 | 327 |
| 457 | 3300001976 | JGI24752J21851_1001100 | JGI24752J21851_10011003 | 327 |
| 458 | 3300001991 | JGI24743J22301_10004790 | JGI24743J22301_100047902 | 327 |
| 459 | 3300002239 | JGI24034J26672_10002560 | JGI24034J26672_100025601 | 327 |
| 460 | 3300002459 | JGI24751J29686_10000704 | JGI24751J29686_100007047 | 327 |
| 461 | 3300004799 | Ga0058863_10071160 | Ga0058863_100711603 | 327 |
| 462 | 3300004800 | Ga0058861_10063203 | Ga0058861_100632032 | 327 |
| 463 | 3300004803 | Ga0058862_12859213 | Ga0058862_128592132 | 327 |
| 464 | 3300005290 | Ga0065712_10086452 | Ga0065712_100864522 | 327 |
| 465 | 3300005327 | Ga0070658_10026605 | Ga0070658_100266053 | 327 |
| 466 | 3300005327 | Ga0070658_10200115 | Ga0070658_102001152 | 327 |
| 467 | 3300005329 | Ga0070683_100014673 | Ga0070683_1000146737 | 327 |
| 468 | 3300005329 | Ga0070683_100035951 | Ga0070683_1000359514 | 327 |
| 469 | 3300005329 | Ga0070683_100049622 | Ga0070683_1000496222 | 327 |
| 470 | 3300005329 | Ga0070683_100073338 | Ga0070683_1000733383 | 327 |
| 471 | 3300005330 | Ga0070690_100136925 | Ga0070690_1001369252 | 327 |
| 472 | 3300005331 | Ga0070670_100017910 | Ga0070670_1000179106 | 327 |
| 473 | 3300005331 | Ga0070670_100219703 | Ga0070670_1002197033 | 327 |
| 474 | 3300005334 | Ga0068869_100002638 | Ga0068869_1000026386 | 327 |
| 475 | 3300005334 | Ga0068869_100011661 | Ga0068869_1000116612 | 327 |
| 476 | 3300005334 | Ga0068869_100108457 | Ga0068869_1001084571 | 327 |
| 477 | 3300005334 | Ga0068869_100270622 | Ga0068869_1002706221 | 327 |
| 478 | 3300005335 | Ga0070666_10062094 | Ga0070666_100620943 | 327 |
| 479 | 3300005336 | Ga0070680_100002009 | Ga0070680_10000200911 | 327 |
| 480 | 3300005336 | Ga0070680_100045686 | Ga0070680_1000456866 | 327 |
| 481 | 3300005337 | Ga0070682_100009784 | Ga0070682_1000097843 | 327 |
| 482 | 3300005337 | Ga0070682_100026601 | Ga0070682_1000266013 | 327 |
| 483 | 3300005337 | Ga0070682_100188497 | Ga0070682_1001884971 | 327 |
| 484 | 3300005338 | Ga0068868_100001549 | Ga0068868_10000154914 | 327 |
| 485 | 3300005338 | Ga0068868_100002221 | Ga0068868_10000222112 | 327 |
| 486 | 3300005338 | Ga0068868_100005847 | Ga0068868_1000058473 | 327 |
| 487 | 3300005338 | Ga0068868_100026930 | Ga0068868_1000269303 | 327 |
| 488 | 3300005338 | Ga0068868_100049830 | Ga0068868_1000498305 | 327 |
| 489 | 3300005339 | Ga0070660_100108420 | Ga0070660_1001084204 | 327 |
| 490 | 3300005339 | Ga0070660_100116335 | Ga0070660_1001163352 | 327 |
| 491 | 3300005340 | Ga0070689_100001794 | Ga0070689_1000017943 | 327 |
| 492 | 3300005340 | Ga0070689_100255251 | Ga0070689_1002552511 | 327 |
| 493 | 3300005343 | Ga0070687_100124473 | Ga0070687_1001244731 | 327 |
| 494 | 3300005343 | Ga0070687_100170452 | Ga0070687_1001704522 | 327 |
| 495 | 3300005344 | Ga0070661_100005410 | Ga0070661_1000054103 | 327 |
| 496 | 3300005344 | Ga0070661_100023061 | Ga0070661_1000230615 | 327 |
| 497 | 3300005344 | Ga0070661_100051750 | Ga0070661_1000517503 | 327 |
| 498 | 3300005353 | Ga0070669_100084244 | Ga0070669_1000842442 | 327 |
| 499 | 3300005354 | Ga0070675_100119228 | Ga0070675_1001192281 | 327 |
| 500 | 3300005355 | Ga0070671_100263159 | Ga0070671_1002631592 | 327 |
| 501 | 3300005356 | Ga0070674_100014116 | Ga0070674_1000141163 | 327 |
| 502 | 3300005364 | Ga0070673_100017192 | Ga0070673_1000171924 | 327 |
| 503 | 3300005365 | Ga0070688_100039145 | Ga0070688_1000391451 | 327 |
| 504 | 3300005366 | Ga0070659_100060263 | Ga0070659_1000602634 | 327 |
| 505 | 3300005367 | Ga0070667_100024129 | Ga0070667_1000241296 | 327 |
| 506 | 3300005434 | Ga0070709_10012180 | Ga0070709_100121803 | 327 |
| 507 | 3300005434 | Ga0070709_10019978 | Ga0070709_100199782 | 327 |
| 508 | 3300005434 | Ga0070709_10038707 | Ga0070709_100387073 | 327 |
| 509 | 3300005434 | Ga0070709_10113547 | Ga0070709_101135473 | 327 |
| 510 | 3300005434 | Ga0070709_10136093 | Ga0070709_101360932 | 327 |
| 511 | 3300005434 | Ga0070709_10178317 | Ga0070709_101783171 | 327 |
| 512 | 3300005435 | Ga0070714_100026899 | Ga0070714_1000268994 | 327 |
| 513 | 3300005435 | Ga0070714_100076345 | Ga0070714_1000763452 | 327 |
| 514 | 3300005435 | Ga0070714_100121156 | Ga0070714_1001211563 | 327 |
| 515 | 3300005435 | Ga0070714_100136572 | Ga0070714_1001365722 | 327 |
| 516 | 3300005436 | Ga0070713_100007574 | Ga0070713_1000075747 | 327 |
| 517 | 3300005436 | Ga0070713_100009238 | Ga0070713_1000092382 | 327 |
| 518 | 3300005436 | Ga0070713_100028090 | Ga0070713_1000280903 | 327 |
| 519 | 3300005436 | Ga0070713_100082674 | Ga0070713_1000826742 | 327 |
| 520 | 3300005436 | Ga0070713_100098069 | Ga0070713_1000980692 | 327 |
| 521 | 3300005436 | Ga0070713_100106406 | Ga0070713_1001064063 | 327 |
| 522 | 3300005436 | Ga0070713_100110831 | Ga0070713_1001108312 | 327 |
| 523 | 3300005436 | Ga0070713_100172013 | Ga0070713_1001720132 | 327 |
| 524 | 3300005437 | Ga0070710_10043572 | Ga0070710_100435723 | 327 |
| 525 | 3300005437 | Ga0070710_10043877 | Ga0070710_100438773 | 327 |
| 526 | 3300005437 | Ga0070710_10149788 | Ga0070710_101497881 | 327 |
| 527 | 3300005439 | Ga0070711_100001220 | Ga0070711_1000012209 | 327 |
| 528 | 3300005439 | Ga0070711_100010822 | Ga0070711_1000108223 | 327 |
| 529 | 3300005439 | Ga0070711_100068847 | Ga0070711_1000688472 | 327 |
| 530 | 3300005439 | Ga0070711_100110863 | Ga0070711_1001108632 | 327 |
| 531 | 3300005439 | Ga0070711_100423185 | Ga0070711_1004231851 | 327 |
| 532 | 3300005445 | Ga0070708_100000848 | Ga0070708_1000008487 | 327 |
| 533 | 3300005445 | Ga0070708_100002910 | Ga0070708_1000029108 | 327 |
| 534 | 3300005445 | Ga0070708_100009912 | Ga0070708_1000099123 | 327 |
| 535 | 3300005445 | Ga0070708_100011561 | Ga0070708_1000115614 | 327 |
| 536 | 3300005445 | Ga0070708_100048892 | Ga0070708_1000488925 | 327 |
| 537 | 3300005445 | Ga0070708_100079355 | Ga0070708_1000793553 | 327 |
| 538 | 3300005455 | Ga0070663_100062859 | Ga0070663_1000628592 | 327 |
| 539 | 3300005456 | Ga0070678_100031915 | Ga0070678_1000319152 | 327 |
| 540 | 3300005456 | Ga0070678_100075469 | Ga0070678_1000754692 | 327 |
| 541 | 3300005456 | Ga0070678_100304677 | Ga0070678_1003046771 | 327 |
| 542 | 3300005457 | Ga0070662_100008886 | Ga0070662_1000088865 | 327 |
| 543 | 3300005457 | Ga0070662_100018694 | Ga0070662_1000186946 | 327 |
| 544 | 3300005457 | Ga0070662_100253760 | Ga0070662_1002537601 | 327 |
| 545 | 3300005458 | Ga0070681_10000692 | Ga0070681_1000069216 | 327 |
| 546 | 3300005458 | Ga0070681_10005994 | Ga0070681_1000599411 | 327 |
| 547 | 3300005458 | Ga0070681_10008099 | Ga0070681_100080997 | 327 |
| 548 | 3300005458 | Ga0070681_10021208 | Ga0070681_100212083 | 327 |
