F490990

General Info

Members Datasets Scaffolds Average Seq Length
1160 353 1160 326

Family's Representative Sequence

Representative Sequence 3300026078|Ga0207702_10173363|Ga0207702_101733631
Length 349
Sequence VRTPSYAGLHGWAKKADNMPDTILVVVEQREGKLNRVSWETITAGQAIAAATGWSLEAAVVGSGVNSIASEVAGKKVAKVYDIESPKLEPYTPDALAAGLKQFLESRQPKLVLMPHTYQVRDFVPKLATAMGRTVISDCIGFQHEGGKLVFTRQMFQGKLAADVSFTSDAPWFVTFQNGAFRGDKAEAGAAAAAVETVNVEIADGVIRNKPQEVFKEAKQAVDLTQAEIIVAVGRGIKEQKNIEIAKNLADALGGDLAASRPICDSGWLPMDRQIGSSGQTVAPKLYLALGISGAIQHIVGMKGSRAIIAVNKDSEAPIFEIADYAVVGNLFDIVPPLIEEVKKVKAGG

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
135 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
136 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
137 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
139 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
140 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
205 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
208 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
209 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
210 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
213 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
217 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
218 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
222 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
223 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
224 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
225 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
228 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
229 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
230 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
231 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
235 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
240 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
241 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
242 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
243 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
244 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
245 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
246 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
247 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
248 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
249 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
250 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
251 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
252 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
253 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
254 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
255 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
262 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
263 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
271 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
272 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
273 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
282 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
283 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
284 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
285 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
286 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
287 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
288 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
289 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
290 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
294 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
319 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
320 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
321 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
322 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
323 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
324 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
325 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
326 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
327 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
328 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
329 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
330 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
333 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
334 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
335 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
336 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
337 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
338 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
339 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
340 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
341 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
342 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
343 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
344 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
345 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
346 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
347 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
348 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
349 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
350 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
353 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 1.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 4.91
Rhizosphere 94.05
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_175413 2162886012 Bacteria 1632
2 JGI24752J21851_1001100 3300001976 Bacteria 3706
3 JGI24743J22301_10004790 3300001991 Bacteria 2224
4 JGI24034J26672_10002560 3300002239 Unclassified 2500
5 JGI24751J29686_10000704 3300002459 Bacteria 8154
6 JGI25406J46586_10006285 3300003203 Bacteria 5480
7 rootL2_10275660 3300003322 Bacteria 2715
8 Ga0058863_10071160 3300004799 Bacteria 3018
9 Ga0058861_10063203 3300004800 Bacteria 2565
10 Ga0058862_12859213 3300004803 Bacteria 3198
11 Ga0065712_10086452 3300005290 Bacteria 2601
12 Ga0065707_10004371 3300005295 Bacteria 3617
13 Ga0070658_10026605 3300005327 Unclassified 4642
14 Ga0070658_10200115 3300005327 Unclassified 1685
15 Ga0070676_10283478 3300005328 Bacteria 1117
16 Ga0070683_100014673 3300005329 Bacteria 6862
17 Ga0070683_100035951 3300005329 Bacteria 4531
18 Ga0070683_100049622 3300005329 Bacteria 3883
19 Ga0070683_100073338 3300005329 Unclassified 3196
20 Ga0070690_100136925 3300005330 Bacteria 1659
21 Ga0070670_100017910 3300005331 Bacteria 6081
22 Ga0070670_100028745 3300005331 Bacteria 4786
23 Ga0070670_100185509 3300005331 Bacteria 1806
24 Ga0070670_100219703 3300005331 Bacteria 1653
25 Ga0068869_100002638 3300005334 Bacteria 10837
26 Ga0068869_100011661 3300005334 Bacteria 5774
27 Ga0068869_100108457 3300005334 Bacteria 2109
28 Ga0068869_100270622 3300005334 Bacteria 1363
29 Ga0070666_10062094 3300005335 Unclassified 2530
30 Ga0070680_100002009 3300005336 Bacteria 14989
31 Ga0070680_100045686 3300005336 Bacteria 3561
32 Ga0070682_100009784 3300005337 Bacteria 5428
33 Ga0070682_100026601 3300005337 Bacteria 3464
34 Ga0070682_100188497 3300005337 Unclassified 1446
35 Ga0068868_100001549 3300005338 Bacteria 15707
36 Ga0068868_100002221 3300005338 Bacteria 13412
37 Ga0068868_100005847 3300005338 Bacteria 8671
38 Ga0068868_100026930 3300005338 Bacteria 4383
39 Ga0068868_100041733 3300005338 Bacteria 3575
40 Ga0068868_100049830 3300005338 Unclassified 3287
41 Ga0070660_100108420 3300005339 Unclassified 2207
42 Ga0070660_100116335 3300005339 Bacteria 2132
43 Ga0070689_100001794 3300005340 Bacteria 13790
44 Ga0070689_100211075 3300005340 Bacteria 1589
45 Ga0070689_100255251 3300005340 Bacteria 1448
46 Ga0070689_100316094 3300005340 Bacteria 1303
47 Ga0070689_100378163 3300005340 Bacteria 1193
48 Ga0070687_100124473 3300005343 Bacteria 1479
49 Ga0070687_100170452 3300005343 Bacteria 1295
50 Ga0070661_100005410 3300005344 Bacteria 8804
51 Ga0070661_100023061 3300005344 Unclassified 4460
52 Ga0070661_100051750 3300005344 Unclassified 3006
53 Ga0070668_100379771 3300005347 Bacteria 1202
54 Ga0070669_100026243 3300005353 Bacteria 4190
55 Ga0070669_100084244 3300005353 Unclassified 2372
56 Ga0070675_100000540 3300005354 Bacteria 25910
57 Ga0070675_100119228 3300005354 Bacteria 2241
58 Ga0070675_100306670 3300005354 Bacteria 1400
59 Ga0070675_100334793 3300005354 Bacteria 1340
60 Ga0070671_100263159 3300005355 Unclassified 1466
61 Ga0070671_100444554 3300005355 Bacteria 1112
62 Ga0070674_100014116 3300005356 Bacteria 4959
63 Ga0070673_100017192 3300005364 Bacteria 5135
64 Ga0070688_100039145 3300005365 Unclassified 2900
65 Ga0070659_100060263 3300005366 Unclassified 2997
66 Ga0070659_100311291 3300005366 Bacteria 1315
67 Ga0070667_100024129 3300005367 Bacteria 5050
68 Ga0070709_10000305 3300005434 Bacteria 31117
69 Ga0070709_10012180 3300005434 Unclassified 4809
70 Ga0070709_10019978 3300005434 Unclassified 3882
71 Ga0070709_10038707 3300005434 Bacteria 2922
72 Ga0070709_10080178 3300005434 Unclassified 2128
73 Ga0070709_10113547 3300005434 Unclassified 1824
74 Ga0070709_10136093 3300005434 Bacteria 1683
75 Ga0070709_10178317 3300005434 Bacteria 1490
76 Ga0070714_100000183 3300005435 Bacteria 49970
77 Ga0070714_100026899 3300005435 Unclassified 4758
78 Ga0070714_100076345 3300005435 Unclassified 2909
79 Ga0070714_100121156 3300005435 Bacteria 2327
80 Ga0070714_100136572 3300005435 Bacteria 2197
81 Ga0070714_100210082 3300005435 Bacteria 1784
82 Ga0070714_100238223 3300005435 Bacteria 1679
83 Ga0070714_100249898 3300005435 Unclassified 1639
84 Ga0070714_100366743 3300005435 Unclassified 1355
85 Ga0070713_100000922 3300005436 Bacteria 18743
86 Ga0070713_100005356 3300005436 Bacteria 8760
87 Ga0070713_100007574 3300005436 Bacteria 7632
88 Ga0070713_100008454 3300005436 Bacteria 7301
89 Ga0070713_100009238 3300005436 Bacteria 7041
90 Ga0070713_100028090 3300005436 Bacteria 4439
91 Ga0070713_100058345 3300005436 Unclassified 3219
92 Ga0070713_100082674 3300005436 Unclassified 2743
93 Ga0070713_100098069 3300005436 Bacteria 2533
94 Ga0070713_100106406 3300005436 Unclassified 2438
95 Ga0070713_100110831 3300005436 Bacteria 2392
96 Ga0070713_100172013 3300005436 Bacteria 1941
97 Ga0070713_100192653 3300005436 Bacteria 1838
98 Ga0070713_100302161 3300005436 Unclassified 1473
99 Ga0070710_10043572 3300005437 Bacteria 2486
100 Ga0070710_10043877 3300005437 Unclassified 2479
101 Ga0070710_10149788 3300005437 Bacteria 1438
102 Ga0070701_10123076 3300005438 Bacteria 1464
103 Ga0070711_100001220 3300005439 Bacteria 13868
104 Ga0070711_100010822 3300005439 Bacteria 5656
105 Ga0070711_100016954 3300005439 Bacteria 4632
106 Ga0070711_100068847 3300005439 Bacteria 2488
107 Ga0070711_100110863 3300005439 Unclassified 2014
108 Ga0070711_100112889 3300005439 Bacteria 1997
109 Ga0070711_100113762 3300005439 Bacteria 1990
110 Ga0070711_100135456 3300005439 Unclassified 1840
111 Ga0070711_100423185 3300005439 Unclassified 1086
112 Ga0070694_100001871 3300005444 Bacteria 12458
113 Ga0070708_100000848 3300005445 Bacteria 23002
114 Ga0070708_100002910 3300005445 Bacteria 13306
115 Ga0070708_100009912 3300005445 Bacteria 7700
116 Ga0070708_100011561 3300005445 Bacteria 7186
117 Ga0070708_100039959 3300005445 Unclassified 4107
118 Ga0070708_100048892 3300005445 Bacteria 3741
119 Ga0070708_100079355 3300005445 Unclassified 2969
120 Ga0070663_100062859 3300005455 Unclassified 2678
121 Ga0070663_100407052 3300005455 Bacteria 1113
122 Ga0070678_100031915 3300005456 Unclassified 3639
123 Ga0070678_100075469 3300005456 Unclassified 2536
124 Ga0070678_100304677 3300005456 Bacteria 1355
125 Ga0070662_100008886 3300005457 Bacteria 6550
126 Ga0070662_100018694 3300005457 Bacteria 4692
127 Ga0070662_100253760 3300005457 Bacteria 1415
128 Ga0070681_10000692 3300005458 Bacteria 27984
129 Ga0070681_10005994 3300005458 Bacteria 11779
130 Ga0070681_10008099 3300005458 Bacteria 10281
131 Ga0070681_10021208 3300005458 Bacteria 6510
132 Ga0070681_10028494 3300005458 Bacteria 5615
133 Ga0070681_10035282 3300005458 Bacteria 5025
134 Ga0070681_10055803 3300005458 Bacteria 3932
135 Ga0070681_10058881 3300005458 Bacteria 3821
136 Ga0070681_10075687 3300005458 Unclassified 3326
137 Ga0070681_10111730 3300005458 Unclassified 2671
138 Ga0070681_10149409 3300005458 Bacteria 2264
139 Ga0070681_10165457 3300005458 Bacteria 2134
140 Ga0070681_10176878 3300005458 Bacteria 2056
141 Ga0070681_10304639 3300005458 Bacteria 1503
142 Ga0070681_10368853 3300005458 Bacteria 1346
143 Ga0070681_10539954 3300005458 Bacteria 1079
144 Ga0068867_100008095 3300005459 Bacteria 7429
145 Ga0068867_100125831 3300005459 Unclassified 1986
146 Ga0070706_100000381 3300005467 Bacteria 53192
147 Ga0070706_100000609 3300005467 Bacteria 41393
148 Ga0070706_100006382 3300005467 Bacteria 11139
149 Ga0070706_100027489 3300005467 Bacteria 5236
150 Ga0070706_100027595 3300005467 Bacteria 5225
151 Ga0070706_100061794 3300005467 Bacteria 3460
152 Ga0070706_100086089 3300005467 Unclassified 2912
153 Ga0070707_100000144 3300005468 Bacteria 67480
154 Ga0070707_100018379 3300005468 Bacteria 6577
155 Ga0070707_100054792 3300005468 Bacteria 3824
156 Ga0070707_100087255 3300005468 Bacteria 3018
157 Ga0070707_100299150 3300005468 Bacteria 1564
158 Ga0070698_100000015 3300005471 Bacteria 111813