| 549 | 3300005458 | Ga0070681_10028494 | Ga0070681_100284945 | 327 |
| 550 | 3300005458 | Ga0070681_10055803 | Ga0070681_100558032 | 327 |
| 551 | 3300005458 | Ga0070681_10058881 | Ga0070681_100588816 | 327 |
| 552 | 3300005458 | Ga0070681_10111730 | Ga0070681_101117302 | 327 |
| 553 | 3300005458 | Ga0070681_10165457 | Ga0070681_101654572 | 327 |
| 554 | 3300005458 | Ga0070681_10539954 | Ga0070681_105399541 | 327 |
| 555 | 3300005459 | Ga0068867_100008095 | Ga0068867_1000080956 | 327 |
| 556 | 3300005459 | Ga0068867_100125831 | Ga0068867_1001258312 | 327 |
| 557 | 3300005467 | Ga0070706_100000381 | Ga0070706_10000038117 | 327 |
| 558 | 3300005467 | Ga0070706_100000609 | Ga0070706_10000060913 | 327 |
| 559 | 3300005467 | Ga0070706_100006382 | Ga0070706_10000638211 | 327 |
| 560 | 3300005467 | Ga0070706_100027489 | Ga0070706_1000274895 | 327 |
| 561 | 3300005467 | Ga0070706_100061794 | Ga0070706_1000617943 | 327 |
| 562 | 3300005467 | Ga0070706_100086089 | Ga0070706_1000860892 | 327 |
| 563 | 3300005468 | Ga0070707_100018379 | Ga0070707_1000183794 | 327 |
| 564 | 3300005468 | Ga0070707_100054792 | Ga0070707_1000547922 | 327 |
| 565 | 3300005468 | Ga0070707_100087255 | Ga0070707_1000872553 | 327 |
| 566 | 3300005468 | Ga0070707_100299150 | Ga0070707_1002991501 | 327 |
| 567 | 3300005471 | Ga0070698_100000015 | Ga0070698_10000001511 | 327 |
| 568 | 3300005471 | Ga0070698_100176144 | Ga0070698_1001761442 | 327 |
| 569 | 3300005518 | Ga0070699_100045650 | Ga0070699_1000456504 | 327 |
| 570 | 3300005518 | Ga0070699_100195385 | Ga0070699_1001953853 | 327 |
| 571 | 3300005518 | Ga0070699_100286249 | Ga0070699_1002862492 | 327 |
| 572 | 3300005530 | Ga0070679_100017685 | Ga0070679_1000176852 | 327 |
| 573 | 3300005530 | Ga0070679_100036410 | Ga0070679_1000364104 | 327 |
| 574 | 3300005530 | Ga0070679_100041797 | Ga0070679_1000417973 | 327 |
| 575 | 3300005530 | Ga0070679_100049113 | Ga0070679_1000491136 | 327 |
| 576 | 3300005530 | Ga0070679_100059047 | Ga0070679_1000590474 | 327 |
| 577 | 3300005530 | Ga0070679_100068243 | Ga0070679_1000682434 | 327 |
| 578 | 3300005530 | Ga0070679_100157163 | Ga0070679_1001571634 | 327 |
| 579 | 3300005535 | Ga0070684_100002625 | Ga0070684_1000026253 | 327 |
| 580 | 3300005535 | Ga0070684_100002682 | Ga0070684_1000026827 | 327 |
| 581 | 3300005535 | Ga0070684_100007916 | Ga0070684_1000079167 | 327 |
| 582 | 3300005535 | Ga0070684_100016155 | Ga0070684_1000161556 | 327 |
| 583 | 3300005535 | Ga0070684_100054714 | Ga0070684_1000547146 | 327 |
| 584 | 3300005535 | Ga0070684_100127298 | Ga0070684_1001272982 | 327 |
| 585 | 3300005535 | Ga0070684_100168906 | Ga0070684_1001689062 | 327 |
| 586 | 3300005536 | Ga0070697_100000195 | Ga0070697_10000019522 | 327 |
| 587 | 3300005536 | Ga0070697_100003101 | Ga0070697_10000310114 | 327 |
| 588 | 3300005536 | Ga0070697_100006153 | Ga0070697_1000061539 | 327 |
| 589 | 3300005536 | Ga0070697_100010873 | Ga0070697_1000108732 | 327 |
| 590 | 3300005536 | Ga0070697_100026144 | Ga0070697_1000261444 | 327 |
| 591 | 3300005536 | Ga0070697_100086122 | Ga0070697_1000861221 | 327 |
| 592 | 3300005536 | Ga0070697_100118316 | Ga0070697_1001183162 | 327 |
| 593 | 3300005539 | Ga0068853_100004456 | Ga0068853_1000044563 | 327 |
| 594 | 3300005539 | Ga0068853_100016340 | Ga0068853_1000163403 | 327 |
| 595 | 3300005539 | Ga0068853_100051674 | Ga0068853_1000516746 | 327 |
| 596 | 3300005539 | Ga0068853_100071730 | Ga0068853_1000717302 | 327 |
| 597 | 3300005539 | Ga0068853_100093359 | Ga0068853_1000933594 | 327 |
| 598 | 3300005543 | Ga0070672_100041331 | Ga0070672_1000413313 | 327 |
| 599 | 3300005544 | Ga0070686_100022493 | Ga0070686_1000224932 | 327 |
| 600 | 3300005544 | Ga0070686_100104806 | Ga0070686_1001048062 | 327 |
| 601 | 3300005545 | Ga0070695_100070485 | Ga0070695_1000704852 | 327 |
| 602 | 3300005546 | Ga0070696_100011056 | Ga0070696_1000110566 | 327 |
| 603 | 3300005546 | Ga0070696_100167415 | Ga0070696_1001674151 | 327 |
| 604 | 3300005547 | Ga0070693_100008703 | Ga0070693_1000087032 | 327 |
| 605 | 3300005548 | Ga0070665_100027509 | Ga0070665_1000275096 | 327 |
| 606 | 3300005563 | Ga0068855_100001490 | Ga0068855_10000149028 | 327 |
| 607 | 3300005563 | Ga0068855_100002064 | Ga0068855_1000020641 | 327 |
| 608 | 3300005563 | Ga0068855_100004921 | Ga0068855_1000049216 | 327 |
| 609 | 3300005563 | Ga0068855_100013622 | Ga0068855_1000136226 | 327 |
| 610 | 3300005563 | Ga0068855_100020077 | Ga0068855_1000200775 | 327 |
| 611 | 3300005563 | Ga0068855_100055057 | Ga0068855_1000550573 | 327 |
| 612 | 3300005563 | Ga0068855_100368240 | Ga0068855_1003682401 | 327 |
| 613 | 3300005563 | Ga0068855_100612017 | Ga0068855_1006120171 | 327 |
| 614 | 3300005564 | Ga0070664_100017492 | Ga0070664_1000174924 | 327 |
| 615 | 3300005564 | Ga0070664_100147243 | Ga0070664_1001472434 | 327 |
| 616 | 3300005577 | Ga0068857_100001030 | Ga0068857_1000010302 | 327 |
| 617 | 3300005577 | Ga0068857_100003337 | Ga0068857_10000333713 | 327 |
| 618 | 3300005577 | Ga0068857_100096591 | Ga0068857_1000965912 | 327 |
| 619 | 3300005577 | Ga0068857_100215307 | Ga0068857_1002153072 | 327 |
| 620 | 3300005578 | Ga0068854_100004220 | Ga0068854_1000042203 | 327 |
| 621 | 3300005578 | Ga0068854_100012031 | Ga0068854_1000120315 | 327 |
| 622 | 3300005614 | Ga0068856_100000065 | Ga0068856_10000006521 | 327 |
| 623 | 3300005614 | Ga0068856_100000989 | Ga0068856_10000098913 | 327 |
| 624 | 3300005614 | Ga0068856_100002496 | Ga0068856_1000024966 | 327 |
| 625 | 3300005614 | Ga0068856_100012096 | Ga0068856_1000120962 | 327 |
| 626 | 3300005614 | Ga0068856_100023046 | Ga0068856_1000230465 | 327 |
| 627 | 3300005614 | Ga0068856_100028145 | Ga0068856_1000281451 | 327 |
| 628 | 3300005614 | Ga0068856_100052234 | Ga0068856_1000522342 | 327 |
| 629 | 3300005614 | Ga0068856_100057605 | Ga0068856_1000576056 | 327 |
| 630 | 3300005614 | Ga0068856_100158414 | Ga0068856_1001584143 | 327 |
| 631 | 3300005614 | Ga0068856_100220034 | Ga0068856_1002200342 | 327 |
| 632 | 3300005614 | Ga0068856_100477087 | Ga0068856_1004770872 | 327 |
| 633 | 3300005615 | Ga0070702_100009321 | Ga0070702_1000093212 | 327 |
| 634 | 3300005616 | Ga0068852_100052092 | Ga0068852_1000520925 | 327 |
| 635 | 3300005616 | Ga0068852_100102856 | Ga0068852_1001028563 | 327 |
| 636 | 3300005617 | Ga0068859_100000939 | Ga0068859_10000093913 | 327 |
| 637 | 3300005617 | Ga0068859_100005531 | Ga0068859_10000553114 | 327 |
| 638 | 3300005617 | Ga0068859_100417281 | Ga0068859_1004172812 | 327 |
| 639 | 3300005618 | Ga0068864_100000369 | Ga0068864_10000036916 | 327 |
| 640 | 3300005618 | Ga0068864_100008228 | Ga0068864_1000082287 | 327 |
| 641 | 3300005618 | Ga0068864_100032790 | Ga0068864_1000327904 | 327 |
| 642 | 3300005618 | Ga0068864_100198148 | Ga0068864_1001981482 | 327 |
| 643 | 3300005718 | Ga0068866_10003414 | Ga0068866_100034144 | 327 |
| 644 | 3300005718 | Ga0068866_10009998 | Ga0068866_100099985 | 327 |
| 645 | 3300005718 | Ga0068866_10149758 | Ga0068866_101497582 | 327 |
| 646 | 3300005719 | Ga0068861_100009849 | Ga0068861_1000098496 | 327 |
| 647 | 3300005719 | Ga0068861_100172783 | Ga0068861_1001727833 | 327 |
| 648 | 3300005834 | Ga0068851_10005710 | Ga0068851_100057106 | 327 |
| 649 | 3300005840 | Ga0068870_10000935 | Ga0068870_100009353 | 327 |
| 650 | 3300005841 | Ga0068863_100006532 | Ga0068863_10000653210 | 327 |
| 651 | 3300005841 | Ga0068863_100050601 | Ga0068863_1000506016 | 327 |
| 652 | 3300005841 | Ga0068863_100160860 | Ga0068863_1001608602 | 327 |
| 653 | 3300005842 | Ga0068858_100002175 | Ga0068858_1000021757 | 327 |
| 654 | 3300005842 | Ga0068858_100024408 | Ga0068858_1000244086 | 327 |
| 655 | 3300005842 | Ga0068858_100027668 | Ga0068858_1000276684 | 327 |
| 656 | 3300005843 | Ga0068860_100061945 | Ga0068860_1000619452 | 327 |
| 657 | 3300005843 | Ga0068860_100065633 | Ga0068860_1000656332 | 327 |
| 658 | 3300005843 | Ga0068860_100110187 | Ga0068860_1001101872 | 327 |
| 659 | 3300005843 | Ga0068860_100355061 | Ga0068860_1003550612 | 327 |
| 660 | 3300005843 | Ga0068860_100488859 | Ga0068860_1004888591 | 327 |
| 661 | 3300005844 | Ga0068862_100015615 | Ga0068862_1000156152 | 327 |
| 662 | 3300005844 | Ga0068862_100024780 | Ga0068862_1000247804 | 327 |
| 663 | 3300005983 | Ga0081540_1026668 | Ga0081540_10266682 | 327 |
| 664 | 3300006028 | Ga0070717_10001830 | Ga0070717_100018305 | 327 |
| 665 | 3300006028 | Ga0070717_10002609 | Ga0070717_1000260916 | 327 |
| 666 | 3300006028 | Ga0070717_10004387 | Ga0070717_100043872 | 327 |
| 667 | 3300006028 | Ga0070717_10007529 | Ga0070717_100075297 | 327 |
| 668 | 3300006028 | Ga0070717_10016823 | Ga0070717_100168233 | 327 |
| 669 | 3300006028 | Ga0070717_10035619 | Ga0070717_100356198 | 327 |
| 670 | 3300006028 | Ga0070717_10061452 | Ga0070717_100614522 | 327 |
| 671 | 3300006028 | Ga0070717_10111940 | Ga0070717_101119402 | 327 |
| 672 | 3300006028 | Ga0070717_10165616 | Ga0070717_101656163 | 327 |
| 673 | 3300006163 | Ga0070715_10005347 | Ga0070715_100053475 | 327 |
| 674 | 3300006163 | Ga0070715_10018053 | Ga0070715_100180532 | 327 |
| 675 | 3300006163 | Ga0070715_10032661 | Ga0070715_100326612 | 327 |
| 676 | 3300006173 | Ga0070716_100082439 | Ga0070716_1000824392 | 327 |
| 677 | 3300006175 | Ga0070712_100005202 | Ga0070712_1000052026 | 327 |
| 678 | 3300006175 | Ga0070712_100007031 | Ga0070712_1000070313 | 327 |
| 679 | 3300006175 | Ga0070712_100015260 | Ga0070712_1000152602 | 327 |
| 680 | 3300006175 | Ga0070712_100191397 | Ga0070712_1001913972 | 327 |
| 681 | 3300006237 | Ga0097621_100000034 | Ga0097621_10000003439 | 327 |
| 682 | 3300006237 | Ga0097621_100000908 | Ga0097621_1000009083 | 327 |
| 683 | 3300006237 | Ga0097621_100049009 | Ga0097621_1000490092 | 327 |
| 684 | 3300006237 | Ga0097621_100049426 | Ga0097621_1000494263 | 327 |
| 685 | 3300006237 | Ga0097621_100076264 | Ga0097621_1000762643 | 327 |
| 686 | 3300006237 | Ga0097621_100247316 | Ga0097621_1002473162 | 327 |
| 687 | 3300006237 | Ga0097621_100444465 | Ga0097621_1004444651 | 327 |
| 688 | 3300006358 | Ga0068871_100000233 | Ga0068871_10000023325 | 327 |
| 689 | 3300006358 | Ga0068871_100000444 | Ga0068871_10000044416 | 327 |
| 690 | 3300006358 | Ga0068871_100091447 | Ga0068871_1000914474 | 327 |
| 691 | 3300006358 | Ga0068871_100252942 | Ga0068871_1002529422 | 327 |
| 692 | 3300006871 | Ga0075434_100038540 | Ga0075434_1000385402 | 327 |
| 693 | 3300006871 | Ga0075434_100147812 | Ga0075434_1001478123 | 327 |
| 694 | 3300006871 | Ga0075434_100188356 | Ga0075434_1001883562 | 327 |
| 695 | 3300006881 | Ga0068865_100002230 | Ga0068865_1000022305 | 327 |
| 696 | 3300006881 | Ga0068865_100006642 | Ga0068865_1000066422 | 327 |
| 697 | 3300006881 | Ga0068865_100044236 | Ga0068865_1000442363 | 327 |
| 698 | 3300006914 | Ga0075436_100003577 | Ga0075436_1000035779 | 327 |
| 699 | 3300006914 | Ga0075436_100080970 | Ga0075436_1000809702 | 327 |
| 700 | 3300006931 | Ga0097620_100000939 | Ga0097620_10000093913 | 327 |
| 701 | 3300006931 | Ga0097620_100005531 | Ga0097620_1000055312 | 327 |
| 702 | 3300006931 | Ga0097620_100417257 | Ga0097620_1004172572 | 327 |
| 703 | 3300007076 | Ga0075435_100010144 | Ga0075435_1000101443 | 327 |
| 704 | 3300007265 | Ga0099794_10144830 | Ga0099794_101448301 | 327 |
| 705 | 3300009011 | Ga0105251_10100663 | Ga0105251_101006631 | 327 |
| 706 | 3300009092 | Ga0105250_10009360 | Ga0105250_100093602 | 327 |
| 707 | 3300009093 | Ga0105240_10006455 | Ga0105240_1000645513 | 327 |
| 708 | 3300009093 | Ga0105240_10065144 | Ga0105240_100651445 | 327 |
| 709 | 3300009093 | Ga0105240_10116022 | Ga0105240_101160222 | 327 |
| 710 | 3300009093 | Ga0105240_10128678 | Ga0105240_101286782 | 327 |
| 711 | 3300009093 | Ga0105240_10152642 | Ga0105240_101526423 | 327 |
| 712 | 3300009093 | Ga0105240_10206913 | Ga0105240_102069132 | 327 |
| 713 | 3300009093 | Ga0105240_10735834 | Ga0105240_107358341 | 327 |
| 714 | 3300009098 | Ga0105245_10000624 | Ga0105245_100006245 | 327 |
| 715 | 3300009098 | Ga0105245_10007043 | Ga0105245_100070437 | 327 |
| 716 | 3300009098 | Ga0105245_10058681 | Ga0105245_100586814 | 327 |
| 717 | 3300009098 | Ga0105245_10083479 | Ga0105245_100834793 | 327 |
| 718 | 3300009098 | Ga0105245_10101680 | Ga0105245_101016804 | 327 |
| 719 | 3300009098 | Ga0105245_10281561 | Ga0105245_102815612 | 327 |
| 720 | 3300009101 | Ga0105247_10001507 | Ga0105247_1000150714 | 327 |
| 721 | 3300009101 | Ga0105247_10093622 | Ga0105247_100936222 | 327 |
| 722 | 3300009148 | Ga0105243_10439729 | Ga0105243_104397291 | 327 |
| 723 | 3300009174 | Ga0105241_10002126 | Ga0105241_1000212616 | 327 |
| 724 | 3300009174 | Ga0105241_10117677 | Ga0105241_101176772 | 327 |
| 725 | 3300009174 | Ga0105241_10154538 | Ga0105241_101545381 | 327 |
| 726 | 3300009176 | Ga0105242_10053867 | Ga0105242_100538673 | 327 |
| 727 | 3300009176 | Ga0105242_10099580 | Ga0105242_100995803 | 327 |
| 728 | 3300009176 | Ga0105242_10376543 | Ga0105242_103765431 | 327 |
| 729 | 3300009177 | Ga0105248_10005836 | Ga0105248_100058366 | 327 |
| 730 | 3300009177 | Ga0105248_10072101 | Ga0105248_100721013 | 327 |
| 731 | 3300009177 | Ga0105248_10091853 | Ga0105248_100918534 | 327 |
| 732 | 3300009545 | Ga0105237_10008538 | Ga0105237_1000853812 | 327 |
| 733 | 3300009545 | Ga0105237_10019697 | Ga0105237_100196972 | 327 |