159 Ga0070698_100000903 3300005471 Bacteria 32615
160 Ga0070698_100037349 3300005471 Bacteria 5009
161 Ga0070698_100176144 3300005471 Unclassified 2078
162 Ga0070699_100045650 3300005518 Unclassified 3792
163 Ga0070699_100195385 3300005518 Bacteria 1798
164 Ga0070699_100286249 3300005518 Bacteria 1477
165 Ga0070679_100009060 3300005530 Bacteria 9390
166 Ga0070679_100017685 3300005530 Bacteria 6901
167 Ga0070679_100036410 3300005530 Unclassified 4882
168 Ga0070679_100041797 3300005530 Bacteria 4563
169 Ga0070679_100049113 3300005530 Bacteria 4202
170 Ga0070679_100059047 3300005530 Bacteria 3823
171 Ga0070679_100068243 3300005530 Bacteria 3547
172 Ga0070679_100157163 3300005530 Unclassified 2248
173 Ga0070684_100002625 3300005535 Bacteria 13279
174 Ga0070684_100002682 3300005535 Bacteria 13145
175 Ga0070684_100007916 3300005535 Bacteria 8294
176 Ga0070684_100016155 3300005535 Bacteria 6099
177 Ga0070684_100042699 3300005535 Bacteria 3915
178 Ga0070684_100054714 3300005535 Bacteria 3477
179 Ga0070684_100127298 3300005535 Unclassified 2295
180 Ga0070684_100168906 3300005535 Bacteria 1986
181 Ga0070684_100176690 3300005535 Bacteria 1940
182 Ga0070697_100000195 3300005536 Bacteria 49351
183 Ga0070697_100001021 3300005536 Bacteria 21127
184 Ga0070697_100003101 3300005536 Bacteria 12771
185 Ga0070697_100006153 3300005536 Bacteria 9286
186 Ga0070697_100010873 3300005536 Bacteria 7108
187 Ga0070697_100026144 3300005536 Unclassified 4659
188 Ga0070697_100032232 3300005536 Bacteria 4216
189 Ga0070697_100086122 3300005536 Bacteria 2592
190 Ga0070697_100118316 3300005536 Unclassified 2214
191 Ga0068853_100004456 3300005539 Bacteria 10852
192 Ga0068853_100016340 3300005539 Bacteria 6106
193 Ga0068853_100051674 3300005539 Unclassified 3538
194 Ga0068853_100071730 3300005539 Bacteria 3017
195 Ga0068853_100093359 3300005539 Bacteria 2649
196 Ga0070672_100041331 3300005543 Bacteria 3544
197 Ga0070686_100022493 3300005544 Unclassified 3755
198 Ga0070686_100104806 3300005544 Unclassified 1916
199 Ga0070695_100070485 3300005545 Unclassified 2287
200 Ga0070696_100011056 3300005546 Bacteria 6043
201 Ga0070696_100167415 3300005546 Bacteria 1623
202 Ga0070693_100008703 3300005547 Bacteria 5021
203 Ga0070665_100027509 3300005548 Bacteria 5728
204 Ga0070665_100590653 3300005548 Bacteria 1123
205 Ga0068855_100001490 3300005563 Bacteria 29300
206 Ga0068855_100002064 3300005563 Bacteria 24891
207 Ga0068855_100004921 3300005563 Bacteria 16303
208 Ga0068855_100013622 3300005563 Bacteria 9806
209 Ga0068855_100020077 3300005563 Bacteria 8024
210 Ga0068855_100055057 3300005563 Bacteria 4673
211 Ga0068855_100108486 3300005563 Bacteria 3189
212 Ga0068855_100337298 3300005563 Bacteria 1663
213 Ga0068855_100368240 3300005563 Bacteria 1580
214 Ga0068855_100612017 3300005563 Bacteria 1174
215 Ga0070664_100017492 3300005564 Bacteria 5887
216 Ga0070664_100106944 3300005564 Bacteria 2438
217 Ga0070664_100147243 3300005564 Unclassified 2077
218 Ga0068857_100001030 3300005577 Bacteria 21530
219 Ga0068857_100003337 3300005577 Bacteria 13362
220 Ga0068857_100096591 3300005577 Unclassified 2648
221 Ga0068857_100215307 3300005577 Unclassified 1753
222 Ga0068857_100239962 3300005577 Bacteria 1659
223 Ga0068854_100004220 3300005578 Bacteria 9046
224 Ga0068854_100012031 3300005578 Bacteria 5656
225 Ga0068854_100123985 3300005578 Bacteria 1965
226 Ga0068856_100000065 3300005614 Bacteria 98683
227 Ga0068856_100000989 3300005614 Bacteria 30332
228 Ga0068856_100002496 3300005614 Bacteria 18932
229 Ga0068856_100012096 3300005614 Bacteria 8359
230 Ga0068856_100023046 3300005614 Bacteria 6054
231 Ga0068856_100028145 3300005614 Bacteria 5485
232 Ga0068856_100052234 3300005614 Bacteria 4030
233 Ga0068856_100057605 3300005614 Unclassified 3836
234 Ga0068856_100120678 3300005614 Bacteria 2623
235 Ga0068856_100158414 3300005614 Bacteria 2274
236 Ga0068856_100220034 3300005614 Bacteria 1914
237 Ga0068856_100477087 3300005614 Bacteria 1268
238 Ga0070702_100009321 3300005615 Bacteria 4801
239 Ga0068852_100052092 3300005616 Unclassified 3516
240 Ga0068852_100102856 3300005616 Bacteria 2582
241 Ga0068859_100000939 3300005617 Bacteria 29832
242 Ga0068859_100005531 3300005617 Bacteria 12867
243 Ga0068859_100162576 3300005617 Bacteria 2312
244 Ga0068859_100244109 3300005617 Bacteria 1885
245 Ga0068859_100417281 3300005617 Bacteria 1438
246 Ga0068864_100000369 3300005618 Bacteria 39200
247 Ga0068864_100008228 3300005618 Bacteria 8603
248 Ga0068864_100032790 3300005618 Unclassified 4415
249 Ga0068864_100198148 3300005618 Unclassified 1844
250 Ga0068864_100243346 3300005618 Bacteria 1667
251 Ga0068866_10003414 3300005718 Bacteria 6511
252 Ga0068866_10009998 3300005718 Unclassified 4052
253 Ga0068866_10149758 3300005718 Bacteria 1350
254 Ga0068861_100009849 3300005719 Bacteria 6609
255 Ga0068861_100172783 3300005719 Bacteria 1792
256 Ga0068861_100360143 3300005719 Bacteria 1279
257 Ga0068851_10005710 3300005834 Bacteria 5658
258 Ga0068870_10000935 3300005840 Bacteria 11452
259 Ga0068863_100006532 3300005841 Bacteria 11443
260 Ga0068863_100023970 3300005841 Bacteria 5823
261 Ga0068863_100050601 3300005841 Bacteria 3938
262 Ga0068863_100160860 3300005841 Bacteria 2151
263 Ga0068858_100002175 3300005842 Bacteria 19870
264 Ga0068858_100005150 3300005842 Bacteria 12810
265 Ga0068858_100024408 3300005842 Bacteria 5633
266 Ga0068858_100027668 3300005842 Bacteria 5268
267 Ga0068858_100078685 3300005842 Bacteria 3064
268 Ga0068860_100061945 3300005843 Bacteria 3555
269 Ga0068860_100065633 3300005843 Unclassified 3446
270 Ga0068860_100091141 3300005843 Bacteria 2904
271 Ga0068860_100110187 3300005843 Bacteria 2631
272 Ga0068860_100170019 3300005843 Bacteria 2105
273 Ga0068860_100355061 3300005843 Bacteria 1443
274 Ga0068860_100488859 3300005843 Bacteria 1227
275 Ga0068862_100015615 3300005844 Bacteria 6308
276 Ga0068862_100024780 3300005844 Bacteria 5034
277 Ga0081455_10008282 3300005937 Bacteria 10834
278 Ga0081455_10301905 3300005937 Bacteria 1148
279 Ga0081540_1026668 3300005983 Unclassified 3291
280 Ga0081539_10001175 3300005985 Bacteria 47406
281 Ga0070717_10001830 3300006028 Bacteria 14861
282 Ga0070717_10002609 3300006028 Bacteria 12710
283 Ga0070717_10004387 3300006028 Bacteria 10182
284 Ga0070717_10007529 3300006028 Bacteria 8089
285 Ga0070717_10016823 3300006028 Bacteria 5676
286 Ga0070717_10035619 3300006028 Bacteria 4031
287 Ga0070717_10047746 3300006028 Bacteria 3509
288 Ga0070717_10061452 3300006028 Bacteria 3113
289 Ga0070717_10111940 3300006028 Bacteria 2329
290 Ga0070717_10165616 3300006028 Bacteria 1920
291 Ga0070717_10216772 3300006028 Bacteria 1681
292 Ga0070717_10224788 3300006028 Bacteria 1651
293 Ga0070715_10005347 3300006163 Unclassified 4276
294 Ga0070715_10018053 3300006163 Bacteria 2682
295 Ga0070715_10032661 3300006163 Bacteria 2122
296 Ga0070716_100008843 3300006173 Bacteria 5004
297 Ga0070716_100082439 3300006173 Bacteria 1923
298 Ga0070712_100001229 3300006175 Bacteria 15482
299 Ga0070712_100005202 3300006175 Bacteria 8045
300 Ga0070712_100006553 3300006175 Bacteria 7226
301 Ga0070712_100006918 3300006175 Bacteria 7067
302 Ga0070712_100007031 3300006175 Bacteria 7015
303 Ga0070712_100010851 3300006175 Bacteria 5761
304 Ga0070712_100015260 3300006175 Bacteria 4941
305 Ga0070712_100191397 3300006175 Bacteria 1601
306 Ga0097621_100000034 3300006237 Bacteria 69159
307 Ga0097621_100000908 3300006237 Bacteria 20694
308 Ga0097621_100010855 3300006237 Bacteria 6684
309 Ga0097621_100039276 3300006237 Bacteria 3801
310 Ga0097621_100049009 3300006237 Bacteria 3430
311 Ga0097621_100049426 3300006237 Unclassified 3416
312 Ga0097621_100076264 3300006237 Bacteria 2781
313 Ga0097621_100247316 3300006237 Bacteria 1561
314 Ga0097621_100444465 3300006237 Unclassified 1167
315 Ga0068871_100000233 3300006358 Bacteria 39441
316 Ga0068871_100000444 3300006358 Bacteria 28514
317 Ga0068871_100003756 3300006358 Bacteria 10457
318 Ga0068871_100005759 3300006358 Bacteria 8700
319 Ga0068871_100009308 3300006358 Bacteria 7110
320 Ga0068871_100080692 3300006358 Bacteria 2694
321 Ga0068871_100091447 3300006358 Bacteria 2536
322 Ga0068871_100252942 3300006358 Unclassified 1535
323 Ga0075428_100000607 3300006844 Bacteria 36552
324 Ga0075428_100069652 3300006844 Bacteria 3845
325 Ga0075428_100131714 3300006844 Bacteria 2719
326 Ga0075428_100224083 3300006844 Bacteria 2030
327 Ga0075431_100017181 3300006847 Bacteria 7352
328 Ga0075431_100120429 3300006847 Bacteria 2708
329 Ga0075431_100130750 3300006847 Bacteria 2589
330 Ga0075431_100210048 3300006847 Bacteria 1989
331 Ga0075431_100227038 3300006847 Bacteria 1903
332 Ga0075431_100303010 3300006847 Bacteria 1614
333 Ga0075433_10149908 3300006852 Bacteria 2074
334 Ga0075433_10171943 3300006852 Bacteria 1928
335 Ga0075434_100001079 3300006871 Bacteria 22322
336 Ga0075434_100038540 3300006871 Bacteria 4733
337 Ga0075434_100147812 3300006871 Bacteria 2370
338 Ga0075434_100188356 3300006871 Bacteria 2083
339 Ga0068865_100002230 3300006881 Bacteria 11411
340 Ga0068865_100006642 3300006881 Bacteria 7077
341 Ga0068865_100044236 3300006881 Unclassified 3047
342 Ga0075436_100001547 3300006914 Bacteria 15710
343 Ga0075436_100003577 3300006914 Bacteria 10648
344 Ga0075436_100006024 3300006914 Bacteria 8324
345 Ga0075436_100007392 3300006914 Bacteria 7513
346 Ga0075436_100080970 3300006914 Unclassified 2251
347 Ga0075436_100142659 3300006914 Bacteria 1684
348 Ga0097620_100000939 3300006931 Bacteria 29832
349 Ga0097620_100005531 3300006931 Bacteria 12867
350 Ga0097620_100162582 3300006931 Bacteria 2312
351 Ga0097620_100244113 3300006931 Bacteria 1885
352 Ga0097620_100417257 3300006931 Bacteria 1438
353 Ga0075435_100010144 3300007076 Bacteria 6879
354 Ga0099794_10144830 3300007265 Bacteria 1204
355 Ga0105251_10100663 3300009011 Unclassified 1321
356 Ga0105250_10009360 3300009092 Bacteria 4130
357 Ga0105240_10000161 3300009093 Bacteria 137359
358 Ga0105240_10006455 3300009093 Bacteria 17235
359 Ga0105240_10034509 3300009093 Bacteria 6525
360 Ga0105240_10065144 3300009093 Bacteria 4524
361 Ga0105240_10116022 3300009093 Bacteria 3231
362 Ga0105240_10128678 3300009093 Bacteria 3040
363 Ga0105240_10152642 3300009093 Unclassified 2749
364 Ga0105240_10206913 3300009093 Bacteria 2296
365 Ga0105240_10239535 3300009093 Bacteria 2104
366 Ga0105240_10322798 3300009093 Bacteria 1759
367 Ga0105240_10338304 3300009093 Bacteria 1710
368 Ga0105240_10735834 3300009093 Bacteria 1073
369 Ga0111539_10000455 3300009094 Bacteria 51281
370 Ga0111539_10026226 3300009094 Bacteria 7130
371 Ga0111539_10036740 3300009094 Bacteria 5919
372 Ga0111539_10060226 3300009094 Bacteria 4499
373 Ga0111539_10147796 3300009094 Bacteria 2751
374 Ga0111539_10214441 3300009094 Bacteria 2243
375 Ga0111539_10442945 3300009094 Bacteria 1512
376 Ga0105245_10000624 3300009098 Bacteria 32143
377 Ga0105245_10007043 3300009098 Bacteria 9863
378 Ga0105245_10041692 3300009098 Bacteria 4092
379 Ga0105245_10058681 3300009098 Bacteria 3464
380 Ga0105245_10083479 3300009098 Unclassified 2925
381 Ga0105245_10101680 3300009098 Bacteria 2661
382 Ga0105245_10281561 3300009098 Bacteria 1625
383 Ga0105247_10001507 3300009101 Bacteria 16650
384 Ga0105247_10024056 3300009101 Bacteria 3668
385 Ga0105247_10089205 3300009101 Bacteria 1955
386 Ga0105247_10093622 3300009101 Bacteria 1910
387 Ga0114129_10004180 3300009147 Bacteria 20396
388 Ga0114129_10235763 3300009147 Bacteria 2462
389 Ga0105243_10439729 3300009148 Bacteria 1221
390 Ga0105241_10002126 3300009174 Bacteria 14978
391 Ga0105241_10025623 3300009174 Bacteria 4384
392 Ga0105241_10117677 3300009174 Unclassified 2136
393 Ga0105241_10154538 3300009174 Bacteria 1880
394 Ga0105242_10016443 3300009176 Bacteria 5752
395 Ga0105242_10053867 3300009176 Bacteria 3286
396 Ga0105242_10099580 3300009176 Unclassified 2460
397 Ga0105242_10115686 3300009176 Bacteria 2293
398 Ga0105242_10188353 3300009176 Bacteria 1825
399 Ga0105242_10376543 3300009176 Unclassified 1318
400 Ga0105248_10005836 3300009177 Bacteria 13532
401 Ga0105248_10072101 3300009177 Unclassified 3882
402 Ga0105248_10081845 3300009177 Bacteria 3630
403 Ga0105248_10091853 3300009177 Unclassified 3419
404 Ga0105248_10112311 3300009177 Bacteria 3073
405 Ga0105248_10270875 3300009177 Bacteria 1912
406 Ga0105237_10008538 3300009545 Bacteria 11072
407 Ga0105237_10019697 3300009545 Bacteria 6965
408 Ga0105237_10029884 3300009545 Bacteria 5535
409 Ga0105237_10151073 3300009545 Bacteria 2319
410 Ga0105237_10164956 3300009545 Bacteria 2214
411 Ga0105238_10000464 3300009551 Bacteria 42663
412 Ga0105238_10016655 3300009551 Bacteria 7446
413 Ga0105238_10049855 3300009551 Bacteria 4215
414 Ga0105238_10091729 3300009551 Bacteria 3025
415 Ga0105238_10155748 3300009551 Bacteria 2260
416 Ga0105238_10200457 3300009551 Unclassified 1971
417 Ga0105249_10004737 3300009553 Bacteria 11742
418 Ga0105249_10090776 3300009553 Bacteria 2857
419 Ga0105249_10100646 3300009553 Bacteria 2718
420 Ga0105249_10406595 3300009553 Bacteria 1393
421 Ga0105239_10053632 3300010375 Bacteria 4422
422 Ga0105239_10054173 3300010375 Bacteria 4399
423 Ga0105239_10086301 3300010375 Bacteria 3459
424 Ga0105239_10248862 3300010375 Unclassified 1996
425 Ga0105246_10001854 3300011119 Bacteria 12705
426 Ga0105246_10034407 3300011119 Unclassified 3376
427 Ga0105246_10070999 3300011119 Bacteria 2451
428 Ga0157373_10001119 3300013100 Bacteria 20585