| 734 | 3300009545 | Ga0105237_10029884 | Ga0105237_100298845 | 327 |
| 735 | 3300009545 | Ga0105237_10151073 | Ga0105237_101510732 | 327 |
| 736 | 3300009545 | Ga0105237_10164956 | Ga0105237_101649563 | 327 |
| 737 | 3300009551 | Ga0105238_10000464 | Ga0105238_1000046410 | 327 |
| 738 | 3300009551 | Ga0105238_10016655 | Ga0105238_100166551 | 327 |
| 739 | 3300009551 | Ga0105238_10049855 | Ga0105238_100498552 | 327 |
| 740 | 3300009551 | Ga0105238_10200457 | Ga0105238_102004572 | 327 |
| 741 | 3300009553 | Ga0105249_10004737 | Ga0105249_100047377 | 327 |
| 742 | 3300010375 | Ga0105239_10053632 | Ga0105239_100536324 | 327 |
| 743 | 3300010375 | Ga0105239_10054173 | Ga0105239_100541734 | 327 |
| 744 | 3300010375 | Ga0105239_10248862 | Ga0105239_102488622 | 327 |
| 745 | 3300011119 | Ga0105246_10001854 | Ga0105246_100018543 | 327 |
| 746 | 3300011119 | Ga0105246_10034407 | Ga0105246_100344072 | 327 |
| 747 | 3300013100 | Ga0157373_10001119 | Ga0157373_100011197 | 327 |
| 748 | 3300013100 | Ga0157373_10017190 | Ga0157373_100171907 | 327 |
| 749 | 3300013100 | Ga0157373_10043524 | Ga0157373_100435242 | 327 |
| 750 | 3300013100 | Ga0157373_10049631 | Ga0157373_100496312 | 327 |
| 751 | 3300013100 | Ga0157373_10058555 | Ga0157373_100585552 | 327 |
| 752 | 3300013100 | Ga0157373_10177962 | Ga0157373_101779621 | 327 |
| 753 | 3300013102 | Ga0157371_10012556 | Ga0157371_100125566 | 327 |
| 754 | 3300013102 | Ga0157371_10013207 | Ga0157371_100132076 | 327 |
| 755 | 3300013104 | Ga0157370_10016231 | Ga0157370_100162313 | 327 |
| 756 | 3300013104 | Ga0157370_10158393 | Ga0157370_101583932 | 327 |
| 757 | 3300013104 | Ga0157370_10289527 | Ga0157370_102895272 | 327 |
| 758 | 3300013105 | Ga0157369_10000264 | Ga0157369_1000026421 | 327 |
| 759 | 3300013105 | Ga0157369_10010181 | Ga0157369_100101817 | 327 |
| 760 | 3300013105 | Ga0157369_10014322 | Ga0157369_100143228 | 327 |
| 761 | 3300013105 | Ga0157369_10078699 | Ga0157369_100786992 | 327 |
| 762 | 3300013105 | Ga0157369_10102065 | Ga0157369_101020653 | 327 |
| 763 | 3300013105 | Ga0157369_10150938 | Ga0157369_101509383 | 327 |
| 764 | 3300013105 | Ga0157369_10225621 | Ga0157369_102256214 | 327 |
| 765 | 3300013105 | Ga0157369_10256053 | Ga0157369_102560532 | 327 |
| 766 | 3300013105 | Ga0157369_10354439 | Ga0157369_103544392 | 327 |
| 767 | 3300013105 | Ga0157369_10365070 | Ga0157369_103650702 | 327 |
| 768 | 3300013105 | Ga0157369_10418488 | Ga0157369_104184881 | 327 |
| 769 | 3300013296 | Ga0157374_10000249 | Ga0157374_1000024937 | 327 |
| 770 | 3300013296 | Ga0157374_10000496 | Ga0157374_1000049622 | 327 |
| 771 | 3300013296 | Ga0157374_10001107 | Ga0157374_1000110710 | 327 |
| 772 | 3300013296 | Ga0157374_10005920 | Ga0157374_100059206 | 327 |
| 773 | 3300013296 | Ga0157374_10024491 | Ga0157374_100244916 | 327 |
| 774 | 3300013296 | Ga0157374_10078774 | Ga0157374_100787742 | 327 |
| 775 | 3300013296 | Ga0157374_10125558 | Ga0157374_101255583 | 327 |
| 776 | 3300013296 | Ga0157374_10229305 | Ga0157374_102293053 | 327 |
| 777 | 3300013297 | Ga0157378_10000008 | Ga0157378_1000000848 | 327 |
| 778 | 3300013297 | Ga0157378_10002765 | Ga0157378_100027654 | 327 |
| 779 | 3300013297 | Ga0157378_10003358 | Ga0157378_1000335810 | 327 |
| 780 | 3300013297 | Ga0157378_10045872 | Ga0157378_100458722 | 327 |
| 781 | 3300013297 | Ga0157378_10093841 | Ga0157378_100938412 | 327 |
| 782 | 3300013297 | Ga0157378_10255933 | Ga0157378_102559332 | 327 |
| 783 | 3300013306 | Ga0163162_10000777 | Ga0163162_1000077717 | 327 |
| 784 | 3300013306 | Ga0163162_10024543 | Ga0163162_100245436 | 327 |
| 785 | 3300013306 | Ga0163162_10288342 | Ga0163162_102883422 | 327 |
| 786 | 3300013307 | Ga0157372_10000436 | Ga0157372_1000043636 | 327 |
| 787 | 3300013307 | Ga0157372_10000611 | Ga0157372_100006116 | 327 |
| 788 | 3300013307 | Ga0157372_10001696 | Ga0157372_100016964 | 327 |
| 789 | 3300013307 | Ga0157372_10004250 | Ga0157372_100042508 | 327 |
| 790 | 3300013307 | Ga0157372_10008298 | Ga0157372_100082986 | 327 |
| 791 | 3300013307 | Ga0157372_10019394 | Ga0157372_100193948 | 327 |
| 792 | 3300013307 | Ga0157372_10049516 | Ga0157372_100495161 | 327 |
| 793 | 3300013307 | Ga0157372_10065331 | Ga0157372_100653311 | 327 |
| 794 | 3300013307 | Ga0157372_10078438 | Ga0157372_100784384 | 327 |
| 795 | 3300013307 | Ga0157372_10122925 | Ga0157372_101229252 | 327 |
| 796 | 3300013307 | Ga0157372_10247006 | Ga0157372_102470062 | 327 |
| 797 | 3300013308 | Ga0157375_10003580 | Ga0157375_100035808 | 327 |
| 798 | 3300013308 | Ga0157375_10015367 | Ga0157375_100153674 | 327 |
| 799 | 3300013308 | Ga0157375_10030491 | Ga0157375_100304913 | 327 |
| 800 | 3300013308 | Ga0157375_10356373 | Ga0157375_103563732 | 327 |
| 801 | 3300014325 | Ga0163163_10020441 | Ga0163163_100204413 | 327 |
| 802 | 3300014325 | Ga0163163_10025274 | Ga0163163_100252745 | 327 |
| 803 | 3300014325 | Ga0163163_10059974 | Ga0163163_100599746 | 327 |
| 804 | 3300014325 | Ga0163163_10110393 | Ga0163163_101103933 | 327 |
| 805 | 3300014325 | Ga0163163_10360639 | Ga0163163_103606392 | 327 |
| 806 | 3300014497 | Ga0182008_10044746 | Ga0182008_100447463 | 327 |
| 807 | 3300014745 | Ga0157377_10007969 | Ga0157377_100079693 | 327 |
| 808 | 3300014968 | Ga0157379_10001812 | Ga0157379_100018124 | 327 |
| 809 | 3300014968 | Ga0157379_10026975 | Ga0157379_100269754 | 327 |
| 810 | 3300014968 | Ga0157379_10055120 | Ga0157379_100551203 | 327 |
| 811 | 3300014968 | Ga0157379_10060793 | Ga0157379_100607935 | 327 |
| 812 | 3300014968 | Ga0157379_10175320 | Ga0157379_101753202 | 327 |
| 813 | 3300014969 | Ga0157376_10004063 | Ga0157376_100040637 | 327 |
| 814 | 3300014969 | Ga0157376_10042115 | Ga0157376_100421156 | 327 |
| 815 | 3300014969 | Ga0157376_10049476 | Ga0157376_100494765 | 327 |
| 816 | 3300014969 | Ga0157376_10272741 | Ga0157376_102727411 | 327 |
| 817 | 3300015261 | Ga0182006_1021588 | Ga0182006_10215883 | 327 |
| 818 | 3300015261 | Ga0182006_1072942 | Ga0182006_10729421 | 327 |
| 819 | 3300015262 | Ga0182007_10002409 | Ga0182007_100024093 | 327 |
| 820 | 3300015262 | Ga0182007_10039680 | Ga0182007_100396801 | 327 |
| 821 | 3300015265 | Ga0182005_1009264 | Ga0182005_10092645 | 327 |
| 822 | 3300017792 | Ga0163161_10051815 | Ga0163161_100518153 | 327 |
| 823 | 3300020081 | Ga0206354_10265616 | Ga0206354_102656163 | 327 |
| 824 | 3300021358 | Ga0213873_10020908 | Ga0213873_100209082 | 327 |
| 825 | 3300022467 | Ga0224712_10026682 | Ga0224712_100266822 | 327 |
| 826 | 3300022467 | Ga0224712_10044458 | Ga0224712_100444583 | 327 |
| 827 | 3300022730 | Ga0224570_100565 | Ga0224570_1005654 | 327 |
| 828 | 3300024225 | Ga0224572_1000257 | Ga0224572_10002573 | 327 |
| 829 | 3300024227 | Ga0228598_1001074 | Ga0228598_10010744 | 327 |
| 830 | 3300024227 | Ga0228598_1001256 | Ga0228598_10012566 | 327 |
| 831 | 3300025321 | Ga0207656_10036251 | Ga0207656_100362513 | 327 |
| 832 | 3300025898 | Ga0207692_10063997 | Ga0207692_100639973 | 327 |
| 833 | 3300025899 | Ga0207642_10005304 | Ga0207642_100053044 | 327 |
| 834 | 3300025899 | Ga0207642_10018358 | Ga0207642_100183583 | 327 |
| 835 | 3300025901 | Ga0207688_10003069 | Ga0207688_100030697 | 327 |
| 836 | 3300025904 | Ga0207647_10002063 | Ga0207647_1000206310 | 327 |
| 837 | 3300025904 | Ga0207647_10016048 | Ga0207647_100160486 | 327 |
| 838 | 3300025904 | Ga0207647_10049796 | Ga0207647_100497963 | 327 |
| 839 | 3300025904 | Ga0207647_10098194 | Ga0207647_100981942 | 327 |
| 840 | 3300025905 | Ga0207685_10003074 | Ga0207685_100030745 | 327 |
| 841 | 3300025905 | Ga0207685_10038958 | Ga0207685_100389582 | 327 |
| 842 | 3300025906 | Ga0207699_10012015 | Ga0207699_100120152 | 327 |
| 843 | 3300025906 | Ga0207699_10050642 | Ga0207699_100506422 | 327 |
| 844 | 3300025906 | Ga0207699_10146111 | Ga0207699_101461112 | 327 |
| 845 | 3300025906 | Ga0207699_10334304 | Ga0207699_103343041 | 327 |
| 846 | 3300025907 | Ga0207645_10000901 | Ga0207645_1000090121 | 327 |
| 847 | 3300025907 | Ga0207645_10006268 | Ga0207645_100062683 | 327 |
| 848 | 3300025908 | Ga0207643_10000172 | Ga0207643_1000017212 | 327 |
| 849 | 3300025909 | Ga0207705_10045267 | Ga0207705_100452673 | 327 |
| 850 | 3300025910 | Ga0207684_10005976 | Ga0207684_100059766 | 327 |
| 851 | 3300025910 | Ga0207684_10017175 | Ga0207684_100171751 | 327 |
| 852 | 3300025910 | Ga0207684_10062474 | Ga0207684_100624744 | 327 |
| 853 | 3300025910 | Ga0207684_10094980 | Ga0207684_100949802 | 327 |
| 854 | 3300025911 | Ga0207654_10029582 | Ga0207654_100295822 | 327 |
| 855 | 3300025911 | Ga0207654_10032668 | Ga0207654_100326683 | 327 |
| 856 | 3300025912 | Ga0207707_10000266 | Ga0207707_1000026643 | 327 |
| 857 | 3300025912 | Ga0207707_10003379 | Ga0207707_100033796 | 327 |
| 858 | 3300025912 | Ga0207707_10007460 | Ga0207707_100074607 | 327 |
| 859 | 3300025912 | Ga0207707_10011097 | Ga0207707_100110978 | 327 |
| 860 | 3300025912 | Ga0207707_10021147 | Ga0207707_100211471 | 327 |
| 861 | 3300025912 | Ga0207707_10065929 | Ga0207707_100659292 | 327 |
| 862 | 3300025912 | Ga0207707_10101188 | Ga0207707_101011884 | 327 |
| 863 | 3300025913 | Ga0207695_10003740 | Ga0207695_1000374018 | 327 |
| 864 | 3300025913 | Ga0207695_10007402 | Ga0207695_100074025 | 327 |
| 865 | 3300025913 | Ga0207695_10016105 | Ga0207695_100161059 | 327 |
| 866 | 3300025913 | Ga0207695_10037550 | Ga0207695_100375502 | 327 |
| 867 | 3300025913 | Ga0207695_10178963 | Ga0207695_101789633 | 327 |
| 868 | 3300025913 | Ga0207695_10373813 | Ga0207695_103738131 | 327 |
| 869 | 3300025913 | Ga0207695_10480551 | Ga0207695_104805511 | 327 |
| 870 | 3300025914 | Ga0207671_10027073 | Ga0207671_100270735 | 327 |
| 871 | 3300025914 | Ga0207671_10064810 | Ga0207671_100648102 | 327 |
| 872 | 3300025914 | Ga0207671_10133740 | Ga0207671_101337401 | 327 |
| 873 | 3300025915 | Ga0207693_10000098 | Ga0207693_1000009849 | 327 |
| 874 | 3300025915 | Ga0207693_10000884 | Ga0207693_1000088424 | 327 |
| 875 | 3300025915 | Ga0207693_10012227 | Ga0207693_100122273 | 327 |
| 876 | 3300025915 | Ga0207693_10044284 | Ga0207693_100442843 | 327 |
| 877 | 3300025915 | Ga0207693_10079310 | Ga0207693_100793103 | 327 |
| 878 | 3300025915 | Ga0207693_10112274 | Ga0207693_101122743 | 327 |
| 879 | 3300025915 | Ga0207693_10237676 | Ga0207693_102376762 | 327 |
| 880 | 3300025916 | Ga0207663_10007568 | Ga0207663_100075683 | 327 |
| 881 | 3300025916 | Ga0207663_10087264 | Ga0207663_100872643 | 327 |
| 882 | 3300025916 | Ga0207663_10089454 | Ga0207663_100894541 | 327 |
| 883 | 3300025916 | Ga0207663_10095862 | Ga0207663_100958622 | 327 |
| 884 | 3300025917 | Ga0207660_10002995 | Ga0207660_100029952 | 327 |
| 885 | 3300025917 | Ga0207660_10061997 | Ga0207660_100619971 | 327 |
| 886 | 3300025917 | Ga0207660_10074438 | Ga0207660_100744383 | 327 |
| 887 | 3300025917 | Ga0207660_10178146 | Ga0207660_101781462 | 327 |
| 888 | 3300025917 | Ga0207660_10285284 | Ga0207660_102852842 | 327 |
| 889 | 3300025918 | Ga0207662_10002090 | Ga0207662_100020907 | 327 |
| 890 | 3300025918 | Ga0207662_10174525 | Ga0207662_101745252 | 327 |
| 891 | 3300025919 | Ga0207657_10000660 | Ga0207657_1000066019 | 327 |
| 892 | 3300025919 | Ga0207657_10002292 | Ga0207657_1000229216 | 327 |
| 893 | 3300025919 | Ga0207657_10016937 | Ga0207657_100169375 | 327 |
| 894 | 3300025920 | Ga0207649_10001125 | Ga0207649_1000112513 | 327 |
| 895 | 3300025920 | Ga0207649_10023104 | Ga0207649_100231041 | 327 |
| 896 | 3300025920 | Ga0207649_10156878 | Ga0207649_101568782 | 327 |
| 897 | 3300025921 | Ga0207652_10001598 | Ga0207652_1000159814 | 327 |
| 898 | 3300025921 | Ga0207652_10003545 | Ga0207652_100035454 | 327 |
| 899 | 3300025921 | Ga0207652_10038171 | Ga0207652_100381714 | 327 |
| 900 | 3300025921 | Ga0207652_10064198 | Ga0207652_100641982 | 327 |
| 901 | 3300025921 | Ga0207652_10106214 | Ga0207652_101062142 | 327 |
| 902 | 3300025921 | Ga0207652_10139802 | Ga0207652_101398023 | 327 |
| 903 | 3300025922 | Ga0207646_10004709 | Ga0207646_1000470910 | 327 |
| 904 | 3300025922 | Ga0207646_10045908 | Ga0207646_100459083 | 327 |
| 905 | 3300025922 | Ga0207646_10046574 | Ga0207646_100465745 | 327 |
| 906 | 3300025922 | Ga0207646_10077799 | Ga0207646_100777993 | 327 |
| 907 | 3300025923 | Ga0207681_10064112 | Ga0207681_100641123 | 327 |
| 908 | 3300025924 | Ga0207694_10002762 | Ga0207694_100027624 | 327 |
| 909 | 3300025924 | Ga0207694_10029240 | Ga0207694_100292404 | 327 |
| 910 | 3300025924 | Ga0207694_10065154 | Ga0207694_100651542 | 327 |
| 911 | 3300025924 | Ga0207694_10122260 | Ga0207694_101222602 | 327 |
| 912 | 3300025924 | Ga0207694_10245779 | Ga0207694_102457791 | 327 |
| 913 | 3300025925 | Ga0207650_10000059 | Ga0207650_1000005935 | 327 |
| 914 | 3300025927 | Ga0207687_10006015 | Ga0207687_100060154 | 327 |
| 915 | 3300025927 | Ga0207687_10009700 | Ga0207687_100097006 | 327 |
| 916 | 3300025928 | Ga0207700_10008946 | Ga0207700_100089464 | 327 |
| 917 | 3300025928 | Ga0207700_10015310 | Ga0207700_100153102 | 327 |
| 918 | 3300025928 | Ga0207700_10018692 | Ga0207700_100186924 | 327 |
| 919 | 3300025928 | Ga0207700_10063197 | Ga0207700_100631973 | 327 |
| 920 | 3300025928 | Ga0207700_10099797 | Ga0207700_100997973 | 327 |
| 921 | 3300025928 | Ga0207700_10144330 | Ga0207700_101443303 | 327 |