429 Ga0157373_10017190 3300013100 Bacteria 5267
430 Ga0157373_10043524 3300013100 Unclassified 3207
431 Ga0157373_10049631 3300013100 Bacteria 2990
432 Ga0157373_10058555 3300013100 Unclassified 2731
433 Ga0157373_10177962 3300013100 Bacteria 1497
434 Ga0157371_10012556 3300013102 Bacteria 6470
435 Ga0157371_10013207 3300013102 Bacteria 6286
436 Ga0157370_10016231 3300013104 Bacteria 7545
437 Ga0157370_10158393 3300013104 Bacteria 2107
438 Ga0157370_10289527 3300013104 Bacteria 1513
439 Ga0157370_10469306 3300013104 Bacteria 1157
440 Ga0157369_10000264 3300013105 Bacteria 70855
441 Ga0157369_10010181 3300013105 Bacteria 10729
442 Ga0157369_10014322 3300013105 Bacteria 8957
443 Ga0157369_10078699 3300013105 Bacteria 3532
444 Ga0157369_10102065 3300013105 Bacteria 3057
445 Ga0157369_10150938 3300013105 Unclassified 2455
446 Ga0157369_10225621 3300013105 Bacteria 1960
447 Ga0157369_10256053 3300013105 Bacteria 1826
448 Ga0157369_10284298 3300013105 Bacteria 1722
449 Ga0157369_10354439 3300013105 Bacteria 1524
450 Ga0157369_10362392 3300013105 Bacteria 1505
451 Ga0157369_10365070 3300013105 Bacteria 1499
452 Ga0157369_10418488 3300013105 Bacteria 1389
453 Ga0157374_10000249 3300013296 Bacteria 49808
454 Ga0157374_10000496 3300013296 Bacteria 35685
455 Ga0157374_10001107 3300013296 Bacteria 23202
456 Ga0157374_10005920 3300013296 Bacteria 10330
457 Ga0157374_10024491 3300013296 Bacteria 5412
458 Ga0157374_10033131 3300013296 Bacteria 4712
459 Ga0157374_10078774 3300013296 Bacteria 3121
460 Ga0157374_10088066 3300013296 Bacteria 2956
461 Ga0157374_10125558 3300013296 Bacteria 2480
462 Ga0157374_10229305 3300013296 Bacteria 1824
463 Ga0157378_10000008 3300013297 Bacteria 162605
464 Ga0157378_10000145 3300013297 Bacteria 66719
465 Ga0157378_10002765 3300013297 Bacteria 15636
466 Ga0157378_10003358 3300013297 Bacteria 14239
467 Ga0157378_10045872 3300013297 Bacteria 3884
468 Ga0157378_10093841 3300013297 Unclassified 2732
469 Ga0157378_10124723 3300013297 Bacteria 2378
470 Ga0157378_10255933 3300013297 Unclassified 1678
471 Ga0163162_10000777 3300013306 Bacteria 29697
472 Ga0163162_10024543 3300013306 Bacteria 5952
473 Ga0163162_10092330 3300013306 Bacteria 3111
474 Ga0163162_10145019 3300013306 Bacteria 2490
475 Ga0163162_10288342 3300013306 Bacteria 1773
476 Ga0157372_10000436 3300013307 Bacteria 45959
477 Ga0157372_10000611 3300013307 Bacteria 39068
478 Ga0157372_10001696 3300013307 Bacteria 23852
479 Ga0157372_10004250 3300013307 Bacteria 15312
480 Ga0157372_10008298 3300013307 Bacteria 11043
481 Ga0157372_10019394 3300013307 Bacteria 7330
482 Ga0157372_10049516 3300013307 Bacteria 4671
483 Ga0157372_10065331 3300013307 Bacteria 4084
484 Ga0157372_10078438 3300013307 Unclassified 3732
485 Ga0157372_10122925 3300013307 Unclassified 2983
486 Ga0157372_10187711 3300013307 Bacteria 2394
487 Ga0157372_10247006 3300013307 Unclassified 2071
488 Ga0157375_10003580 3300013308 Bacteria 13482
489 Ga0157375_10015367 3300013308 Bacteria 6850
490 Ga0157375_10030491 3300013308 Bacteria 5085
491 Ga0157375_10043801 3300013308 Bacteria 4343
492 Ga0157375_10356373 3300013308 Bacteria 1629
493 Ga0163163_10020441 3300014325 Bacteria 6234
494 Ga0163163_10025274 3300014325 Bacteria 5662
495 Ga0163163_10059974 3300014325 Bacteria 3765
496 Ga0163163_10072291 3300014325 Bacteria 3438
497 Ga0163163_10110393 3300014325 Unclassified 2778
498 Ga0163163_10124386 3300014325 Bacteria 2615
499 Ga0163163_10157889 3300014325 Bacteria 2313
500 Ga0163163_10360639 3300014325 Bacteria 1510
501 Ga0163163_10387049 3300014325 Bacteria 1456
502 Ga0163163_10475204 3300014325 Bacteria 1311
503 Ga0157380_10006237 3300014326 Bacteria 8375
504 Ga0157380_10535390 3300014326 Bacteria 1146
505 Ga0182008_10044746 3300014497 Unclassified 2202
506 Ga0157377_10007969 3300014745 Bacteria 5144
507 Ga0157379_10001812 3300014968 Bacteria 17646
508 Ga0157379_10012865 3300014968 Bacteria 7318
509 Ga0157379_10026975 3300014968 Bacteria 5112
510 Ga0157379_10055120 3300014968 Bacteria 3552
511 Ga0157379_10060793 3300014968 Bacteria 3378
512 Ga0157379_10175320 3300014968 Bacteria 1936
513 Ga0157376_10004063 3300014969 Bacteria 10125
514 Ga0157376_10042115 3300014969 Unclassified 3742
515 Ga0157376_10049476 3300014969 Unclassified 3482
516 Ga0157376_10202439 3300014969 Unclassified 1828
517 Ga0157376_10272741 3300014969 Bacteria 1590
518 Ga0182006_1021588 3300015261 Unclassified 2683
519 Ga0182006_1072942 3300015261 Unclassified 1268
520 Ga0182007_10002409 3300015262 Bacteria 9337
521 Ga0182007_10039680 3300015262 Bacteria 1574
522 Ga0182005_1009264 3300015265 Unclassified 2869
523 Ga0163161_10051815 3300017792 Bacteria 2975
524 Ga0206354_10265616 3300020081 Bacteria 1731
525 Ga0213873_10020908 3300021358 Bacteria 1534
526 Ga0213872_10010735 3300021361 Bacteria 4351
527 Ga0213872_10014357 3300021361 Bacteria 3695
528 Ga0213871_10004023 3300021441 Bacteria 2899
529 Ga0224712_10026682 3300022467 Bacteria 2045
530 Ga0224712_10044458 3300022467 Bacteria 1694
531 Ga0224570_100565 3300022730 Bacteria 2931
532 Ga0224572_1000257 3300024225 Bacteria 5423
533 Ga0228598_1001074 3300024227 Bacteria 6015
534 Ga0228598_1001256 3300024227 Bacteria 5575
535 Ga0207656_10036251 3300025321 Unclassified 2069
536 Ga0207692_10063997 3300025898 Bacteria 1913
537 Ga0207642_10005304 3300025899 Bacteria 4198
538 Ga0207642_10018358 3300025899 Bacteria 2683
539 Ga0207710_10075068 3300025900 Bacteria 1557
540 Ga0207688_10003069 3300025901 Bacteria 9113
541 Ga0207647_10002063 3300025904 Bacteria 15352
542 Ga0207647_10016048 3300025904 Bacteria 5118
543 Ga0207647_10049796 3300025904 Unclassified 2597
544 Ga0207647_10098194 3300025904 Bacteria 1740
545 Ga0207685_10003074 3300025905 Unclassified 3980
546 Ga0207685_10038958 3300025905 Bacteria 1761
547 Ga0207699_10009701 3300025906 Bacteria 4805
548 Ga0207699_10012015 3300025906 Bacteria 4393
549 Ga0207699_10050642 3300025906 Unclassified 2450
550 Ga0207699_10067586 3300025906 Bacteria 2173
551 Ga0207699_10094136 3300025906 Unclassified 1887
552 Ga0207699_10146111 3300025906 Bacteria 1559
553 Ga0207699_10252550 3300025906 Bacteria 1216
554 Ga0207699_10334304 3300025906 Bacteria 1066
555 Ga0207645_10000901 3300025907 Bacteria 24637
556 Ga0207645_10006268 3300025907 Bacteria 8547
557 Ga0207643_10000172 3300025908 Bacteria 44395
558 Ga0207705_10045267 3300025909 Bacteria 3163
559 Ga0207684_10000768 3300025910 Bacteria 37301
560 Ga0207684_10005976 3300025910 Bacteria 11136
561 Ga0207684_10016448 3300025910 Bacteria 6351
562 Ga0207684_10017175 3300025910 Bacteria 6210
563 Ga0207684_10062474 3300025910 Unclassified 3163
564 Ga0207684_10094980 3300025910 Unclassified 2544
565 Ga0207684_10103525 3300025910 Bacteria 2434
566 Ga0207654_10029582 3300025911 Bacteria 3001
567 Ga0207654_10032668 3300025911 Bacteria 2878
568 Ga0207654_10057441 3300025911 Bacteria 2261
569 Ga0207707_10000266 3300025912 Bacteria 56336
570 Ga0207707_10003379 3300025912 Bacteria 14162
571 Ga0207707_10007460 3300025912 Bacteria 9528
572 Ga0207707_10011097 3300025912 Bacteria 7834
573 Ga0207707_10021147 3300025912 Bacteria 5686
574 Ga0207707_10065929 3300025912 Bacteria 3153
575 Ga0207707_10101188 3300025912 Bacteria 2518
576 Ga0207707_10177050 3300025912 Bacteria 1863
577 Ga0207695_10000693 3300025913 Bacteria 66031
578 Ga0207695_10003740 3300025913 Bacteria 21155
579 Ga0207695_10007402 3300025913 Bacteria 13995
580 Ga0207695_10016105 3300025913 Bacteria 8770
581 Ga0207695_10037550 3300025913 Bacteria 5226
582 Ga0207695_10115452 3300025913 Bacteria 2659
583 Ga0207695_10178963 3300025913 Bacteria 2042
584 Ga0207695_10373813 3300025913 Unclassified 1311
585 Ga0207695_10480551 3300025913 Bacteria 1124
586 Ga0207671_10027073 3300025914 Bacteria 4289
587 Ga0207671_10064810 3300025914 Bacteria 2716
588 Ga0207671_10133740 3300025914 Bacteria 1905
589 Ga0207693_10000067 3300025915 Bacteria 91025
590 Ga0207693_10000098 3300025915 Bacteria 77389
591 Ga0207693_10000884 3300025915 Bacteria 26840
592 Ga0207693_10001517 3300025915 Bacteria 20489
593 Ga0207693_10012227 3300025915 Bacteria 6935
594 Ga0207693_10016140 3300025915 Bacteria 5974
595 Ga0207693_10020519 3300025915 Bacteria 5255
596 Ga0207693_10044284 3300025915 Bacteria 3498
597 Ga0207693_10079310 3300025915 Bacteria 2569
598 Ga0207693_10112274 3300025915 Bacteria 2138
599 Ga0207693_10237676 3300025915 Bacteria 1430
600 Ga0207663_10007568 3300025916 Bacteria 5637
601 Ga0207663_10014875 3300025916 Bacteria 4276
602 Ga0207663_10031992 3300025916 Bacteria 3119
603 Ga0207663_10041091 3300025916 Bacteria 2816
604 Ga0207663_10087264 3300025916 Unclassified 2060
605 Ga0207663_10089454 3300025916 Unclassified 2039
606 Ga0207663_10095862 3300025916 Bacteria 1980
607 Ga0207660_10002995 3300025917 Bacteria 11061
608 Ga0207660_10061997 3300025917 Bacteria 2693
609 Ga0207660_10074438 3300025917 Unclassified 2479
610 Ga0207660_10178146 3300025917 Unclassified 1649
611 Ga0207660_10285284 3300025917 Bacteria 1311
612 Ga0207662_10002090 3300025918 Bacteria 9922
613 Ga0207662_10174525 3300025918 Bacteria 1380
614 Ga0207657_10000660 3300025919 Bacteria 36719
615 Ga0207657_10002292 3300025919 Bacteria 20729
616 Ga0207657_10016937 3300025919 Bacteria 7013
617 Ga0207649_10001125 3300025920 Bacteria 16224
618 Ga0207649_10023104 3300025920 Bacteria 3598
619 Ga0207649_10156878 3300025920 Unclassified 1573
620 Ga0207652_10001598 3300025921 Bacteria 19947
621 Ga0207652_10003545 3300025921 Bacteria 12882
622 Ga0207652_10038171 3300025921 Bacteria 4069
623 Ga0207652_10064198 3300025921 Unclassified 3177
624 Ga0207652_10106214 3300025921 Bacteria 2485
625 Ga0207652_10139802 3300025921 Unclassified 2165
626 Ga0207646_10000298 3300025922 Bacteria 67489
627 Ga0207646_10004709 3300025922 Bacteria 14704
628 Ga0207646_10045908 3300025922 Bacteria 3920
629 Ga0207646_10046574 3300025922 Bacteria 3890
630 Ga0207646_10077799 3300025922 Bacteria 2964
631 Ga0207646_10102475 3300025922 Bacteria 2566
632 Ga0207646_10320823 3300025922 Bacteria 1400
633 Ga0207681_10064112 3300025923 Bacteria 2536
634 Ga0207681_10228297 3300025923 Unclassified 1444
635 Ga0207694_10002762 3300025924 Bacteria 14177
636 Ga0207694_10029240 3300025924 Unclassified 4204
637 Ga0207694_10065154 3300025924 Bacteria 2840
638 Ga0207694_10122260 3300025924 Unclassified 2079
639 Ga0207694_10245779 3300025924 Bacteria 1463
640 Ga0207650_10000059 3300025925 Bacteria 151427
641 Ga0207659_10145002 3300025926 Bacteria 1848
642 Ga0207659_10157992 3300025926 Bacteria 1777
643 Ga0207687_10006015 3300025927 Bacteria 8029
644 Ga0207687_10009003 3300025927 Bacteria 6526
645 Ga0207687_10009700 3300025927 Bacteria 6297
646 Ga0207687_10103813 3300025927 Bacteria 2097
647 Ga0207700_10008946 3300025928 Bacteria 6234
648 Ga0207700_10015310 3300025928 Bacteria 5053
649 Ga0207700_10018505 3300025928 Bacteria 4683
650 Ga0207700_10018692 3300025928 Bacteria 4663
651 Ga0207700_10021041 3300025928 Unclassified 4446
652 Ga0207700_10024988 3300025928 Bacteria 4142
653 Ga0207700_10063197 3300025928 Unclassified 2815
654 Ga0207700_10069925 3300025928 Unclassified 2696
655 Ga0207700_10099797 3300025928 Unclassified 2312
656 Ga0207700_10144330 3300025928 Bacteria 1960
657 Ga0207700_10151979 3300025928 Unclassified 1914
658 Ga0207700_10186426 3300025928 Bacteria 1741
659 Ga0207700_10217945 3300025928 Unclassified 1616
660 Ga0207700_10296062 3300025928 Unclassified 1396
661 Ga0207664_10000212 3300025929 Bacteria 44097
662 Ga0207664_10066656 3300025929 Bacteria 2886
663 Ga0207664_10079541 3300025929 Unclassified 2661
664 Ga0207664_10138936 3300025929 Unclassified 2053
665 Ga0207664_10138971 3300025929 Unclassified 2052
666 Ga0207664_10314724 3300025929 Bacteria 1380
667 Ga0207664_10360700 3300025929 Bacteria 1288
668 Ga0207664_10448275 3300025929 Unclassified 1152
669 Ga0207690_10089161 3300025932 Unclassified 2174
670 Ga0207706_10000098 3300025933 Bacteria 91173
671 Ga0207706_10000723 3300025933 Bacteria 34501
672 Ga0207686_10069416 3300025934 Unclassified 2260
673 Ga0207686_10085966 3300025934 Bacteria 2064
674 Ga0207670_10053185 3300025936 Bacteria 2727
675 Ga0207670_10205381 3300025936 Bacteria 1499
676 Ga0207670_10326769 3300025936 Bacteria 1208
677 Ga0207704_10048954 3300025938 Bacteria 2538
678 Ga0207704_10075112 3300025938 Bacteria 2160
679 Ga0207665_10020494 3300025939 Unclassified 4345
680 Ga0207665_10037720 3300025939 Bacteria 3217
681 Ga0207665_10067103 3300025939 Bacteria 2442
682 Ga0207665_10104350 3300025939 Bacteria 1984
683 Ga0207691_10001129 3300025940 Bacteria 26514
684 Ga0207711_10004346 3300025941 Bacteria 12093
685 Ga0207711_10035400 3300025941 Bacteria 4232
686 Ga0207711_10074950 3300025941 Bacteria 2944
687 Ga0207711_10114209 3300025941 Bacteria 2405
688 Ga0207711_10143206 3300025941 Bacteria 2152
689 Ga0207689_10000353 3300025942 Bacteria 43010
690 Ga0207689_10038519 3300025942 Unclassified 3959
691 Ga0207689_10098949 3300025942 Bacteria 2396
692 Ga0207689_10141747 3300025942 Bacteria 1980
693 Ga0207661_10021989 3300025944 Bacteria 4792
694 Ga0207661_10096946 3300025944 Bacteria 2468
695 Ga0207679_10000415 3300025945 Bacteria 30616
696 Ga0207679_10031074 3300025945 Bacteria 3735
697 Ga0207679_10216949 3300025945 Bacteria 1608
698 Ga0207667_10000413 3300025949 Bacteria 57875
699 Ga0207667_10006238 3300025949 Bacteria 14469
700 Ga0207667_10012296 3300025949 Bacteria 9876
701 Ga0207667_10018332 3300025949 Bacteria 7852