| 922 | 3300025928 | Ga0207700_10151979 | Ga0207700_101519791 | 327 |
| 923 | 3300025928 | Ga0207700_10186426 | Ga0207700_101864261 | 327 |
| 924 | 3300025928 | Ga0207700_10296062 | Ga0207700_102960622 | 327 |
| 925 | 3300025929 | Ga0207664_10066656 | Ga0207664_100666563 | 327 |
| 926 | 3300025929 | Ga0207664_10138936 | Ga0207664_101389362 | 327 |
| 927 | 3300025929 | Ga0207664_10138971 | Ga0207664_101389712 | 327 |
| 928 | 3300025929 | Ga0207664_10448275 | Ga0207664_104482751 | 327 |
| 929 | 3300025932 | Ga0207690_10089161 | Ga0207690_100891613 | 327 |
| 930 | 3300025933 | Ga0207706_10000098 | Ga0207706_1000009831 | 327 |
| 931 | 3300025933 | Ga0207706_10000723 | Ga0207706_1000072316 | 327 |
| 932 | 3300025934 | Ga0207686_10069416 | Ga0207686_100694162 | 327 |
| 933 | 3300025936 | Ga0207670_10205381 | Ga0207670_102053812 | 327 |
| 934 | 3300025938 | Ga0207704_10048954 | Ga0207704_100489542 | 327 |
| 935 | 3300025938 | Ga0207704_10075112 | Ga0207704_100751122 | 327 |
| 936 | 3300025939 | Ga0207665_10020494 | Ga0207665_100204944 | 327 |
| 937 | 3300025939 | Ga0207665_10037720 | Ga0207665_100377201 | 327 |
| 938 | 3300025939 | Ga0207665_10067103 | Ga0207665_100671032 | 327 |
| 939 | 3300025939 | Ga0207665_10104350 | Ga0207665_101043502 | 327 |
| 940 | 3300025940 | Ga0207691_10001129 | Ga0207691_1000112919 | 327 |
| 941 | 3300025941 | Ga0207711_10004346 | Ga0207711_100043467 | 327 |
| 942 | 3300025941 | Ga0207711_10035400 | Ga0207711_100354002 | 327 |
| 943 | 3300025941 | Ga0207711_10114209 | Ga0207711_101142093 | 327 |
| 944 | 3300025942 | Ga0207689_10000353 | Ga0207689_1000035317 | 327 |
| 945 | 3300025942 | Ga0207689_10038519 | Ga0207689_100385193 | 327 |
| 946 | 3300025942 | Ga0207689_10098949 | Ga0207689_100989492 | 327 |
| 947 | 3300025942 | Ga0207689_10141747 | Ga0207689_101417472 | 327 |
| 948 | 3300025944 | Ga0207661_10096946 | Ga0207661_100969464 | 327 |
| 949 | 3300025945 | Ga0207679_10000415 | Ga0207679_1000041520 | 327 |
| 950 | 3300025945 | Ga0207679_10031074 | Ga0207679_100310742 | 327 |
| 951 | 3300025949 | Ga0207667_10000413 | Ga0207667_1000041339 | 327 |
| 952 | 3300025949 | Ga0207667_10006238 | Ga0207667_100062384 | 327 |
| 953 | 3300025949 | Ga0207667_10012296 | Ga0207667_100122963 | 327 |
| 954 | 3300025949 | Ga0207667_10018332 | Ga0207667_100183326 | 327 |
| 955 | 3300025949 | Ga0207667_10083898 | Ga0207667_100838982 | 327 |
| 956 | 3300025949 | Ga0207667_10148903 | Ga0207667_101489032 | 327 |
| 957 | 3300025949 | Ga0207667_10348265 | Ga0207667_103482653 | 327 |
| 958 | 3300025961 | Ga0207712_10007011 | Ga0207712_100070114 | 327 |
| 959 | 3300025961 | Ga0207712_10268382 | Ga0207712_102683822 | 327 |
| 960 | 3300025972 | Ga0207668_10008891 | Ga0207668_100088913 | 327 |
| 961 | 3300025981 | Ga0207640_10060567 | Ga0207640_100605672 | 327 |
| 962 | 3300025981 | Ga0207640_10079021 | Ga0207640_100790212 | 327 |
| 963 | 3300025981 | Ga0207640_10089505 | Ga0207640_100895052 | 327 |
| 964 | 3300025981 | Ga0207640_10149792 | Ga0207640_101497922 | 327 |
| 965 | 3300026023 | Ga0207677_10001543 | Ga0207677_100015439 | 327 |
| 966 | 3300026023 | Ga0207677_10001745 | Ga0207677_100017458 | 327 |
| 967 | 3300026023 | Ga0207677_10003837 | Ga0207677_100038372 | 327 |
| 968 | 3300026023 | Ga0207677_10004382 | Ga0207677_100043826 | 327 |
| 969 | 3300026023 | Ga0207677_10011658 | Ga0207677_100116583 | 327 |
| 970 | 3300026023 | Ga0207677_10078138 | Ga0207677_100781381 | 327 |
| 971 | 3300026023 | Ga0207677_10192605 | Ga0207677_101926053 | 327 |
| 972 | 3300026035 | Ga0207703_10006204 | Ga0207703_100062043 | 327 |
| 973 | 3300026035 | Ga0207703_10007234 | Ga0207703_100072346 | 327 |
| 974 | 3300026035 | Ga0207703_10010063 | Ga0207703_100100636 | 327 |
| 975 | 3300026035 | Ga0207703_10050625 | Ga0207703_100506253 | 327 |
| 976 | 3300026035 | Ga0207703_10069955 | Ga0207703_100699552 | 327 |
| 977 | 3300026035 | Ga0207703_10373062 | Ga0207703_103730622 | 327 |
| 978 | 3300026041 | Ga0207639_10016209 | Ga0207639_100162093 | 327 |
| 979 | 3300026041 | Ga0207639_10038468 | Ga0207639_100384682 | 327 |
| 980 | 3300026041 | Ga0207639_10077952 | Ga0207639_100779522 | 327 |
| 981 | 3300026067 | Ga0207678_10000581 | Ga0207678_1000058120 | 327 |
| 982 | 3300026067 | Ga0207678_10006094 | Ga0207678_1000609410 | 327 |
| 983 | 3300026078 | Ga0207702_10000209 | Ga0207702_1000020921 | 327 |
| 984 | 3300026078 | Ga0207702_10001199 | Ga0207702_100011999 | 327 |
| 985 | 3300026078 | Ga0207702_10003037 | Ga0207702_100030377 | 327 |
| 986 | 3300026078 | Ga0207702_10055790 | Ga0207702_100557902 | 327 |
| 987 | 3300026078 | Ga0207702_10073539 | Ga0207702_100735395 | 327 |
| 988 | 3300026078 | Ga0207702_10099952 | Ga0207702_100999522 | 327 |
| 989 | 3300026078 | Ga0207702_10173363 | Ga0207702_101733631 | 327 |
| 990 | 3300026078 | Ga0207702_10222748 | Ga0207702_102227483 | 327 |
| 991 | 3300026078 | Ga0207702_10313036 | Ga0207702_103130361 | 327 |
| 992 | 3300026078 | Ga0207702_10396022 | Ga0207702_103960222 | 327 |
| 993 | 3300026078 | Ga0207702_10432168 | Ga0207702_104321681 | 327 |
| 994 | 3300026088 | Ga0207641_10000025 | Ga0207641_1000002537 | 327 |
| 995 | 3300026088 | Ga0207641_10008027 | Ga0207641_100080277 | 327 |
| 996 | 3300026088 | Ga0207641_10020912 | Ga0207641_100209123 | 327 |
| 997 | 3300026088 | Ga0207641_10059041 | Ga0207641_100590412 | 327 |
| 998 | 3300026089 | Ga0207648_10003458 | Ga0207648_100034586 | 327 |
| 999 | 3300026089 | Ga0207648_10047694 | Ga0207648_100476942 | 327 |
| 1000 | 3300026095 | Ga0207676_10000252 | Ga0207676_1000025232 | 327 |
| 1001 | 3300026095 | Ga0207676_10002695 | Ga0207676_1000269510 | 327 |
| 1002 | 3300026095 | Ga0207676_10008202 | Ga0207676_100082023 | 327 |
| 1003 | 3300026116 | Ga0207674_10000162 | Ga0207674_1000016227 | 327 |
| 1004 | 3300026116 | Ga0207674_10003030 | Ga0207674_100030302 | 327 |
| 1005 | 3300026116 | Ga0207674_10042580 | Ga0207674_100425803 | 327 |
| 1006 | 3300026116 | Ga0207674_10078029 | Ga0207674_100780294 | 327 |
| 1007 | 3300026116 | Ga0207674_10127467 | Ga0207674_101274672 | 327 |
| 1008 | 3300026116 | Ga0207674_10214815 | Ga0207674_102148152 | 327 |
| 1009 | 3300026118 | Ga0207675_100017450 | Ga0207675_1000174506 | 327 |
| 1010 | 3300026118 | Ga0207675_100078474 | Ga0207675_1000784742 | 327 |
| 1011 | 3300026121 | Ga0207683_10001306 | Ga0207683_1000130619 | 327 |
| 1012 | 3300026121 | Ga0207683_10083016 | Ga0207683_100830163 | 327 |
| 1013 | 3300026142 | Ga0207698_10029146 | Ga0207698_100291463 | 327 |
| 1014 | 3300028017 | Ga0265356_1000857 | Ga0265356_10008575 | 327 |
| 1015 | 3300028379 | Ga0268266_10010266 | Ga0268266_100102663 | 327 |