702 Ga0207667_10066067 3300025949 Bacteria 3771
703 Ga0207667_10083898 3300025949 Bacteria 3299
704 Ga0207667_10148903 3300025949 Unclassified 2409
705 Ga0207667_10326491 3300025949 Bacteria 1567
706 Ga0207667_10348265 3300025949 Bacteria 1511
707 Ga0207712_10007011 3300025961 Bacteria 7108
708 Ga0207712_10142518 3300025961 Bacteria 1841
709 Ga0207712_10198434 3300025961 Bacteria 1589
710 Ga0207712_10268382 3300025961 Bacteria 1387
711 Ga0207668_10008891 3300025972 Bacteria 6007
712 Ga0207640_10060567 3300025981 Bacteria 2503
713 Ga0207640_10079021 3300025981 Unclassified 2241
714 Ga0207640_10089505 3300025981 Bacteria 2128
715 Ga0207640_10149792 3300025981 Unclassified 1712
716 Ga0207677_10001543 3300026023 Bacteria 12182
717 Ga0207677_10001745 3300026023 Bacteria 11515
718 Ga0207677_10003837 3300026023 Bacteria 7995
719 Ga0207677_10004382 3300026023 Bacteria 7564
720 Ga0207677_10011658 3300026023 Bacteria 5018
721 Ga0207677_10078138 3300026023 Bacteria 2362
722 Ga0207677_10192605 3300026023 Bacteria 1614
723 Ga0207703_10006204 3300026035 Bacteria 9564
724 Ga0207703_10007234 3300026035 Bacteria 8827
725 Ga0207703_10010063 3300026035 Bacteria 7414
726 Ga0207703_10050625 3300026035 Unclassified 3363
727 Ga0207703_10069955 3300026035 Bacteria 2896
728 Ga0207703_10105216 3300026035 Bacteria 2398
729 Ga0207703_10373062 3300026035 Bacteria 1318
730 Ga0207639_10016209 3300026041 Bacteria 5266
731 Ga0207639_10038468 3300026041 Unclassified 3559
732 Ga0207639_10077952 3300026041 Bacteria 2614
733 Ga0207678_10000581 3300026067 Bacteria 33440
734 Ga0207678_10006094 3300026067 Bacteria 10728
735 Ga0207708_10353370 3300026075 Bacteria 1206
736 Ga0207702_10000209 3300026078 Bacteria 69358
737 Ga0207702_10001199 3300026078 Bacteria 26302
738 Ga0207702_10003037 3300026078 Bacteria 15597
739 Ga0207702_10055790 3300026078 Bacteria 3352
740 Ga0207702_10073539 3300026078 Unclassified 2948
741 Ga0207702_10099952 3300026078 Unclassified 2558
742 Ga0207702_10173363 3300026078 Bacteria 1980
743 Ga0207702_10222748 3300026078 Bacteria 1758
744 Ga0207702_10313036 3300026078 Unclassified 1493
745 Ga0207702_10396022 3300026078 Bacteria 1331
746 Ga0207702_10432168 3300026078 Bacteria 1275
747 Ga0207641_10000025 3300026088 Bacteria 247727
748 Ga0207641_10008027 3300026088 Bacteria 8749
749 Ga0207641_10020912 3300026088 Bacteria 5379
750 Ga0207641_10059041 3300026088 Bacteria 3266
751 Ga0207641_10063347 3300026088 Bacteria 3158
752 Ga0207641_10068485 3300026088 Bacteria 3044
753 Ga0207648_10003458 3300026089 Bacteria 16561
754 Ga0207648_10047694 3300026089 Bacteria 3753
755 Ga0207676_10000252 3300026095 Bacteria 46432
756 Ga0207676_10002695 3300026095 Bacteria 12631
757 Ga0207676_10008202 3300026095 Bacteria 7432
758 Ga0207676_10032451 3300026095 Bacteria 3935
759 Ga0207674_10000162 3300026116 Bacteria 79631
760 Ga0207674_10003030 3300026116 Bacteria 20822
761 Ga0207674_10042580 3300026116 Bacteria 4688
762 Ga0207674_10078029 3300026116 Bacteria 3317
763 Ga0207674_10127467 3300026116 Unclassified 2510
764 Ga0207674_10214815 3300026116 Bacteria 1872
765 Ga0207675_100017450 3300026118 Bacteria 6700
766 Ga0207675_100027963 3300026118 Bacteria 5251
767 Ga0207675_100078474 3300026118 Bacteria 3094
768 Ga0207683_10001306 3300026121 Bacteria 22515
769 Ga0207683_10083016 3300026121 Unclassified 2847
770 Ga0207698_10029146 3300026142 Bacteria 3948
771 Ga0207428_10000435 3300027907 Bacteria 51355
772 Ga0207428_10000846 3300027907 Bacteria 34463
773 Ga0207428_10041335 3300027907 Bacteria 3733
774 Ga0265356_1000857 3300028017 Bacteria 4995
775 Ga0268266_10010266 3300028379 Bacteria 8199
776 Ga0268264_10025084 3300028381 Unclassified 4872
777 Ga0268264_10050987 3300028381 Bacteria 3447
778 Ga0268264_10063001 3300028381 Bacteria 3116
779 Ga0268264_10066451 3300028381 Bacteria 3041
780 Ga0268264_10096896 3300028381 Bacteria 2556
781 Ga0268264_10307434 3300028381 Bacteria 1495
782 Ga0265338_10004251 3300028800 Bacteria 19463
783 Ga0265338_10024675 3300028800 Bacteria 6135
784 Ga0265338_10148870 3300028800 Unclassified 1821
785 Ga0265338_10196671 3300028800 Bacteria 1524
786 Ga0265762_1000116 3300030760 Bacteria 11753
787 Ga0265762_1001781 3300030760 Bacteria 3913
788 Ga0265760_10002278 3300031090 Bacteria 5612
789 Ga0265760_10002457 3300031090 Bacteria 5408
790 Ga0265760_10018115 3300031090 Bacteria 2025
791 Ga0265330_10005484 3300031235 Bacteria 6330
792 Ga0265325_10025527 3300031241 Bacteria 3207
793 Ga0265325_10047993 3300031241 Unclassified 2208
794 Ga0265339_10018777 3300031249 Bacteria 4071
795 Ga0265339_10019646 3300031249 Bacteria 3963
796 Ga0265339_10159198 3300031249 Bacteria 1137
797 Ga0265316_10041782 3300031344 Bacteria 3667
798 Ga0265316_10048446 3300031344 Bacteria 3354
799 Ga0265316_10113095 3300031344 Bacteria 2055
800 Ga0307408_100012830 3300031548 Bacteria 5558
801 Ga0307408_100110828 3300031548 Bacteria 2108
802 Ga0307408_100152467 3300031548 Bacteria 1826
803 Ga0307408_100194934 3300031548 Bacteria 1635
804 Ga0307408_100287197 3300031548 Bacteria 1372
805 Ga0265314_10004435 3300031711 Bacteria 13025
806 Ga0265314_10080937 3300031711 Bacteria 2142
807 Ga0265314_10169979 3300031711 Bacteria 1317
808 Ga0265342_10061692 3300031712 Bacteria 2208
809 Ga0307405_10036139 3300031731 Bacteria 2957
810 Ga0307405_10077866 3300031731 Bacteria 2156
811 Ga0307410_10004067 3300031852 Bacteria 7481
812 Ga0307410_10135625 3300031852 Bacteria 1814
813 Ga0307406_10081672 3300031901 Bacteria 2150
814 Ga0307407_10156535 3300031903 Bacteria 1487
815 Ga0307407_10181292 3300031903 Bacteria 1396
816 Ga0307412_10046266 3300031911 Bacteria 2850
817 Ga0307409_100030864 3300031995 Bacteria 3858
818 Ga0307416_100003885 3300032002 Bacteria 8894
819 Ga0307416_100040415 3300032002 Bacteria 3623
820 Ga0307416_100047412 3300032002 Bacteria 3401
821 Ga0307416_100061300 3300032002 Bacteria 3069
822 Ga0307416_100081440 3300032002 Bacteria 2737
823 Ga0307416_100117482 3300032002 Bacteria 2361
824 Ga0307416_100354754 3300032002 Bacteria 1486
825 Ga0307416_100463725 3300032002 Bacteria 1323
826 Ga0307411_10006952 3300032005 Bacteria 5711
827 Ga0307411_10125471 3300032005 Bacteria 1866
828 Ga0307411_10282574 3300032005 Bacteria 1322
829 Ga0307415_100010919 3300032126 Bacteria 5168
830 Ga0307415_100503072 3300032126 Bacteria 1060
831 Ga0316212_1003932 3300033547 Bacteria 2157
832 Ga0373926_0017457 3300035083 Bacteria 2463
833 Ga0373923_0001393 3300035111 Bacteria 6891
834 Ga0373923_0038824 3300035111 Bacteria 1953
835 Ga0373923_0090879 3300035111 Unclassified 1335
836 Ga0373936_0000319 3300035113 Bacteria 16274
837 Ga0373936_0090408 3300035113 Bacteria 1283
838 Ga0373945_0001313 3300035116 Bacteria 7543
839 Ga0373945_0060547 3300035116 Bacteria 1412
840 Ga0373956_0007158 3300035119 Bacteria 4491
841 Ga0373956_0073444 3300035119 Unclassified 1563
842 Ga0373943_0000016 3300035170 Bacteria 58099
843 Ga0373943_0016294 3300035170 Bacteria 3387
844 Ga0373943_0040390 3300035170 Bacteria 2252
845 Ga0373946_0019422 3300035171 Bacteria 2618
846 Ga0373924_0000248 3300035410 Bacteria 16512
847 Ga0373924_0003372 3300035410 Bacteria 5486
848 Ga0373924_0031217 3300035410 Bacteria 2141
849 Ga0373931_0007410 3300035691 Bacteria 5167
850 Ga0373931_0032147 3300035691 Bacteria 2714
851 Ga0373931_0045293 3300035691 Unclassified 2323
852 Ga0373935_0000864 3300035692 Bacteria 16342
853 Ga0373935_0003124 3300035692 Bacteria 9554
854 Ga0373935_0006632 3300035692 Bacteria 6916
855 Ga0373935_0010148 3300035692 Bacteria 5641
856 Ga0373935_0032320 3300035692 Unclassified 3252
857 Ga0373927_0000034 3300035695 Bacteria 103921
858 Ga0373927_0058122 3300035695 Unclassified 2501
859 Ga0373927_0072792 3300035695 Unclassified 2225
860 Ga0373927_0078965 3300035695 Bacteria 2131
861 Ga0373927_0111053 3300035695 Bacteria 1786
862 Ga0373933_0015818 3300035724 Bacteria 4210
863 Ga0373947_0000035 3300035725 Bacteria 68883
864 Ga0373947_0017382 3300035725 Bacteria 4137
865 Ga0373947_0039779 3300035725 Bacteria 2799
866 Ga0373947_0087873 3300035725 Bacteria 1934
867 Ga0373937_0000090 3300036401 Bacteria 84561
868 Ga0373937_0049245 3300036401 Bacteria 3859
869 Ga0373937_0076551 3300036401 Bacteria 3090
870 Ga0373937_0440853 3300036401 Unclassified 1236
871 Ga0373937_0647934 3300036401 Bacteria 1002
872 Ga0373925_0000714 3300037068 Bacteria 31008
873 Ga0373925_0005732 3300037068 Bacteria 9234
874 Ga0373925_0006084 3300037068 Bacteria 8925
875 Ga0373925_0021655 3300037068 Bacteria 4685
876 Ga0373925_0048158 3300037068 Bacteria 3175
877 Ga0373925_0127295 3300037068 Bacteria 1983
878 Ga0373925_0178622 3300037068 Unclassified 1679
879 Ga0373925_0226782 3300037068 Bacteria 1493
880 Ga0395900_0460942 3300037418 Bacteria 1226
881 Ga0395898_0049727 3300037466 Bacteria 4107
882 Ga0395898_0177640 3300037466 Bacteria 2035
883 Ga0395905_0003951 3300037471 Bacteria 15596
884 Ga0395905_0026624 3300037471 Bacteria 5452
885 Ga0395905_0070863 3300037471 Bacteria 3267
886 Ga0395905_0090299 3300037471 Bacteria 2872
887 Ga0395905_0092192 3300037471 Unclassified 2841
888 Ga0436364_0366631 3300037853 Bacteria 1687
889 Ga0395901_0219459 3300038443 Unclassified 1988
890 Ga0436360_0174134 3300039438 Unclassified 3345
891 Ga0436361_0534152 3300039447 Bacteria 2191
892 Ga0436361_0620753 3300039447 Bacteria 4828
893 Ga0436361_0635090 3300039447 Bacteria 20791
894 Ga0436361_0706896 3300039447 Bacteria 2278
895 Ga0436363_0375979 3300039450 Bacteria 2267
896 Ga0436363_1252730 3300039450 Bacteria 2815
897 Ga0436363_1383135 3300039450 Unclassified 2016
898 Ga0436363_1663027 3300039450 Bacteria 1869
899 Ga0436362_0906121 3300039453 Bacteria 1536
900 Ga0436362_1104320 3300039453 Bacteria 2121
901 Ga0436362_1148430 3300039453 Bacteria 7068
902 Ga0451853_2499464 3300041512 Bacteria 1342
903 Ga0439462_0031366 3300042015 Bacteria 1407
904 Ga0451577_0001555 3300042876 Bacteria 30103
905 Ga0451577_0113458 3300042876 Bacteria 2426
906 Ga0466969_0056413 3300044656 Bacteria 1918
907 Ga0466963_0005503 3300044694 Bacteria 7414
908 Ga0466963_0049233 3300044694 Unclassified 2786
909 Ga0466963_0049475 3300044694 Bacteria 2780
910 Ga0453684_0000289 3300044712 Bacteria 215476
911 Ga0453684_0019897 3300044712 Bacteria 10181
912 Ga0466957_0018353 3300044842 Bacteria 4108
913 Ga0466957_0095683 3300044842 Bacteria 1865
914 Ga0466957_0132345 3300044842 Bacteria 1599
915 Ga0466959_0033530 3300045049 Unclassified 3797
916 Ga0466959_0035415 3300045049 Bacteria 3692
917 Ga0466959_0209135 3300045049 Bacteria 1356
918 Ga0451576_0035560 3300045051 Bacteria 5283
919 Ga0451576_0420030 3300045051 Bacteria 1403
920 Ga0451576_0531076 3300045051 Bacteria 1236
921 Ga0466958_0026948 3300045836 Bacteria 3398
922 Ga0466958_0147300 3300045836 Unclassified 1484
923 Ga0466967_0055328 3300045976 Bacteria 3495
924 Ga0466967_0114172 3300045976 Bacteria 2486
925 Ga0495592_0139215 3300046454 Bacteria 1690
926 Ga0495629_0021849 3300046459 Bacteria 4566
927 Ga0495629_0077853 3300046459 Bacteria 2315
928 Ga0495580_0000354 3300046472 Bacteria 37390
929 Ga0495580_0001606 3300046472 Bacteria 19867
930 Ga0495580_0002290 3300046472 Bacteria 16705
931 Ga0495580_0004272 3300046472 Bacteria 12014
932 Ga0495580_0004478 3300046472 Bacteria 11736
933 Ga0495580_0019736 3300046472 Bacteria 5004
934 Ga0495580_0022694 3300046472 Bacteria 4614
935 Ga0495580_0023751 3300046472 Bacteria 4497
936 Ga0495580_0025920 3300046472 Unclassified 4279
937 Ga0495580_0046482 3300046472 Bacteria 3079
938 Ga0495580_0051886 3300046472 Bacteria 2898
939 Ga0495580_0078652 3300046472 Bacteria 2300
940 Ga0495580_0092740 3300046472 Bacteria 2102
941 Ga0495580_0098837 3300046472 Unclassified 2030
942 Ga0495580_0132859 3300046472 Bacteria 1726
943 Ga0495664_0049533 3300046477 Unclassified 2494
944 Ga0495594_0008908 3300046499 Bacteria 5175
945 Ga0495630_0001984 3300046517 Bacteria 14253
946 Ga0495630_0011837 3300046517 Bacteria 6322
947 Ga0495630_0026718 3300046517 Bacteria 4276
948 Ga0495630_0074146 3300046517 Unclassified 2563
949 Ga0495630_0120901 3300046517 Bacteria 1987
950 Ga0495666_0112078 3300046526 Unclassified 1281
951 Ga0495665_0014305 3300046531 Unclassified 4281
952 Ga0495587_0077896 3300046536 Bacteria 1924
953 Ga0495667_0043718 3300046559 Bacteria 2968
954 Ga0495635_0179857 3300046663 Unclassified 1438
955 Ga0495657_0220848 3300046675 Unclassified 1149
956 Ga0495599_0060721 3300046678 Bacteria 2364
957 Ga0495623_0039822 3300046679 Bacteria 3002
958 Ga0495658_0013179 3300046683 Bacteria 4206
959 Ga0495658_0035332 3300046683 Unclassified 2749
960 Ga0495669_0000991 3300046684 Bacteria 11866
961 Ga0495669_0002685 3300046684 Bacteria 7283
962 Ga0495669_0074677 3300046684 Bacteria 1550
963 Ga0495613_0000670 3300046689 Bacteria 27111
964 Ga0495613_0177997 3300046689 Bacteria 1507
965 Ga0495613_0178872 3300046689 Bacteria 1503
966 Ga0495613_0202417 3300046689 Bacteria 1399
967 Ga0495600_0016234 3300046809 Bacteria 4722
968 Ga0495600_0126297 3300046809 Bacteria 1664
969 Ga0495600_0133668 3300046809 Bacteria 1612
970 Ga0495581_0029073 3300047315 Bacteria 3204
971 Ga0495604_0028162 3300047317 Bacteria 4469
972 Ga0495604_0032592 3300047317 Unclassified 4129
973 Ga0495604_0042957 3300047317 Bacteria 3541
974 Ga0495636_0048202 3300047318 Bacteria 1780
975 Ga0495674_0016645 3300047319 Bacteria 6860
976 Ga0495674_0078187 3300047319 Bacteria 2843
977 Ga0495672_0055485 3300047320 Bacteria 2312
978 Ga0495675_0013233 3300047444 Bacteria 5207
979 Ga0495675_0090400 3300047444 Bacteria 1922
980 Ga0495677_0090568 3300047445 Bacteria 1152
981 Ga0495684_0009482 3300047471 Bacteria 7511
982 Ga0495684_0187855 3300047471 Bacteria 1529
983 Ga0495602_0103606 3300048088 Bacteria 2329
984 Ga0495614_0108478 3300048089 Unclassified 1218
985 Ga0496100_0038130 3300048903 Bacteria 3043
986 Ga0496101_0057320 3300048904 Bacteria 2818
987 Ga0496101_0109408 3300048904 Bacteria 2079
988 Ga0496101_0243345 3300048904 Bacteria 1400
989 Ga0496101_0281897 3300048904 Bacteria 1299
990 Ga0496102_0002608 3300048905 Bacteria 15350
991 Ga0496102_0026380 3300048905 Bacteria 5182
992 Ga0496102_0028897 3300048905 Bacteria 4956
993 Ga0496102_0042036 3300048905 Unclassified 4142
994 Ga0496102_0107895 3300048905 Unclassified 2593
995 Ga0496102_0224927 3300048905 Bacteria 1769
996 Ga0496103_0063905 3300048906 Bacteria 2293
997 Ga0496103_0137086 3300048906 Unclassified 1564
998 Ga0496104_0008792 3300048907 Bacteria 8978
999 Ga0496104_0091926 3300048907 Bacteria 2901
1000 Ga0496104_0163570 3300048907 Bacteria 2134
1001 Ga0496104_0299112 3300048907 Bacteria 1521
1002 Ga0496104_0326605 3300048907 Unclassified 1447
1003 Ga0496104_0457469 3300048907 Bacteria 1188
1004 Ga0496105_0000584 3300048908 Bacteria 24242
1005 Ga0496105_0053823 3300048908 Bacteria 3324
1006 Ga0496106_0085428 3300048909 Bacteria 2430
1007 Ga0496106_0353486 3300048909 Bacteria 1180
1008 Ga0496107_0139938 3300048910 Bacteria 1789
1009 Ga0496108_0000203 3300048911 Bacteria 54921
1010 Ga0496108_0135570 3300048911 Bacteria 2118
1011 Ga0496108_0306696 3300048911 Unclassified 1383
1012 Ga0496109_0000080 3300048912 Bacteria 100056
1013 Ga0496109_0000228 3300048912 Bacteria 54849
1014 Ga0496109_0031502 3300048912 Bacteria 4759
1015 Ga0496110_0000145 3300048913 Bacteria 41800
1016 Ga0496110_0023501 3300048913 Bacteria 5244
1017 Ga0496110_0076017 3300048913 Bacteria 2985
1018 Ga0496110_0179781 3300048913 Unclassified 1921
1019 Ga0496110_0479489 3300048913 Bacteria 1133
1020 Ga0496111_0003439 3300048914 Bacteria 9791
1021 Ga0496111_0060610 3300048914 Unclassified 2743
1022 Ga0496111_0115526 3300048914 Bacteria 1979
1023 Ga0496111_0187711 3300048914 Bacteria 1537
1024 Ga0496112_0000048 3300048915 Bacteria 84789
1025 Ga0496112_0001123 3300048915 Bacteria 19904
1026 Ga0496112_0002435 3300048915 Bacteria 14999
1027 Ga0496112_0004578 3300048915 Bacteria 11754
1028 Ga0496112_0006190 3300048915 Bacteria 10470
1029 Ga0496112_0008072 3300048915 Bacteria 9398
1030 Ga0496112_0063880 3300048915 Bacteria 3632
1031 Ga0496112_0129203 3300048915 Bacteria 2498
1032 Ga0496112_0173849 3300048915 Bacteria 2119
1033 Ga0496112_0212238 3300048915 Bacteria 1893
1034 Ga0496113_0001316 3300048916 Bacteria 13730
1035 Ga0496113_0002647 3300048916 Bacteria 10487
1036 Ga0496114_0021153 3300048917 Bacteria 5289
1037 Ga0496115_0051371 3300048918 Bacteria 3306
1038 Ga0496115_0086899 3300048918 Bacteria 2552
1039 Ga0496115_0260447 3300048918 Bacteria 1426
1040 Ga0496115_0357787 3300048918 Bacteria 1190
1041 Ga0496115_0471910 3300048918 Unclassified 1011
1042 Ga0496126_0006296 3300048929 Bacteria 13254
1043 Ga0501031_0038147 3300049568 Bacteria 3136
1044 Ga0501031_0065791 3300049568 Bacteria 2362
1045 Ga0501032_0018387 3300049569 Bacteria 4897
1046 Ga0501034_0013627 3300049571 Bacteria 8363
1047 Ga0501034_0040164 3300049571 Bacteria 4737
1048 Ga0501034_0072287 3300049571 Bacteria 3458
1049 Ga0501034_0305587 3300049571 Bacteria 1526
1050 Ga0501036_0030799 3300049572 Bacteria 4533
1051 Ga0501036_0062073 3300049572 Bacteria 3165
1052 Ga0501036_0194759 3300049572 Bacteria 1705
1053 Ga0501036_0395569 3300049572 Bacteria 1153
1054 Ga0501037_0108903 3300049573 Bacteria 1996
1055 Ga0501038_0034756 3300049574 Bacteria 4429
1056 Ga0501038_0057722 3300049574 Bacteria 3332
1057 Ga0501038_0057746 3300049574 Bacteria 3331
1058 Ga0501039_0003109 3300049575 Bacteria 12405
1059 Ga0501039_0089362 3300049575 Bacteria 2401
1060 Ga0501040_0201743 3300049576 Bacteria 1412
1061 Ga0501041_0072689 3300049577 Bacteria 2113
1062 Ga0501041_0205129 3300049577 Bacteria 1236
1063 Ga0501042_0014107 3300049578 Bacteria 5449
1064 Ga0501043_0015240 3300049579 Bacteria 6020
1065 Ga0501043_0243822 3300049579 Bacteria 1385
1066 Ga0501046_0028314 3300049580 Bacteria 4564
1067 Ga0501046_0029522 3300049580 Bacteria 4457
1068 Ga0501047_0017959 3300049581 Bacteria 6779
1069 Ga0501047_0061399 3300049581 Bacteria 3626
1070 Ga0501047_0287344 3300049581 Bacteria 1488
1071 Ga0501047_0400480 3300049581 Bacteria 1205
1072 Ga0501048_0090923 3300049582 Bacteria 2153
1073 Ga0501048_0135043 3300049582 Bacteria 1743
1074 Ga0501048_0335269 3300049582 Bacteria 1078
1075 Ga0501068_0019437 3300049584 Bacteria 3945
1076 Ga0501068_0056767 3300049584 Bacteria 2373
1077 Ga0501070_0141430 3300049586 Bacteria 1987
1078 Ga0501071_0016257 3300049587 Bacteria 5116
1079 Ga0501071_0138459 3300049587 Bacteria 1812
1080 Ga0501072_0068282 3300049588 Bacteria 2806
1081 Ga0501072_0070436 3300049588 Bacteria 2762
1082 Ga0501072_0076605 3300049588 Bacteria 2646
1083 Ga0501072_0187445 3300049588 Bacteria 1650
1084 Ga0501073_0097468 3300049589 Bacteria 2042
1085 Ga0501074_0140727 3300049590 Bacteria 1726
1086 Ga0501075_0000178 3300049591 Bacteria 33062
1087 Ga0501075_0031140 3300049591 Bacteria 3958
1088 Ga0501075_0044998 3300049591 Bacteria 3312
1089 Ga0501075_0048456 3300049591 Bacteria 3193
1090 Ga0501076_0411308 3300049592 Bacteria 1113
1091 Ga0501079_0022743 3300049741 Bacteria 4811
1092 Ga0501079_0108957 3300049741 Bacteria 2151
1093 Ga0501079_0215736 3300049741 Bacteria 1499
1094 Ga0501080_0066274 3300049742 Bacteria 3358
1095 Ga0501080_0102524 3300049742 Bacteria 2654
1096 Ga0501081_0396110 3300049743 Bacteria 1022
1097 Ga0501083_0001858 3300049744 Bacteria 14484
1098 Ga0501083_0006674 3300049744 Bacteria 8187
1099 Ga0501083_0215208 3300049744 Bacteria 1252
1100 Ga0501035_0120812 3300049822 Bacteria 2290
1101 Ga0501044_0033918 3300049823 Bacteria 5358
1102 Ga0501045_0010280 3300049824 Bacteria 6555
1103 Ga0501045_0188994 3300049824 Bacteria 1535
1104 nmdc:mga05p37_234728_c1 3300050507 Bacteria 2208
1105 nmdc:mga05p37_403642_c1 3300050507 Bacteria 1595
1106 nmdc:mga05p37_55969_c1 3300050507 Bacteria 4855
1107 nmdc:mga05p37_7249_c1 3300050507 Bacteria 3068
1108 nmdc:mga05p37_7276_c1 3300050507 Bacteria 13060
1109 nmdc:mga05p37_98700_c1 3300050507 Bacteria 3597
1110 nmdc:mga06r32_13473_c1 3300050510 Bacteria 7408
1111 nmdc:mga06r32_135894_c1 3300050510 Bacteria 2433
1112 nmdc:mga06r32_141739_c1 3300050510 Bacteria 2380
1113 nmdc:mga06r32_304824_c1 3300050510 Bacteria 1578
1114 nmdc:mga08y16_10941_c1 3300050511 Bacteria 9530
1115 nmdc:mga08y16_12992_c1 3300050511 Bacteria 8762
1116 nmdc:mga08y16_12_c1 3300050511 Bacteria 438455
1117 nmdc:mga08y16_217501_c1 3300050511 Bacteria 1978
1118 nmdc:mga08y16_240155_c1 3300050511 Bacteria 1873
1119 nmdc:mga08y16_300757_c1 3300050511 Bacteria 1654
1120 nmdc:mga0n895_12161_c1 3300050512 Bacteria 7705
1121 nmdc:mga0n895_22018_c1 3300050512 Bacteria 5971
1122 nmdc:mga0n895_37706_c1 3300050512 Bacteria 4678
1123 nmdc:mga0rr50_189626_c1 3300050513 Bacteria 1684
1124 nmdc:mga0rr50_2479_c1 3300050513 Bacteria 10422
1125 nmdc:mga0rr50_52962_c1 3300050513 Unclassified 3017
1126 nmdc:mga0rr50_7501_c1 3300050513 Bacteria 6732
1127 nmdc:mga08x19_1403_c1 3300050514 Bacteria 14894
1128 nmdc:mga08x19_18118_c1 3300050514 Bacteria 4314
1129 nmdc:mga08x19_24788_c1 3300050514 Bacteria 3732
1130 nmdc:mga08x19_7007_c1 3300050514 Bacteria 6693
1131 nmdc:mga08x19_74010_c1 3300050514 Bacteria 2225
1132 nmdc:mga0a205_312391_c1 3300050515 Bacteria 1444
1133 nmdc:mga0a205_358808_c1 3300050515 Bacteria 1324
1134 nmdc:mga0a205_46822_c1 3300050515 Bacteria 4171
1135 nmdc:mga0a205_57878_c1 3300050515 Bacteria 3743
1136 nmdc:mga0a205_61308_c1 3300050515 Bacteria 3633
1137 Ga0495601_0001213 3300053077 Bacteria 14137
1138 Ga0495601_0004055 3300053077 Bacteria 8445
1139 Ga0495612_0025640 3300053078 Bacteria 2368
1140 Ga0495612_0113032 3300053078 Bacteria 1164
1141 Ga0495595_0098264 3300053084 Bacteria 1411
1142 Ga0495619_0022944 3300053085 Bacteria 3995
1143 Ga0500555_003375 3300053103 Bacteria 4553
1144 Ga0500556_0006751 3300053104 Bacteria 3263
1145 Ga0500616_0000358 3300053153 Bacteria 64893
1146 Ga0501084_0008312 3300054114 Bacteria 8565
1147 Ga0501084_0055804 3300054114 Unclassified 3305
1148 Ga0590071_002424 3300059421 Bacteria 4687
1149 Ga0590075_005018 3300059424 Bacteria 3129
1150 Ga0587073_0005958 3300059492 Unclassified 1849
1151 Ga0587091_009615 3300059511 Unclassified 1461
1152 Ga0501082_0016755 3300060353 Bacteria 6310
1153 Ga0501082_0019066 3300060353 Bacteria 5911
1154 Ga0501082_0124815 3300060353 Bacteria 2232
1155 Ga0501082_0149188 3300060353 Bacteria 2030
1156 Ga0501082_0190359 3300060353 Bacteria 1785
1157 Ga0501082_0216432 3300060353 Bacteria 1667
1158 Ga0501082_0369400 3300060353 Bacteria 1251
1159 Ga0501082_0436636 3300060353 Bacteria 1143
1160 Ga0530510_0286292 3300061734 Bacteria 1232

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046689 Ga0495613_0202417 Ga0495613_0202417_547_1368 273
2 3300048906 Ga0496103_0137086 Ga0496103_0137086_621_1469 280
3 3300025906 Ga0207699_10252550 Ga0207699_102525502 282
4 3300006237 Ga0097621_100010855 Ga0097621_1000108555 285
5 3300006358 Ga0068871_100003756 Ga0068871_1000037564 285
6 3300053153 Ga0500616_0000358 Ga0500616_0000358_6555_7523 286
7 3300005458 Ga0070681_10368853 Ga0070681_103688532 291
8 3300031548 Ga0307408_100194934 Ga0307408_1001949342 291
9 3300032002 Ga0307416_100003885 Ga0307416_1000038852 291
10 3300036401 Ga0373937_0647934 Ga0373937_0647934_14_889 291
11 3300046472 Ga0495580_0025920 Ga0495580_0025920_3054_4043 291
12 3300009094 Ga0111539_10060226 Ga0111539_100602265 293
13 3300027907 Ga0207428_10041335 Ga0207428_100413353 293
14 3300049571 Ga0501034_0072287 Ga0501034_0072287_808_1770 294
15 3300044712 Ga0453684_0019897 Ga0453684_0019897_9001_9954 298
16 3300048916 Ga0496113_0001316 Ga0496113_0001316_16_918 300
17 3300005535 Ga0070684_100042699 Ga0070684_1000426992 302
18 3300006237 Ga0097621_100039276 Ga0097621_1000392762 302
19 3300025944 Ga0207661_10021989 Ga0207661_100219895 302
20 3300030760 Ga0265762_1000116 Ga0265762_10001169 302
21 3300049579 Ga0501043_0015240 Ga0501043_0015240_2915_3871 302
22 3300049581 Ga0501047_0017959 Ga0501047_0017959_4468_5424 302
23 3300049744 Ga0501083_0006674 Ga0501083_0006674_2158_3114 302
24 3300054114 Ga0501084_0008312 Ga0501084_0008312_5850_6806 302
25 3300060353 Ga0501082_0216432 Ga0501082_0216432_32_988 302
26 3300009177 Ga0105248_10270875 Ga0105248_102708752 303
27 3300025928 Ga0207700_10024988 Ga0207700_100249883 303
28 3300009093 Ga0105240_10000161 Ga0105240_1000016175 304
29 3300009094 Ga0111539_10214441 Ga0111539_102144412 304
30 3300025913 Ga0207695_10000693 Ga0207695_1000069346 304
31 3300031548 Ga0307408_100110828 Ga0307408_1001108281 304
32 3300035116 Ga0373945_0060547 Ga0373945_0060547_145_1122 304
33 3300035170 Ga0373943_0040390 Ga0373943_0040390_1084_2061 304
34 3300035410 Ga0373924_0003372 Ga0373924_0003372_1240_2217 304
35 3300035692 Ga0373935_0006632 Ga0373935_0006632_5828_6805 304
36 3300037068 Ga0373925_0048158 Ga0373925_0048158_1776_2753 304
37 3300046684 Ga0495669_0000991 Ga0495669_0000991_2725_3714 304
38 3300049582 Ga0501048_0335269 Ga0501048_0335269_13_927 304
39 3300003322 rootL2_10275660 rootL2_102756602 305
40 3300006358 Ga0068871_100080692 Ga0068871_1000806922 305
41 3300005436 Ga0070713_100192653 Ga0070713_1001926532 306
42 3300009094 Ga0111539_10026226 Ga0111539_100262262 306
43 3300009094 Ga0111539_10036740 Ga0111539_100367404 306
44 3300025928 Ga0207700_10069925 Ga0207700_100699252 306
45 3300050511 nmdc:mga08y16_12992_c1 nmdc:mga08y16_12992_c1_7436_8410 306
46 3300050511 nmdc:mga08y16_217501_c1 nmdc:mga08y16_217501_c1_623_1576 306
47 3300031731 Ga0307405_10077866 Ga0307405_100778661 307
48 3300032002 Ga0307416_100081440 Ga0307416_1000814401 307
49 3300049586 Ga0501070_0141430 Ga0501070_0141430_47_970 307
50 3300059421 Ga0590071_002424 Ga0590071_002424_2415_3374 307
51 3300059424 Ga0590075_005018 Ga0590075_005018_88_1047 307
52 3300009093 Ga0105240_10239535 Ga0105240_102395351 308
53 3300049591 Ga0501075_0031140 Ga0501075_0031140_844_1806 308
54 3300053104 Ga0500556_0006751 Ga0500556_0006751_1580_2560 308
55 3300005536 Ga0070697_100032232 Ga0070697_1000322325 309
56 3300031235 Ga0265330_10005484 Ga0265330_100054847 309
57 3300046517 Ga0495630_0026718 Ga0495630_0026718_304_1329 309
58 3300049742 Ga0501080_0102524 Ga0501080_0102524_1495_2451 309
59 3300049744 Ga0501083_0001858 Ga0501083_0001858_4616_5572 309
60 3300050515 nmdc:mga0a205_46822_c1 nmdc:mga0a205_46822_c1_2497_3456 309
61 3300060353 Ga0501082_0436636 Ga0501082_0436636_117_1073 309
62 3300033547 Ga0316212_1003932 Ga0316212_10039324 310
63 3300044694 Ga0466963_0049475 Ga0466963_0049475_345_1319 310
64 3300047320 Ga0495672_0055485 Ga0495672_0055485_658_1629 310
65 3300049574 Ga0501038_0057746 Ga0501038_0057746_431_1387 310
66 3300005617 Ga0068859_100162576 Ga0068859_1001625762 311
67 3300006931 Ga0097620_100162582 Ga0097620_1001625822 311
68 3300009553 Ga0105249_10406595 Ga0105249_104065952 311
69 3300025961 Ga0207712_10198434 Ga0207712_101984341 311
70 3300035695 Ga0373927_0072792 Ga0373927_0072792_198_1193 311
71 3300037068 Ga0373925_0021655 Ga0373925_0021655_871_1866 311