| 1016 | 3300028381 | Ga0268264_10025084 | Ga0268264_100250844 | 327 |
| 1017 | 3300028381 | Ga0268264_10050987 | Ga0268264_100509873 | 327 |
| 1018 | 3300028381 | Ga0268264_10063001 | Ga0268264_100630012 | 327 |
| 1019 | 3300028381 | Ga0268264_10307434 | Ga0268264_103074342 | 327 |
| 1020 | 3300028800 | Ga0265338_10024675 | Ga0265338_100246753 | 327 |
| 1021 | 3300028800 | Ga0265338_10148870 | Ga0265338_101488701 | 327 |
| 1022 | 3300028800 | Ga0265338_10196671 | Ga0265338_101966711 | 327 |
| 1023 | 3300030760 | Ga0265762_1001781 | Ga0265762_10017814 | 327 |
| 1024 | 3300031090 | Ga0265760_10002278 | Ga0265760_100022785 | 327 |
| 1025 | 3300031090 | Ga0265760_10002457 | Ga0265760_100024575 | 327 |
| 1026 | 3300031090 | Ga0265760_10018115 | Ga0265760_100181151 | 327 |
| 1027 | 3300031241 | Ga0265325_10025527 | Ga0265325_100255272 | 327 |
| 1028 | 3300031241 | Ga0265325_10047993 | Ga0265325_100479932 | 327 |
| 1029 | 3300031249 | Ga0265339_10018777 | Ga0265339_100187773 | 327 |
| 1030 | 3300031249 | Ga0265339_10019646 | Ga0265339_100196463 | 327 |
| 1031 | 3300031249 | Ga0265339_10159198 | Ga0265339_101591982 | 327 |
| 1032 | 3300031344 | Ga0265316_10041782 | Ga0265316_100417824 | 327 |
| 1033 | 3300031344 | Ga0265316_10048446 | Ga0265316_100484464 | 327 |
| 1034 | 3300031344 | Ga0265316_10113095 | Ga0265316_101130952 | 327 |
| 1035 | 3300031711 | Ga0265314_10004435 | Ga0265314_1000443514 | 327 |
| 1036 | 3300031711 | Ga0265314_10080937 | Ga0265314_100809372 | 327 |
| 1037 | 3300031711 | Ga0265314_10169979 | Ga0265314_101699791 | 327 |
| 1038 | 3300032002 | Ga0307416_100047412 | Ga0307416_1000474123 | 327 |
| 1039 | 3300035111 | Ga0373923_0090879 | Ga0373923_0090879_256_1254 | 327 |
| 1040 | 3300035116 | Ga0373945_0001313 | Ga0373945_0001313_3526_4521 | 327 |
| 1041 | 3300035119 | Ga0373956_0007158 | Ga0373956_0007158_3125_4120 | 327 |
| 1042 | 3300035119 | Ga0373956_0073444 | Ga0373956_0073444_329_1327 | 327 |
| 1043 | 3300035170 | Ga0373943_0016294 | Ga0373943_0016294_1069_2058 | 327 |
| 1044 | 3300035410 | Ga0373924_0000248 | Ga0373924_0000248_140_1135 | 327 |
| 1045 | 3300035691 | Ga0373931_0007410 | Ga0373931_0007410_2268_3263 | 327 |
| 1046 | 3300035691 | Ga0373931_0032147 | Ga0373931_0032147_1134_2123 | 327 |
| 1047 | 3300035691 | Ga0373931_0045293 | Ga0373931_0045293_202_1191 | 327 |
| 1048 | 3300035692 | Ga0373935_0003124 | Ga0373935_0003124_7995_8984 | 327 |
| 1049 | 3300035692 | Ga0373935_0010148 | Ga0373935_0010148_402_1397 | 327 |
| 1050 | 3300035692 | Ga0373935_0032320 | Ga0373935_0032320_1580_2569 | 327 |
| 1051 | 3300035695 | Ga0373927_0058122 | Ga0373927_0058122_165_1163 | 327 |
| 1052 | 3300035695 | Ga0373927_0078965 | Ga0373927_0078965_819_1808 | 327 |
| 1053 | 3300035695 | Ga0373927_0111053 | Ga0373927_0111053_109_1101 | 327 |
| 1054 | 3300035725 | Ga0373947_0017382 | Ga0373947_0017382_121_1110 | 327 |
| 1055 | 3300035725 | Ga0373947_0087873 | Ga0373947_0087873_805_1794 | 327 |
| 1056 | 3300036401 | Ga0373937_0000090 | Ga0373937_0000090_81620_82609 | 327 |
| 1057 | 3300036401 | Ga0373937_0049245 | Ga0373937_0049245_2631_3629 | 327 |
| 1058 | 3300036401 | Ga0373937_0076551 | Ga0373937_0076551_1616_2608 | 327 |
| 1059 | 3300036401 | Ga0373937_0440853 | Ga0373937_0440853_79_1074 | 327 |
| 1060 | 3300037068 | Ga0373925_0005732 | Ga0373925_0005732_4545_5543 | 327 |
| 1061 | 3300037068 | Ga0373925_0006084 | Ga0373925_0006084_7111_8100 | 327 |
| 1062 | 3300037068 | Ga0373925_0127295 | Ga0373925_0127295_231_1226 | 327 |
| 1063 | 3300037068 | Ga0373925_0226782 | Ga0373925_0226782_55_1044 | 327 |
| 1064 | 3300037466 | Ga0395898_0049727 | Ga0395898_0049727_3073_4065 | 327 |
| 1065 | 3300037471 | Ga0395905_0090299 | Ga0395905_0090299_329_1327 | 327 |
| 1066 | 3300037853 | Ga0436364_0366631 | Ga0436364_0366631_62_1057 | 327 |
| 1067 | 3300039450 | Ga0436363_0375979 | Ga0436363_0375979_986_1975 | 327 |
| 1068 | 3300039450 | Ga0436363_1252730 | Ga0436363_1252730_1245_2240 | 327 |
| 1069 | 3300039450 | Ga0436363_1383135 | Ga0436363_1383135_39_1034 | 327 |
| 1070 | 3300039450 | Ga0436363_1663027 | Ga0436363_1663027_129_1124 | 327 |
| 1071 | 3300039453 | Ga0436362_1104320 | Ga0436362_1104320_19_1014 | 327 |
| 1072 | 3300039453 | Ga0436362_1148430 | Ga0436362_1148430_5059_6054 | 327 |
| 1073 | 3300042876 | Ga0451577_0001555 | Ga0451577_0001555_28711_29700 | 327 |
| 1074 | 3300042876 | Ga0451577_0113458 | Ga0451577_0113458_477_1472 | 327 |
| 1075 | 3300044694 | Ga0466963_0005503 | Ga0466963_0005503_3693_4682 | 327 |
| 1076 | 3300044712 | Ga0453684_0000289 | Ga0453684_0000289_70898_71887 | 327 |
| 1077 | 3300044842 | Ga0466957_0095683 | Ga0466957_0095683_430_1419 | 327 |
| 1078 | 3300044842 | Ga0466957_0132345 | Ga0466957_0132345_539_1528 | 327 |
| 1079 | 3300045049 | Ga0466959_0033530 | Ga0466959_0033530_902_1891 | 327 |
| 1080 | 3300045049 | Ga0466959_0035415 | Ga0466959_0035415_2089_3084 | 327 |
| 1081 | 3300045051 | Ga0451576_0035560 | Ga0451576_0035560_256_1245 | 327 |
| 1082 | 3300045051 | Ga0451576_0420030 | Ga0451576_0420030_145_1140 | 327 |
| 1083 | 3300045836 | Ga0466958_0026948 | Ga0466958_0026948_1875_2864 | 327 |
| 1084 | 3300045836 | Ga0466958_0147300 | Ga0466958_0147300_167_1156 | 327 |
| 1085 | 3300045976 | Ga0466967_0055328 | Ga0466967_0055328_723_1712 | 327 |
| 1086 | 3300046472 | Ga0495580_0000354 | Ga0495580_0000354_17995_18987 | 327 |
| 1087 | 3300046472 | Ga0495580_0004478 | Ga0495580_0004478_4690_5679 | 327 |
| 1088 | 3300046472 | Ga0495580_0019736 | Ga0495580_0019736_3426_4421 | 327 |
| 1089 | 3300046472 | Ga0495580_0046482 | Ga0495580_0046482_885_1877 | 327 |
| 1090 | 3300046472 | Ga0495580_0051886 | Ga0495580_0051886_1861_2856 | 327 |
| 1091 | 3300046472 | Ga0495580_0078652 | Ga0495580_0078652_757_1746 | 327 |
| 1092 | 3300046499 | Ga0495594_0008908 | Ga0495594_0008908_2627_3625 | 327 |
| 1093 | 3300046517 | Ga0495630_0074146 | Ga0495630_0074146_1477_2466 | 327 |
| 1094 | 3300046526 | Ga0495666_0112078 | Ga0495666_0112078_125_1123 | 327 |
| 1095 | 3300046531 | Ga0495665_0014305 | Ga0495665_0014305_146_1138 | 327 |
| 1096 | 3300046678 | Ga0495599_0060721 | Ga0495599_0060721_1296_2291 | 327 |
| 1097 | 3300046679 | Ga0495623_0039822 | Ga0495623_0039822_1456_2445 | 327 |
| 1098 | 3300046683 | Ga0495658_0035332 | Ga0495658_0035332_1121_2119 | 327 |
| 1099 | 3300046809 | Ga0495600_0126297 | Ga0495600_0126297_268_1260 | 327 |
| 1100 | 3300047317 | Ga0495604_0028162 | Ga0495604_0028162_353_1342 | 327 |
| 1101 | 3300047319 | Ga0495674_0078187 | Ga0495674_0078187_141_1136 | 327 |
| 1102 | 3300047444 | Ga0495675_0090400 | Ga0495675_0090400_893_1885 | 327 |
| 1103 | 3300048089 | Ga0495614_0108478 | Ga0495614_0108478_128_1120 | 327 |