72 3300046459 Ga0495629_0021849 Ga0495629_0021849_1938_2933 311
73 3300046472 Ga0495580_0004272 Ga0495580_0004272_2919_3914 311
74 3300046683 Ga0495658_0013179 Ga0495658_0013179_331_1329 311
75 3300005435 Ga0070714_100000183 Ga0070714_10000018322 312
76 3300005435 Ga0070714_100210082 Ga0070714_1002100822 312
77 3300005435 Ga0070714_100238223 Ga0070714_1002382232 312
78 3300005439 Ga0070711_100016954 Ga0070711_1000169542 312
79 3300005455 Ga0070663_100407052 Ga0070663_1004070521 312
80 3300006358 Ga0068871_100009308 Ga0068871_1000093085 312
81 3300006914 Ga0075436_100001547 Ga0075436_10000154710 312
82 3300009093 Ga0105240_10322798 Ga0105240_103227982 312
83 3300013307 Ga0157372_10187711 Ga0157372_101877113 312
84 3300025916 Ga0207663_10014875 Ga0207663_100148753 312
85 3300025929 Ga0207664_10000212 Ga0207664_1000021214 312
86 3300025929 Ga0207664_10360700 Ga0207664_103607001 312
87 3300035083 Ga0373926_0017457 Ga0373926_0017457_882_1871 312
88 3300035111 Ga0373923_0001393 Ga0373923_0001393_4202_5191 312
89 3300035113 Ga0373936_0000319 Ga0373936_0000319_1169_2158 312
90 3300035170 Ga0373943_0000016 Ga0373943_0000016_52314_53303 312
91 3300035171 Ga0373946_0019422 Ga0373946_0019422_340_1329 312
92 3300035410 Ga0373924_0031217 Ga0373924_0031217_988_1977 312
93 3300035692 Ga0373935_0000864 Ga0373935_0000864_9217_10206 312
94 3300035695 Ga0373927_0000034 Ga0373927_0000034_41985_42974 312
95 3300035724 Ga0373933_0015818 Ga0373933_0015818_1539_2528 312
96 3300035725 Ga0373947_0000035 Ga0373947_0000035_42023_43012 312
97 3300037068 Ga0373925_0000714 Ga0373925_0000714_9381_10370 312
98 3300046472 Ga0495580_0022694 Ga0495580_0022694_3200_4189 312
99 3300046517 Ga0495630_0011837 Ga0495630_0011837_513_1502 312
100 3300046689 Ga0495613_0177997 Ga0495613_0177997_55_1050 312
101 3300048088 Ga0495602_0103606 Ga0495602_0103606_926_1915 312
102 3300050514 nmdc:mga08x19_7007_c1 nmdc:mga08x19_7007_c1_4584_5579 312
103 3300005842 Ga0068858_100005150 Ga0068858_1000051503 313
104 3300006173 Ga0070716_100008843 Ga0070716_1000088435 313
105 3300006175 Ga0070712_100006918 Ga0070712_1000069183 313
106 3300009093 Ga0105240_10034509 Ga0105240_100345093 313
107 3300013297 Ga0157378_10124723 Ga0157378_101247232 313
108 3300014968 Ga0157379_10012865 Ga0157379_100128657 313
109 3300025913 Ga0207695_10115452 Ga0207695_101154522 313
110 3300025915 Ga0207693_10016140 Ga0207693_100161407 313
111 3300028800 Ga0265338_10004251 Ga0265338_100042515 313
112 3300035725 Ga0373947_0039779 Ga0373947_0039779_251_1192 313
113 3300042015 Ga0439462_0031366 Ga0439462_0031366_166_1107 313
114 3300048903 Ga0496100_0038130 Ga0496100_0038130_176_1150 313
115 3300048917 Ga0496114_0021153 Ga0496114_0021153_3924_4898 313
116 3300049584 Ga0501068_0019437 Ga0501068_0019437_980_1936 313
117 3300009094 Ga0111539_10147796 Ga0111539_101477963 314
118 3300046689 Ga0495613_0178872 Ga0495613_0178872_320_1294 314
119 3300048904 Ga0496101_0243345 Ga0496101_0243345_321_1295 314
120 3300050511 nmdc:mga08y16_300757_c1 nmdc:mga08y16_300757_c1_74_1033 314
121 3300006028 Ga0070717_10047746 Ga0070717_100477461 315
122 3300046675 Ga0495657_0220848 Ga0495657_0220848_35_1030 315
123 3300005331 Ga0070670_100028745 Ga0070670_1000287453 316
124 3300005467 Ga0070706_100027595 Ga0070706_1000275952 316
125 3300014325 Ga0163163_10124386 Ga0163163_101243862 316
126 3300025910 Ga0207684_10103525 Ga0207684_101035253 316
127 3300041512 Ga0451853_2499464 Ga0451853_2499464_131_1087 316
128 3300048915 Ga0496112_0129203 Ga0496112_0129203_668_1618 316
129 3300005340 Ga0070689_100378163 Ga0070689_1003781631 317
130 3300005445 Ga0070708_100039959 Ga0070708_1000399595 317
131 3300005471 Ga0070698_100000903 Ga0070698_1000009032 317
132 3300005536 Ga0070697_100001021 Ga0070697_10000102116 317
133 3300006028 Ga0070717_10224788 Ga0070717_102247882 317
134 3300013306 Ga0163162_10092330 Ga0163162_100923302 317
135 3300014325 Ga0163163_10387049 Ga0163163_103870491 317
136 3300025910 Ga0207684_10000768 Ga0207684_1000076830 317
137 3300025922 Ga0207646_10102475 Ga0207646_101024752 317
138 3300025923 Ga0207681_10228297 Ga0207681_102282971 317
139 3300025936 Ga0207670_10053185 Ga0207670_100531852 317
140 3300026088 Ga0207641_10068485 Ga0207641_100684852 317
141 3300032002 Ga0307416_100040415 Ga0307416_1000404152 317
142 3300037418 Ga0395900_0460942 Ga0395900_0460942_254_1216 317
143 3300046809 Ga0495600_0133668 Ga0495600_0133668_286_1239 317
144 3300011119 Ga0105246_10070999 Ga0105246_100709993 318
145 3300025926 Ga0207659_10145002 Ga0207659_101450022 318
146 3300049568 Ga0501031_0038147 Ga0501031_0038147_1779_2735 318
147 3300049569 Ga0501032_0018387 Ga0501032_0018387_2900_3856 318
148 3300049571 Ga0501034_0013627 Ga0501034_0013627_639_1595 318
149 3300049571 Ga0501034_0040164 Ga0501034_0040164_1172_2128 318
150 3300049571 Ga0501034_0305587 Ga0501034_0305587_227_1183 318
151 3300049572 Ga0501036_0030799 Ga0501036_0030799_1508_2464 318
152 3300049572 Ga0501036_0062073 Ga0501036_0062073_1743_2699 318
153 3300049573 Ga0501037_0108903 Ga0501037_0108903_758_1714 318
154 3300049574 Ga0501038_0034756 Ga0501038_0034756_3154_4110 318
155 3300049574 Ga0501038_0057722 Ga0501038_0057722_1292_2248 318
156 3300049575 Ga0501039_0003109 Ga0501039_0003109_1956_2912 318
157 3300049579 Ga0501043_0243822 Ga0501043_0243822_405_1361 318
158 3300049580 Ga0501046_0028314 Ga0501046_0028314_1095_2051 318
159 3300049580 Ga0501046_0029522 Ga0501046_0029522_2176_3132 318
160 3300049581 Ga0501047_0061399 Ga0501047_0061399_733_1689 318
161 3300049581 Ga0501047_0287344 Ga0501047_0287344_367_1323 318
162 3300049581 Ga0501047_0400480 Ga0501047_0400480_132_1088 318
163 3300049582 Ga0501048_0135043 Ga0501048_0135043_639_1595 318
164 3300049584 Ga0501068_0056767 Ga0501068_0056767_1371_2327 318
165 3300049588 Ga0501072_0076605 Ga0501072_0076605_376_1332 318
166 3300049589 Ga0501073_0097468 Ga0501073_0097468_421_1377 318
167 3300049590 Ga0501074_0140727 Ga0501074_0140727_201_1157 318
168 3300049742 Ga0501080_0066274 Ga0501080_0066274_2309_3265 318
169 3300049743 Ga0501081_0396110 Ga0501081_0396110_42_998 318
170 3300049822 Ga0501035_0120812 Ga0501035_0120812_918_1874 318
171 3300049823 Ga0501044_0033918 Ga0501044_0033918_1561_2517 318
172 3300005295 Ga0065707_10004371 Ga0065707_100043712 319
173 3300005353 Ga0070669_100026243 Ga0070669_1000262432 319
174 3300005354 Ga0070675_100306670 Ga0070675_1003066702 319
175 3300005354 Ga0070675_100334793 Ga0070675_1003347932 319
176 3300005458 Ga0070681_10149409 Ga0070681_101494092 319
177 3300005577 Ga0068857_100239962 Ga0068857_1002399622 319
178 3300006844 Ga0075428_100000607 Ga0075428_1000006077 319
179 3300006844 Ga0075428_100224083 Ga0075428_1002240832 319
180 3300006847 Ga0075431_100303010 Ga0075431_1003030102 319
181 3300006852 Ga0075433_10149908 Ga0075433_101499083 319
182 3300006871 Ga0075434_100001079 Ga0075434_1000010797 319
183 3300006914 Ga0075436_100142659 Ga0075436_1001426592 319
184 3300009094 Ga0111539_10000455 Ga0111539_1000045514 319
185 3300009147 Ga0114129_10004180 Ga0114129_100041808 319
186 3300009147 Ga0114129_10235763 Ga0114129_102357632 319
187 3300009553 Ga0105249_10100646 Ga0105249_101006462 319
188 3300014326 Ga0157380_10006237 Ga0157380_100062372 319
189 3300025926 Ga0207659_10157992 Ga0207659_101579922 319
190 3300026118 Ga0207675_100027963 Ga0207675_1000279632 319
191 3300027907 Ga0207428_10000435 Ga0207428_1000043513 319
192 3300031903 Ga0307407_10156535 Ga0307407_101565352 319
193 3300032002 Ga0307416_100117482 Ga0307416_1001174822 319
194 3300035113 Ga0373936_0090408 Ga0373936_0090408_66_1025 319
195 3300049572 Ga0501036_0194759 Ga0501036_0194759_218_1177 319
196 3300049578 Ga0501042_0014107 Ga0501042_0014107_465_1424 319
197 3300049587 Ga0501071_0016257 Ga0501071_0016257_2914_3873 319
198 3300049587 Ga0501071_0138459 Ga0501071_0138459_649_1608 319
199 3300049588 Ga0501072_0070436 Ga0501072_0070436_608_1567 319
200 3300049591 Ga0501075_0044998 Ga0501075_0044998_1118_2077 319
201 3300049591 Ga0501075_0048456 Ga0501075_0048456_547_1506 319
202 3300049741 Ga0501079_0108957 Ga0501079_0108957_788_1747 319
203 3300049824 Ga0501045_0188994 Ga0501045_0188994_530_1489 319
204 3300050507 nmdc:mga05p37_55969_c1 nmdc:mga05p37_55969_c1_3095_4054 319
205 3300050507 nmdc:mga05p37_7276_c1 nmdc:mga05p37_7276_c1_10023_10982 319
206 3300050510 nmdc:mga06r32_304824_c1 nmdc:mga06r32_304824_c1_105_1070 319
207 3300050511 nmdc:mga08y16_12_c1 nmdc:mga08y16_12_c1_393339_394304 319
208 3300050512 nmdc:mga0n895_12161_c1 nmdc:mga0n895_12161_c1_3627_4586 319
209 3300050514 nmdc:mga08x19_74010_c1 nmdc:mga08x19_74010_c1_412_1398 319
210 3300050515 nmdc:mga0a205_61308_c1 nmdc:mga0a205_61308_c1_303_1262 319
211 3300060353 Ga0501082_0019066 Ga0501082_0019066_4676_5641 319
212 3300060353 Ga0501082_0369400 Ga0501082_0369400_66_1025 319
213 3300005354 Ga0070675_100000540 Ga0070675_1000005408 320
214 3300005719 Ga0068861_100360143 Ga0068861_1003601431 320
215 3300006844 Ga0075428_100131714 Ga0075428_1001317142 320
216 3300028381 Ga0268264_10096896 Ga0268264_100968961 320
217 3300031548 Ga0307408_100152467 Ga0307408_1001524672 320
218 3300049568 Ga0501031_0065791 Ga0501031_0065791_1061_2023 320
219 3300049572 Ga0501036_0395569 Ga0501036_0395569_14_976 320
220 3300049575 Ga0501039_0089362 Ga0501039_0089362_646_1608 320
221 3300049577 Ga0501041_0072689 Ga0501041_0072689_444_1406 320
222 3300049582 Ga0501048_0090923 Ga0501048_0090923_815_1777 320
223 3300049588 Ga0501072_0068282 Ga0501072_0068282_1081_2043 320
224 3300049588 Ga0501072_0187445 Ga0501072_0187445_657_1619 320
225 3300049741 Ga0501079_0022743 Ga0501079_0022743_472_1434 320
226 3300049741 Ga0501079_0215736 Ga0501079_0215736_282_1247 320
227 3300049824 Ga0501045_0010280 Ga0501045_0010280_4348_5310 320
228 3300060353 Ga0501082_0124815 Ga0501082_0124815_36_998 320
229 3300060353 Ga0501082_0190359 Ga0501082_0190359_214_1176 320
230 3300005436 Ga0070713_100005356 Ga0070713_1000053565 321
231 3300005617 Ga0068859_100244109 Ga0068859_1002441092 321
232 3300006847 Ga0075431_100120429 Ga0075431_1001204292 321
233 3300006847 Ga0075431_100210048 Ga0075431_1002100482 321
234 3300006931 Ga0097620_100244113 Ga0097620_1002441132 321
235 3300009101 Ga0105247_10089205 Ga0105247_100892052 321
236 3300013104 Ga0157370_10469306 Ga0157370_104693061 321
237 3300025900 Ga0207710_10075068 Ga0207710_100750681 321
238 3300025906 Ga0207699_10067586 Ga0207699_100675862 321
239 3300025910 Ga0207684_10016448 Ga0207684_100164481 321
240 3300031903 Ga0307407_10181292 Ga0307407_101812922 321
241 3300031911 Ga0307412_10046266 Ga0307412_100462662 321
242 3300035111 Ga0373923_0038824 Ga0373923_0038824_681_1646 321
243 3300046459 Ga0495629_0077853 Ga0495629_0077853_913_1878 321
244 3300046517 Ga0495630_0001984 Ga0495630_0001984_3760_4725 321
245 3300046559 Ga0495667_0043718 Ga0495667_0043718_978_1943 321
246 3300046689 Ga0495613_0000670 Ga0495613_0000670_16858_17823 321
247 3300046809 Ga0495600_0016234 Ga0495600_0016234_1907_2872 321
248 3300047315 Ga0495581_0029073 Ga0495581_0029073_1356_2321 321
249 3300047317 Ga0495604_0042957 Ga0495604_0042957_631_1596 321
250 3300047319 Ga0495674_0016645 Ga0495674_0016645_5098_6063 321
251 3300047471 Ga0495684_0009482 Ga0495684_0009482_2398_3363 321
252 3300050510 nmdc:mga06r32_135894_c1 nmdc:mga06r32_135894_c1_966_1931 321
253 3300050510 nmdc:mga06r32_141739_c1 nmdc:mga06r32_141739_c1_663_1628 321
254 3300050515 nmdc:mga0a205_312391_c1 nmdc:mga0a205_312391_c1_458_1423 321
255 3300053077 Ga0495601_0001213 Ga0495601_0001213_4078_5043 321
256 3300053084 Ga0495595_0098264 Ga0495595_0098264_82_1047 321
257 3300053085 Ga0495619_0022944 Ga0495619_0022944_2384_3349 321
258 3300005843 Ga0068860_100170019 Ga0068860_1001700192 322
259 3300009551 Ga0105238_10155748 Ga0105238_101557483 322
260 3300025927 Ga0207687_10103813 Ga0207687_101038132 322
261 3300025934 Ga0207686_10085966 Ga0207686_100859662 322
262 3300031548 Ga0307408_100287197 Ga0307408_1002871972 322
263 3300032005 Ga0307411_10125471 Ga0307411_101254712 322
264 3300032126 Ga0307415_100503072 Ga0307415_1005030721 322
265 3300046454 Ga0495592_0139215 Ga0495592_0139215_687_1667 322
266 3300005331 Ga0070670_100185509 Ga0070670_1001855092 323
267 3300005340 Ga0070689_100211075 Ga0070689_1002110752 323
268 3300005340 Ga0070689_100316094 Ga0070689_1003160941 323
269 3300005347 Ga0070668_100379771 Ga0070668_1003797712 323
270 3300005471 Ga0070698_100037349 Ga0070698_1000373493 323
271 3300006844 Ga0075428_100069652 Ga0075428_1000696522 323
272 3300006852 Ga0075433_10171943 Ga0075433_101719432 323
273 3300006914 Ga0075436_100006024 Ga0075436_1000060243 323
274 3300006914 Ga0075436_100007392 Ga0075436_1000073922 323
275 3300009101 Ga0105247_10024056 Ga0105247_100240563 323
276 3300009176 Ga0105242_10115686 Ga0105242_101156862 323
277 3300009176 Ga0105242_10188353 Ga0105242_101883532 323
278 3300013105 Ga0157369_10284298 Ga0157369_102842982 323
279 3300013308 Ga0157375_10043801 Ga0157375_100438016 323
280 3300014325 Ga0163163_10157889 Ga0163163_101578894 323
281 3300014325 Ga0163163_10475204 Ga0163163_104752041 323
282 3300025912 Ga0207707_10177050 Ga0207707_101770501 323
283 3300025922 Ga0207646_10320823 Ga0207646_103208231 323
284 3300025936 Ga0207670_10326769 Ga0207670_103267692 323
285 3300026075 Ga0207708_10353370 Ga0207708_103533701 323
286 3300046477 Ga0495664_0049533 Ga0495664_0049533_519_1496 323
287 3300046536 Ga0495587_0077896 Ga0495587_0077896_622_1599 323
288 3300046663 Ga0495635_0179857 Ga0495635_0179857_117_1094 323
289 3300047317 Ga0495604_0032592 Ga0495604_0032592_18_995 323
290 3300047444 Ga0495675_0013233 Ga0495675_0013233_3984_4961 323
291 3300048907 Ga0496104_0091926 Ga0496104_0091926_1832_2803 323
292 3300048915 Ga0496112_0212238 Ga0496112_0212238_509_1486 323
293 3300049591 Ga0501075_0000178 Ga0501075_0000178_670_1641 323
294 3300049744 Ga0501083_0215208 Ga0501083_0215208_122_1093 323
295 3300050507 nmdc:mga05p37_403642_c1 nmdc:mga05p37_403642_c1_221_1192 323
296 3300050511 nmdc:mga08y16_240155_c1 nmdc:mga08y16_240155_c1_847_1818 323
297 3300050515 nmdc:mga0a205_358808_c1 nmdc:mga0a205_358808_c1_217_1188 323
298 3300060353 Ga0501082_0016755 Ga0501082_0016755_54_1025 323
299 3300003203 JGI25406J46586_10006285 JGI25406J46586_100062853 324
300 3300005458 Ga0070681_10075687 Ga0070681_100756875 324
301 3300005614 Ga0068856_100120678 Ga0068856_1001206783 324
302 3300005985 Ga0081539_10001175 Ga0081539_100011756 324
303 3300006847 Ga0075431_100227038 Ga0075431_1002270382 324
304 3300009177 Ga0105248_10112311 Ga0105248_101123113 324
305 3300014326 Ga0157380_10535390 Ga0157380_105353902 324
306 3300025941 Ga0207711_10143206 Ga0207711_101432063 324
307 3300031712 Ga0265342_10061692 Ga0265342_100616922 324
308 3300044656 Ga0466969_0056413 Ga0466969_0056413_704_1687 324
309 3300045049 Ga0466959_0209135 Ga0466959_0209135_97_1080 324
310 3300048929 Ga0496126_0006296 Ga0496126_0006296_6703_7683 324
311 3300049576 Ga0501040_0201743 Ga0501040_0201743_402_1382 324
312 3300050513 nmdc:mga0rr50_189626_c1 nmdc:mga0rr50_189626_c1_330_1310 324
313 3300060353 Ga0501082_0149188 Ga0501082_0149188_836_1810 324
314 3300061734 Ga0530510_0286292 Ga0530510_0286292_208_1188 324
315 3300005328 Ga0070676_10283478 Ga0070676_102834781 325
316 3300005338 Ga0068868_100041733 Ga0068868_1000417332 325
317 3300005355 Ga0070671_100444554 Ga0070671_1004445541 325
318 3300005366 Ga0070659_100311291 Ga0070659_1003112912 325
319 3300005434 Ga0070709_10000305 Ga0070709_1000030526 325
320 3300005434 Ga0070709_10080178 Ga0070709_100801784 325
321 3300005435 Ga0070714_100249898 Ga0070714_1002498982 325
322 3300005435 Ga0070714_100366743 Ga0070714_1003667432 325
323 3300005436 Ga0070713_100000922 Ga0070713_10000092217 325
324 3300005436 Ga0070713_100008454 Ga0070713_1000084548 325
325 3300005436 Ga0070713_100302161 Ga0070713_1003021612 325
326 3300005438 Ga0070701_10123076 Ga0070701_101230762 325
327 3300005439 Ga0070711_100135456 Ga0070711_1001354562 325
328 3300005444 Ga0070694_100001871 Ga0070694_1000018713 325
329 3300005458 Ga0070681_10304639 Ga0070681_103046392 325
330 3300005468 Ga0070707_100000144 Ga0070707_10000014421 325
331 3300005535 Ga0070684_100176690 Ga0070684_1001766902 325
332 3300005548 Ga0070665_100590653 Ga0070665_1005906531 325
333 3300005563 Ga0068855_100108486 Ga0068855_1001084864 325
334 3300005563 Ga0068855_100337298 Ga0068855_1003372982 325
335 3300005564 Ga0070664_100106944 Ga0070664_1001069441 325
336 3300005578 Ga0068854_100123985 Ga0068854_1001239852 325
337 3300005618 Ga0068864_100243346 Ga0068864_1002433462 325
338 3300005841 Ga0068863_100023970 Ga0068863_1000239707 325
339 3300005842 Ga0068858_100078685 Ga0068858_1000786852 325
340 3300005843 Ga0068860_100091141 Ga0068860_1000911414 325
341 3300005937 Ga0081455_10008282 Ga0081455_100082826 325
342 3300005937 Ga0081455_10301905 Ga0081455_103019051 325
343 3300006028 Ga0070717_10216772 Ga0070717_102167722 325
344 3300006175 Ga0070712_100006553 Ga0070712_1000065534 325
345 3300006175 Ga0070712_100010851 Ga0070712_1000108515 325
346 3300006358 Ga0068871_100005759 Ga0068871_1000057595 325
347 3300006847 Ga0075431_100017181 Ga0075431_1000171816 325
348 3300006847 Ga0075431_100130750 Ga0075431_1001307502 325
349 3300009094 Ga0111539_10442945 Ga0111539_104429452 325
350 3300009098 Ga0105245_10041692 Ga0105245_100416922 325
351 3300009174 Ga0105241_10025623 Ga0105241_100256237 325
352 3300009176 Ga0105242_10016443 Ga0105242_100164433 325
353 3300009177 Ga0105248_10081845 Ga0105248_100818453 325
354 3300009551 Ga0105238_10091729 Ga0105238_100917293 325
355 3300009553 Ga0105249_10090776 Ga0105249_100907762 325
356 3300010375 Ga0105239_10086301 Ga0105239_100863012 325
357 3300013296 Ga0157374_10033131 Ga0157374_100331316 325
358 3300013296 Ga0157374_10088066 Ga0157374_100880662 325
359 3300013297 Ga0157378_10000145 Ga0157378_1000014531 325
360 3300013306 Ga0163162_10145019 Ga0163162_101450192 325
361 3300014325 Ga0163163_10072291 Ga0163163_100722915 325
362 3300014969 Ga0157376_10202439 Ga0157376_102024393 325
363 3300021361 Ga0213872_10010735 Ga0213872_100107354 325
364 3300021361 Ga0213872_10014357 Ga0213872_100143573 325
365 3300021441 Ga0213871_10004023 Ga0213871_100040233 325
366 3300025906 Ga0207699_10009701 Ga0207699_100097014 325
367 3300025906 Ga0207699_10094136 Ga0207699_100941364 325
368 3300025911 Ga0207654_10057441 Ga0207654_100574411 325
369 3300025915 Ga0207693_10000067 Ga0207693_100000675 325
370 3300025915 Ga0207693_10020519 Ga0207693_100205194 325
371 3300025922 Ga0207646_10000298 Ga0207646_1000029820 325
372 3300025927 Ga0207687_10009003 Ga0207687_100090033 325
373 3300025928 Ga0207700_10018505 Ga0207700_100185052 325
374 3300025928 Ga0207700_10021041 Ga0207700_100210414 325
375 3300025928 Ga0207700_10217945 Ga0207700_102179452 325
376 3300025929 Ga0207664_10079541 Ga0207664_100795414 325
377 3300025929 Ga0207664_10314724 Ga0207664_103147242 325
378 3300025941 Ga0207711_10074950 Ga0207711_100749502 325
379 3300025945 Ga0207679_10216949 Ga0207679_102169491 325
380 3300025949 Ga0207667_10066067 Ga0207667_100660674 325
381 3300025949 Ga0207667_10326491 Ga0207667_103264912 325
382 3300025961 Ga0207712_10142518 Ga0207712_101425182 325
383 3300026035 Ga0207703_10105216 Ga0207703_101052162 325
384 3300026088 Ga0207641_10063347 Ga0207641_100633471 325
385 3300026095 Ga0207676_10032451 Ga0207676_100324517 325
386 3300027907 Ga0207428_10000846 Ga0207428_1000084621 325
387 3300028381 Ga0268264_10066451 Ga0268264_100664513 325
388 3300031548 Ga0307408_100012830 Ga0307408_1000128306 325
389 3300031731 Ga0307405_10036139 Ga0307405_100361392 325
390 3300031852 Ga0307410_10004067 Ga0307410_100040673 325
391 3300031852 Ga0307410_10135625 Ga0307410_101356252 325
392 3300031901 Ga0307406_10081672 Ga0307406_100816724 325
393 3300031995 Ga0307409_100030864 Ga0307409_1000308643 325
394 3300032002 Ga0307416_100061300 Ga0307416_1000613003 325
395 3300032002 Ga0307416_100354754 Ga0307416_1003547542 325
396 3300032002 Ga0307416_100463725 Ga0307416_1004637252 325
397 3300032005 Ga0307411_10006952 Ga0307411_100069526 325
398 3300032005 Ga0307411_10282574 Ga0307411_102825741 325
399 3300032126 Ga0307415_100010919 Ga0307415_1000109194 325
400 3300037466 Ga0395898_0177640 Ga0395898_0177640_187_1173 325
401 3300037471 Ga0395905_0003951 Ga0395905_0003951_10031_11020 325
402 3300037471 Ga0395905_0026624 Ga0395905_0026624_614_1600 325
403 3300037471 Ga0395905_0070863 Ga0395905_0070863_568_1554 325
404 3300037471 Ga0395905_0092192 Ga0395905_0092192_1688_2674 325
405 3300038443 Ga0395901_0219459 Ga0395901_0219459_94_1080 325
406 3300039438 Ga0436360_0174134 Ga0436360_0174134_324_1313 325
407 3300039447 Ga0436361_0534152 Ga0436361_0534152_33_1022 325
408 3300039447 Ga0436361_0620753 Ga0436361_0620753_3775_4764 325
409 3300039447 Ga0436361_0635090 Ga0436361_0635090_5532_6521 325
410 3300039447 Ga0436361_0706896 Ga0436361_0706896_33_1022 325
411 3300039453 Ga0436362_0906121 Ga0436362_0906121_276_1265 325
412 3300045051 Ga0451576_0531076 Ga0451576_0531076_151_1137 325
413 3300046472 Ga0495580_0098837 Ga0495580_0098837_269_1255 325
414 3300046472 Ga0495580_0132859 Ga0495580_0132859_671_1657 325
415 3300046517 Ga0495630_0120901 Ga0495630_0120901_986_1966 325
416 3300046684 Ga0495669_0002685 Ga0495669_0002685_5750_6736 325
417 3300046684 Ga0495669_0074677 Ga0495669_0074677_437_1426 325
418 3300047318 Ga0495636_0048202 Ga0495636_0048202_15_1004 325
419 3300047445 Ga0495677_0090568 Ga0495677_0090568_57_1043 325
420 3300047471 Ga0495684_0187855 Ga0495684_0187855_396_1376 325
421 3300048907 Ga0496104_0299112 Ga0496104_0299112_297_1283 325
422 3300048912 Ga0496109_0000080 Ga0496109_0000080_48979_49962 325
423 3300048912 Ga0496109_0031502 Ga0496109_0031502_3362_4348 325
424 3300048914 Ga0496111_0115526 Ga0496111_0115526_45_1031 325
425 3300048918 Ga0496115_0260447 Ga0496115_0260447_310_1296 325
426 3300048918 Ga0496115_0471910 Ga0496115_0471910_11_1000 325
427 3300049577 Ga0501041_0205129 Ga0501041_0205129_210_1193 325
428 3300049592 Ga0501076_0411308 Ga0501076_0411308_103_1086 325
429 3300050507 nmdc:mga05p37_234728_c1 nmdc:mga05p37_234728_c1_523_1506 325
430 3300050507 nmdc:mga05p37_7249_c1 nmdc:mga05p37_7249_c1_1857_2840 325
431 3300050510 nmdc:mga06r32_13473_c1 nmdc:mga06r32_13473_c1_1684_2667 325
432 3300050511 nmdc:mga08y16_10941_c1 nmdc:mga08y16_10941_c1_3914_4897 325
433 3300050514 nmdc:mga08x19_24788_c1 nmdc:mga08x19_24788_c1_2563_3549 325
434 3300053103 Ga0500555_003375 Ga0500555_003375_709_1692 325
435 3300005436 Ga0070713_100058345 Ga0070713_1000583452 326
436 3300005439 Ga0070711_100112889 Ga0070711_1001128891 326
437 3300005439 Ga0070711_100113762 Ga0070711_1001137622 326
438 3300005458 Ga0070681_10035282 Ga0070681_100352827 326
439 3300005458 Ga0070681_10176878 Ga0070681_101768783 326
440 3300005530 Ga0070679_100009060 Ga0070679_1000090604 326
441 3300006175 Ga0070712_100001229 Ga0070712_1000012292 326
442 3300009093 Ga0105240_10338304 Ga0105240_103383042 326
443 3300013105 Ga0157369_10362392 Ga0157369_103623922 326
444 3300025915 Ga0207693_10001517 Ga0207693_1000151710 326
445 3300025916 Ga0207663_10031992 Ga0207663_100319922 326
446 3300025916 Ga0207663_10041091 Ga0207663_100410912 326
447 3300037068 Ga0373925_0178622 Ga0373925_0178622_73_1059 326
448 3300044694 Ga0466963_0049233 Ga0466963_0049233_544_1539 326
449 3300044842 Ga0466957_0018353 Ga0466957_0018353_334_1329 326
450 3300045976 Ga0466967_0114172 Ga0466967_0114172_750_1745 326
451 3300046472 Ga0495580_0001606 Ga0495580_0001606_2947_3933 326
452 3300046472 Ga0495580_0002290 Ga0495580_0002290_15484_16470 326
453 3300046472 Ga0495580_0023751 Ga0495580_0023751_2917_3903 326
454 3300046472 Ga0495580_0092740 Ga0495580_0092740_1047_2033 326
455 3300048915 Ga0496112_0173849 Ga0496112_0173849_864_1850 326
456 2162886012 MBSR1b_contig_175413 MBSR1b_0646.00001650 327
457 3300001976 JGI24752J21851_1001100 JGI24752J21851_10011003 327
458 3300001991 JGI24743J22301_10004790 JGI24743J22301_100047902 327
459 3300002239 JGI24034J26672_10002560 JGI24034J26672_100025601 327
460 3300002459 JGI24751J29686_10000704 JGI24751J29686_100007047 327
461 3300004799 Ga0058863_10071160 Ga0058863_100711603 327
462 3300004800 Ga0058861_10063203 Ga0058861_100632032 327
463 3300004803 Ga0058862_12859213 Ga0058862_128592132 327
464 3300005290 Ga0065712_10086452 Ga0065712_100864522 327
465 3300005327 Ga0070658_10026605 Ga0070658_100266053 327
466 3300005327 Ga0070658_10200115 Ga0070658_102001152 327
467 3300005329 Ga0070683_100014673 Ga0070683_1000146737 327
468 3300005329 Ga0070683_100035951 Ga0070683_1000359514 327
469 3300005329 Ga0070683_100049622 Ga0070683_1000496222 327
470 3300005329 Ga0070683_100073338 Ga0070683_1000733383 327
471 3300005330 Ga0070690_100136925 Ga0070690_1001369252 327
472 3300005331 Ga0070670_100017910 Ga0070670_1000179106 327
473 3300005331 Ga0070670_100219703 Ga0070670_1002197033 327
474 3300005334 Ga0068869_100002638 Ga0068869_1000026386 327
475 3300005334 Ga0068869_100011661 Ga0068869_1000116612 327
476 3300005334 Ga0068869_100108457 Ga0068869_1001084571 327
477 3300005334 Ga0068869_100270622 Ga0068869_1002706221 327
478 3300005335 Ga0070666_10062094 Ga0070666_100620943 327
479 3300005336 Ga0070680_100002009 Ga0070680_10000200911 327
480 3300005336 Ga0070680_100045686 Ga0070680_1000456866 327
481 3300005337 Ga0070682_100009784 Ga0070682_1000097843 327
482 3300005337 Ga0070682_100026601 Ga0070682_1000266013 327
483 3300005337 Ga0070682_100188497 Ga0070682_1001884971 327
484 3300005338 Ga0068868_100001549 Ga0068868_10000154914 327
485 3300005338 Ga0068868_100002221 Ga0068868_10000222112 327
486 3300005338 Ga0068868_100005847 Ga0068868_1000058473 327
487 3300005338 Ga0068868_100026930 Ga0068868_1000269303 327
488 3300005338 Ga0068868_100049830 Ga0068868_1000498305 327
489 3300005339 Ga0070660_100108420 Ga0070660_1001084204 327
490 3300005339 Ga0070660_100116335 Ga0070660_1001163352 327
491 3300005340 Ga0070689_100001794 Ga0070689_1000017943 327
492 3300005340 Ga0070689_100255251 Ga0070689_1002552511 327
493 3300005343 Ga0070687_100124473 Ga0070687_1001244731 327
494 3300005343 Ga0070687_100170452 Ga0070687_1001704522 327
495 3300005344 Ga0070661_100005410 Ga0070661_1000054103 327
496 3300005344 Ga0070661_100023061 Ga0070661_1000230615 327
497 3300005344 Ga0070661_100051750 Ga0070661_1000517503 327
498 3300005353 Ga0070669_100084244 Ga0070669_1000842442 327
499 3300005354 Ga0070675_100119228 Ga0070675_1001192281 327
500 3300005355 Ga0070671_100263159 Ga0070671_1002631592 327
501 3300005356 Ga0070674_100014116 Ga0070674_1000141163 327
502 3300005364 Ga0070673_100017192 Ga0070673_1000171924 327
503 3300005365 Ga0070688_100039145 Ga0070688_1000391451 327
504 3300005366 Ga0070659_100060263 Ga0070659_1000602634 327
505 3300005367 Ga0070667_100024129 Ga0070667_1000241296 327
506 3300005434 Ga0070709_10012180 Ga0070709_100121803 327
507 3300005434 Ga0070709_10019978 Ga0070709_100199782 327
508 3300005434 Ga0070709_10038707 Ga0070709_100387073 327
509 3300005434 Ga0070709_10113547 Ga0070709_101135473 327
510 3300005434 Ga0070709_10136093 Ga0070709_101360932 327
511 3300005434 Ga0070709_10178317 Ga0070709_101783171 327
512 3300005435 Ga0070714_100026899 Ga0070714_1000268994 327
513 3300005435 Ga0070714_100076345 Ga0070714_1000763452 327
514 3300005435 Ga0070714_100121156 Ga0070714_1001211563 327
515 3300005435 Ga0070714_100136572 Ga0070714_1001365722 327
516 3300005436 Ga0070713_100007574 Ga0070713_1000075747 327
517 3300005436 Ga0070713_100009238 Ga0070713_1000092382 327
518 3300005436 Ga0070713_100028090 Ga0070713_1000280903 327
519 3300005436 Ga0070713_100082674 Ga0070713_1000826742 327
520 3300005436 Ga0070713_100098069 Ga0070713_1000980692 327
521 3300005436 Ga0070713_100106406 Ga0070713_1001064063 327
522 3300005436 Ga0070713_100110831 Ga0070713_1001108312 327
523 3300005436 Ga0070713_100172013 Ga0070713_1001720132 327
524 3300005437 Ga0070710_10043572 Ga0070710_100435723 327
525 3300005437 Ga0070710_10043877 Ga0070710_100438773 327
526 3300005437 Ga0070710_10149788 Ga0070710_101497881 327
527 3300005439 Ga0070711_100001220 Ga0070711_1000012209 327
528 3300005439 Ga0070711_100010822 Ga0070711_1000108223 327
529 3300005439 Ga0070711_100068847 Ga0070711_1000688472 327
530 3300005439 Ga0070711_100110863 Ga0070711_1001108632 327
531 3300005439 Ga0070711_100423185 Ga0070711_1004231851 327
532 3300005445 Ga0070708_100000848 Ga0070708_1000008487 327
533 3300005445 Ga0070708_100002910 Ga0070708_1000029108 327
534 3300005445 Ga0070708_100009912 Ga0070708_1000099123 327
535 3300005445 Ga0070708_100011561 Ga0070708_1000115614 327
536 3300005445 Ga0070708_100048892 Ga0070708_1000488925 327
537 3300005445 Ga0070708_100079355 Ga0070708_1000793553 327
538 3300005455 Ga0070663_100062859 Ga0070663_1000628592 327
539 3300005456 Ga0070678_100031915 Ga0070678_1000319152 327
540 3300005456 Ga0070678_100075469 Ga0070678_1000754692 327
541 3300005456 Ga0070678_100304677 Ga0070678_1003046771 327
542 3300005457 Ga0070662_100008886 Ga0070662_1000088865 327
543 3300005457 Ga0070662_100018694 Ga0070662_1000186946 327
544 3300005457 Ga0070662_100253760 Ga0070662_1002537601 327
545 3300005458 Ga0070681_10000692 Ga0070681_1000069216 327
546 3300005458 Ga0070681_10005994 Ga0070681_1000599411 327
547 3300005458 Ga0070681_10008099 Ga0070681_100080997 327
548 3300005458 Ga0070681_10021208 Ga0070681_100212083 327
549 3300005458 Ga0070681_10028494 Ga0070681_100284945 327
550 3300005458 Ga0070681_10055803 Ga0070681_100558032 327
551 3300005458 Ga0070681_10058881 Ga0070681_100588816 327
552 3300005458 Ga0070681_10111730 Ga0070681_101117302 327
553 3300005458 Ga0070681_10165457 Ga0070681_101654572 327
554 3300005458 Ga0070681_10539954 Ga0070681_105399541 327
555 3300005459 Ga0068867_100008095 Ga0068867_1000080956 327
556 3300005459 Ga0068867_100125831 Ga0068867_1001258312 327
557 3300005467 Ga0070706_100000381 Ga0070706_10000038117 327
558 3300005467 Ga0070706_100000609 Ga0070706_10000060913 327
559 3300005467 Ga0070706_100006382 Ga0070706_10000638211 327
560 3300005467 Ga0070706_100027489 Ga0070706_1000274895 327
561 3300005467 Ga0070706_100061794 Ga0070706_1000617943 327
562 3300005467 Ga0070706_100086089 Ga0070706_1000860892 327
563 3300005468 Ga0070707_100018379 Ga0070707_1000183794 327
564 3300005468 Ga0070707_100054792 Ga0070707_1000547922 327
565 3300005468 Ga0070707_100087255 Ga0070707_1000872553 327
566 3300005468 Ga0070707_100299150 Ga0070707_1002991501 327
567 3300005471 Ga0070698_100000015 Ga0070698_10000001511 327
568 3300005471 Ga0070698_100176144 Ga0070698_1001761442 327
569 3300005518 Ga0070699_100045650 Ga0070699_1000456504 327
570 3300005518 Ga0070699_100195385 Ga0070699_1001953853 327
571 3300005518 Ga0070699_100286249 Ga0070699_1002862492 327
572 3300005530 Ga0070679_100017685 Ga0070679_1000176852 327
573 3300005530 Ga0070679_100036410 Ga0070679_1000364104 327
574 3300005530 Ga0070679_100041797 Ga0070679_1000417973 327
575 3300005530 Ga0070679_100049113 Ga0070679_1000491136 327
576 3300005530 Ga0070679_100059047 Ga0070679_1000590474 327
577 3300005530 Ga0070679_100068243 Ga0070679_1000682434 327
578 3300005530 Ga0070679_100157163 Ga0070679_1001571634 327
579 3300005535 Ga0070684_100002625 Ga0070684_1000026253 327
580 3300005535 Ga0070684_100002682 Ga0070684_1000026827 327
581 3300005535 Ga0070684_100007916 Ga0070684_1000079167 327
582 3300005535 Ga0070684_100016155 Ga0070684_1000161556 327
583 3300005535 Ga0070684_100054714 Ga0070684_1000547146 327
584 3300005535 Ga0070684_100127298 Ga0070684_1001272982 327
585 3300005535 Ga0070684_100168906 Ga0070684_1001689062 327
586 3300005536 Ga0070697_100000195 Ga0070697_10000019522 327
587 3300005536 Ga0070697_100003101 Ga0070697_10000310114 327
588 3300005536 Ga0070697_100006153 Ga0070697_1000061539 327
589 3300005536 Ga0070697_100010873 Ga0070697_1000108732 327
590 3300005536 Ga0070697_100026144 Ga0070697_1000261444 327
591 3300005536 Ga0070697_100086122 Ga0070697_1000861221 327
592 3300005536 Ga0070697_100118316 Ga0070697_1001183162 327
593 3300005539 Ga0068853_100004456 Ga0068853_1000044563 327
594 3300005539 Ga0068853_100016340 Ga0068853_1000163403 327
595 3300005539 Ga0068853_100051674 Ga0068853_1000516746 327
596 3300005539 Ga0068853_100071730 Ga0068853_1000717302 327
597 3300005539 Ga0068853_100093359 Ga0068853_1000933594 327
598 3300005543 Ga0070672_100041331 Ga0070672_1000413313 327
599 3300005544 Ga0070686_100022493 Ga0070686_1000224932 327
600 3300005544 Ga0070686_100104806 Ga0070686_1001048062 327
601 3300005545 Ga0070695_100070485 Ga0070695_1000704852 327
602 3300005546 Ga0070696_100011056 Ga0070696_1000110566 327
603 3300005546 Ga0070696_100167415 Ga0070696_1001674151 327
604 3300005547 Ga0070693_100008703 Ga0070693_1000087032 327
605 3300005548 Ga0070665_100027509 Ga0070665_1000275096 327
606 3300005563 Ga0068855_100001490 Ga0068855_10000149028 327
607 3300005563 Ga0068855_100002064 Ga0068855_1000020641 327
608 3300005563 Ga0068855_100004921 Ga0068855_1000049216 327
609 3300005563 Ga0068855_100013622 Ga0068855_1000136226 327
610 3300005563 Ga0068855_100020077 Ga0068855_1000200775 327
611 3300005563 Ga0068855_100055057 Ga0068855_1000550573 327
612 3300005563 Ga0068855_100368240 Ga0068855_1003682401 327
613 3300005563 Ga0068855_100612017 Ga0068855_1006120171 327
614 3300005564 Ga0070664_100017492 Ga0070664_1000174924 327
615 3300005564 Ga0070664_100147243 Ga0070664_1001472434 327
616 3300005577 Ga0068857_100001030 Ga0068857_1000010302 327
617 3300005577 Ga0068857_100003337 Ga0068857_10000333713 327
618 3300005577 Ga0068857_100096591 Ga0068857_1000965912 327
619 3300005577 Ga0068857_100215307 Ga0068857_1002153072 327
620 3300005578 Ga0068854_100004220 Ga0068854_1000042203 327
621 3300005578 Ga0068854_100012031 Ga0068854_1000120315 327
622 3300005614 Ga0068856_100000065 Ga0068856_10000006521 327
623 3300005614 Ga0068856_100000989 Ga0068856_10000098913 327
624 3300005614 Ga0068856_100002496 Ga0068856_1000024966 327
625 3300005614 Ga0068856_100012096 Ga0068856_1000120962 327
626 3300005614 Ga0068856_100023046 Ga0068856_1000230465 327
627 3300005614 Ga0068856_100028145 Ga0068856_1000281451 327
628 3300005614 Ga0068856_100052234 Ga0068856_1000522342 327
629 3300005614 Ga0068856_100057605 Ga0068856_1000576056 327
630 3300005614 Ga0068856_100158414 Ga0068856_1001584143 327
631 3300005614 Ga0068856_100220034 Ga0068856_1002200342 327
632 3300005614 Ga0068856_100477087 Ga0068856_1004770872 327
633 3300005615 Ga0070702_100009321 Ga0070702_1000093212 327
634 3300005616 Ga0068852_100052092 Ga0068852_1000520925 327
635 3300005616 Ga0068852_100102856 Ga0068852_1001028563 327
636 3300005617 Ga0068859_100000939 Ga0068859_10000093913 327
637 3300005617 Ga0068859_100005531 Ga0068859_10000553114 327
638 3300005617 Ga0068859_100417281 Ga0068859_1004172812 327
639 3300005618 Ga0068864_100000369 Ga0068864_10000036916 327
640 3300005618 Ga0068864_100008228 Ga0068864_1000082287 327
641 3300005618 Ga0068864_100032790 Ga0068864_1000327904 327
642 3300005618 Ga0068864_100198148 Ga0068864_1001981482 327
643 3300005718 Ga0068866_10003414 Ga0068866_100034144 327
644 3300005718 Ga0068866_10009998 Ga0068866_100099985 327
645 3300005718 Ga0068866_10149758 Ga0068866_101497582 327
646 3300005719 Ga0068861_100009849 Ga0068861_1000098496 327
647 3300005719 Ga0068861_100172783 Ga0068861_1001727833 327
648 3300005834 Ga0068851_10005710 Ga0068851_100057106 327
649 3300005840 Ga0068870_10000935 Ga0068870_100009353 327
650 3300005841 Ga0068863_100006532 Ga0068863_10000653210 327
651 3300005841 Ga0068863_100050601 Ga0068863_1000506016 327
652 3300005841 Ga0068863_100160860 Ga0068863_1001608602 327
653 3300005842 Ga0068858_100002175 Ga0068858_1000021757 327
654 3300005842 Ga0068858_100024408 Ga0068858_1000244086 327
655 3300005842 Ga0068858_100027668 Ga0068858_1000276684 327
656 3300005843 Ga0068860_100061945 Ga0068860_1000619452 327
657 3300005843 Ga0068860_100065633 Ga0068860_1000656332 327
658 3300005843 Ga0068860_100110187 Ga0068860_1001101872 327
659 3300005843 Ga0068860_100355061 Ga0068860_1003550612 327
660 3300005843 Ga0068860_100488859 Ga0068860_1004888591 327
661 3300005844 Ga0068862_100015615 Ga0068862_1000156152 327
662 3300005844 Ga0068862_100024780 Ga0068862_1000247804 327
663 3300005983 Ga0081540_1026668 Ga0081540_10266682 327
664 3300006028 Ga0070717_10001830 Ga0070717_100018305 327
665 3300006028 Ga0070717_10002609 Ga0070717_1000260916 327
666 3300006028 Ga0070717_10004387 Ga0070717_100043872 327
667 3300006028 Ga0070717_10007529 Ga0070717_100075297 327
668 3300006028 Ga0070717_10016823 Ga0070717_100168233 327
669 3300006028 Ga0070717_10035619 Ga0070717_100356198 327
670 3300006028 Ga0070717_10061452 Ga0070717_100614522 327
671 3300006028 Ga0070717_10111940 Ga0070717_101119402 327
672 3300006028 Ga0070717_10165616 Ga0070717_101656163 327
673 3300006163 Ga0070715_10005347 Ga0070715_100053475 327
674 3300006163 Ga0070715_10018053 Ga0070715_100180532 327
675 3300006163 Ga0070715_10032661 Ga0070715_100326612 327
676 3300006173 Ga0070716_100082439 Ga0070716_1000824392 327
677 3300006175 Ga0070712_100005202 Ga0070712_1000052026 327
678 3300006175 Ga0070712_100007031 Ga0070712_1000070313 327
679 3300006175 Ga0070712_100015260 Ga0070712_1000152602 327
680 3300006175 Ga0070712_100191397 Ga0070712_1001913972 327
681 3300006237 Ga0097621_100000034 Ga0097621_10000003439 327
682 3300006237 Ga0097621_100000908 Ga0097621_1000009083 327
683 3300006237 Ga0097621_100049009 Ga0097621_1000490092 327
684 3300006237 Ga0097621_100049426 Ga0097621_1000494263 327
685 3300006237 Ga0097621_100076264 Ga0097621_1000762643 327
686 3300006237 Ga0097621_100247316 Ga0097621_1002473162 327
687 3300006237 Ga0097621_100444465 Ga0097621_1004444651 327
688 3300006358 Ga0068871_100000233 Ga0068871_10000023325 327
689 3300006358 Ga0068871_100000444 Ga0068871_10000044416 327
690 3300006358 Ga0068871_100091447 Ga0068871_1000914474 327
691 3300006358 Ga0068871_100252942 Ga0068871_1002529422 327
692 3300006871 Ga0075434_100038540 Ga0075434_1000385402 327
693 3300006871 Ga0075434_100147812 Ga0075434_1001478123 327
694 3300006871 Ga0075434_100188356 Ga0075434_1001883562 327
695 3300006881 Ga0068865_100002230 Ga0068865_1000022305 327
696 3300006881 Ga0068865_100006642 Ga0068865_1000066422 327
697 3300006881 Ga0068865_100044236 Ga0068865_1000442363 327
698 3300006914 Ga0075436_100003577 Ga0075436_1000035779 327
699 3300006914 Ga0075436_100080970 Ga0075436_1000809702 327
700 3300006931 Ga0097620_100000939 Ga0097620_10000093913 327
701 3300006931 Ga0097620_100005531 Ga0097620_1000055312 327
702 3300006931 Ga0097620_100417257 Ga0097620_1004172572 327
703 3300007076 Ga0075435_100010144 Ga0075435_1000101443 327
704 3300007265 Ga0099794_10144830 Ga0099794_101448301 327
705 3300009011 Ga0105251_10100663 Ga0105251_101006631 327
706 3300009092 Ga0105250_10009360 Ga0105250_100093602 327
707 3300009093 Ga0105240_10006455 Ga0105240_1000645513 327
708 3300009093 Ga0105240_10065144 Ga0105240_100651445 327
709 3300009093 Ga0105240_10116022 Ga0105240_101160222 327
710 3300009093 Ga0105240_10128678 Ga0105240_101286782 327
711 3300009093 Ga0105240_10152642 Ga0105240_101526423 327
712 3300009093 Ga0105240_10206913 Ga0105240_102069132 327
713 3300009093 Ga0105240_10735834 Ga0105240_107358341 327
714 3300009098 Ga0105245_10000624 Ga0105245_100006245 327
715 3300009098 Ga0105245_10007043 Ga0105245_100070437 327
716 3300009098 Ga0105245_10058681 Ga0105245_100586814 327
717 3300009098 Ga0105245_10083479 Ga0105245_100834793 327
718 3300009098 Ga0105245_10101680 Ga0105245_101016804 327
719 3300009098 Ga0105245_10281561 Ga0105245_102815612 327
720 3300009101 Ga0105247_10001507 Ga0105247_1000150714 327
721 3300009101 Ga0105247_10093622 Ga0105247_100936222 327
722 3300009148 Ga0105243_10439729 Ga0105243_104397291 327
723 3300009174 Ga0105241_10002126 Ga0105241_1000212616 327
724 3300009174 Ga0105241_10117677 Ga0105241_101176772 327
725 3300009174 Ga0105241_10154538 Ga0105241_101545381 327
726 3300009176 Ga0105242_10053867 Ga0105242_100538673 327
727 3300009176 Ga0105242_10099580 Ga0105242_100995803 327
728 3300009176 Ga0105