| 1104 | 3300048904 | Ga0496101_0057320 | Ga0496101_0057320_1124_2119 | 327 |
| 1105 | 3300048904 | Ga0496101_0109408 | Ga0496101_0109408_222_1205 | 327 |
| 1106 | 3300048904 | Ga0496101_0281897 | Ga0496101_0281897_178_1173 | 327 |
| 1107 | 3300048905 | Ga0496102_0002608 | Ga0496102_0002608_2113_3108 | 327 |
| 1108 | 3300048905 | Ga0496102_0026380 | Ga0496102_0026380_3064_4059 | 327 |
| 1109 | 3300048905 | Ga0496102_0028897 | Ga0496102_0028897_3324_4319 | 327 |
| 1110 | 3300048905 | Ga0496102_0042036 | Ga0496102_0042036_1893_2888 | 327 |
| 1111 | 3300048905 | Ga0496102_0107895 | Ga0496102_0107895_1251_2246 | 327 |
| 1112 | 3300048905 | Ga0496102_0224927 | Ga0496102_0224927_695_1684 | 327 |
| 1113 | 3300048906 | Ga0496103_0063905 | Ga0496103_0063905_1254_2249 | 327 |
| 1114 | 3300048907 | Ga0496104_0008792 | Ga0496104_0008792_1281_2276 | 327 |
| 1115 | 3300048907 | Ga0496104_0163570 | Ga0496104_0163570_306_1301 | 327 |
| 1116 | 3300048907 | Ga0496104_0326605 | Ga0496104_0326605_239_1228 | 327 |
| 1117 | 3300048907 | Ga0496104_0457469 | Ga0496104_0457469_84_1073 | 327 |
| 1118 | 3300048908 | Ga0496105_0000584 | Ga0496105_0000584_8501_9493 | 327 |
| 1119 | 3300048908 | Ga0496105_0053823 | Ga0496105_0053823_1273_2268 | 327 |
| 1120 | 3300048909 | Ga0496106_0085428 | Ga0496106_0085428_46_1041 | 327 |
| 1121 | 3300048909 | Ga0496106_0353486 | Ga0496106_0353486_29_1024 | 327 |
| 1122 | 3300048910 | Ga0496107_0139938 | Ga0496107_0139938_241_1236 | 327 |
| 1123 | 3300048911 | Ga0496108_0000203 | Ga0496108_0000203_37659_38642 | 327 |
| 1124 | 3300048911 | Ga0496108_0135570 | Ga0496108_0135570_571_1566 | 327 |
| 1125 | 3300048911 | Ga0496108_0306696 | Ga0496108_0306696_124_1119 | 327 |
| 1126 | 3300048912 | Ga0496109_0000228 | Ga0496109_0000228_49730_50713 | 327 |
| 1127 | 3300048913 | Ga0496110_0000145 | Ga0496110_0000145_29875_30858 | 327 |
| 1128 | 3300048913 | Ga0496110_0023501 | Ga0496110_0023501_1083_2078 | 327 |
| 1129 | 3300048913 | Ga0496110_0076017 | Ga0496110_0076017_1730_2725 | 327 |
| 1130 | 3300048913 | Ga0496110_0179781 | Ga0496110_0179781_587_1582 | 327 |
| 1131 | 3300048913 | Ga0496110_0479489 | Ga0496110_0479489_121_1116 | 327 |
| 1132 | 3300048914 | Ga0496111_0003439 | Ga0496111_0003439_1036_2031 | 327 |
| 1133 | 3300048914 | Ga0496111_0060610 | Ga0496111_0060610_425_1420 | 327 |
| 1134 | 3300048914 | Ga0496111_0187711 | Ga0496111_0187711_55_1050 | 327 |
| 1135 | 3300048915 | Ga0496112_0000048 | Ga0496112_0000048_49439_50422 | 327 |
| 1136 | 3300048915 | Ga0496112_0001123 | Ga0496112_0001123_16609_17604 | 327 |
| 1137 | 3300048915 | Ga0496112_0002435 | Ga0496112_0002435_2732_3721 | 327 |
| 1138 | 3300048915 | Ga0496112_0004578 | Ga0496112_0004578_2079_3074 | 327 |
| 1139 | 3300048915 | Ga0496112_0006190 | Ga0496112_0006190_5995_6990 | 327 |
| 1140 | 3300048915 | Ga0496112_0008072 | Ga0496112_0008072_1830_2825 | 327 |
| 1141 | 3300048915 | Ga0496112_0063880 | Ga0496112_0063880_1751_2740 | 327 |
| 1142 | 3300048916 | Ga0496113_0002647 | Ga0496113_0002647_8421_9416 | 327 |
| 1143 | 3300048918 | Ga0496115_0051371 | Ga0496115_0051371_1094_2083 | 327 |
| 1144 | 3300048918 | Ga0496115_0086899 | Ga0496115_0086899_418_1407 | 327 |
| 1145 | 3300048918 | Ga0496115_0357787 | Ga0496115_0357787_112_1107 | 327 |
| 1146 | 3300050507 | nmdc:mga05p37_98700_c1 | nmdc:mga05p37_98700_c1_2134_3129 | 327 |
| 1147 | 3300050512 | nmdc:mga0n895_22018_c1 | nmdc:mga0n895_22018_c1_973_1968 | 327 |
| 1148 | 3300050512 | nmdc:mga0n895_37706_c1 | nmdc:mga0n895_37706_c1_1257_2246 | 327 |
| 1149 | 3300050513 | nmdc:mga0rr50_2479_c1 | nmdc:mga0rr50_2479_c1_3056_4051 | 327 |
| 1150 | 3300050513 | nmdc:mga0rr50_52962_c1 | nmdc:mga0rr50_52962_c1_922_1917 | 327 |
| 1151 | 3300050513 | nmdc:mga0rr50_7501_c1 | nmdc:mga0rr50_7501_c1_4482_5471 | 327 |
| 1152 | 3300050514 | nmdc:mga08x19_1403_c1 | nmdc:mga08x19_1403_c1_2630_3619 | 327 |
| 1153 | 3300050514 | nmdc:mga08x19_18118_c1 | nmdc:mga08x19_18118_c1_3097_4092 | 327 |
| 1154 | 3300050515 | nmdc:mga0a205_57878_c1 | nmdc:mga0a205_57878_c1_308_1297 | 327 |
| 1155 | 3300053077 | Ga0495601_0004055 | Ga0495601_0004055_2511_3500 | 327 |
| 1156 | 3300053078 | Ga0495612_0025640 | Ga0495612_0025640_120_1115 | 327 |
| 1157 | 3300053078 | Ga0495612_0113032 | Ga0495612_0113032_144_1139 | 327 |
| 1158 | 3300054114 | Ga0501084_0055804 | Ga0501084_0055804_251_1246 | 327 |
| 1159 | 3300059492 | Ga0587073_0005958 | Ga0587073_0005958_818_1810 | 327 |
| 1160 | 3300059511 | Ga0587091_009615 | Ga0587091_009615_28_1020 | 327 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1o95-assembly1.cif.gz_F | ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein | 0.8811 | 1 | 193 |
| 1t9g-assembly1.cif.gz_R | structure of the human mcad:etf complex | 0.8739 | 1 | 193 |
| 1o95-assembly1.cif.gz_F | ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein | 0.8681 | 1 | 193 |
| 1t9g-assembly1.cif.gz_R | structure of the human mcad:etf complex | 0.8606 | 1 | 193 |
| 3ih5-assembly1.cif.gz_B | crystal structure of electron transfer flavoprotein alpha-subunit from bacteroides thetaiotaomicron | 0.8217 | 2 | 197 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WNG9_187_318_3.40.50.1220 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.97 | 204 | 327 | 3.40.50.1220 |
| af_P77378_184_312_3.40.50.1220 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9577 | 197 | 322 | 3.40.50.1220 |
| af_Q46907_159_286_3.40.50.1220 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9319 | 204 | 327 | 3.40.50.1220 |
| af_P77378_184_312_3.40.50.1220 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9291 | 197 | 322 | 3.40.50.1220 |
| af_P9WNG9_187_318_3.40.50.1220 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9058 | 204 | 327 | 3.40.50.1220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X0S2B0-F1-model_v4 | Electron transfer flavoprotein alpha subunit C-terminal domain-containing protein | 0.9809 | 204 | 326 |
GO:0009055
GO:0033539 GO:0050660 |
| AF-A0A382AUL2-F1-model_v4 | Electron transfer flavoprotein alpha/beta-subunit N-terminal domain-containing protein | 0.977 | 1 | 176 |
GO:0009055
GO:0033539 GO:0050660 |
| AF-A0A2N2ZBZ4-F1-model_v4 | Electron transfer flavoprotein subunit alpha | 0.9748 | 214 | 326 |
GO:0009055
GO:0033539 GO:0050660 |
| AF-A0A1C5DSN9-F1-model_v4 | Electron transfer flavoprotein alpha subunit apoprotein | 0.9739 | 203 | 327 |
GO:0009055
GO:0033539 GO:0050660 |
| AF-S7U661-F1-model_v4 | Electron transfer flavoprotein alpha subunit | 0.9738 | 219 | 325 |
GO:0009055
GO:0033539 GO:0050660 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar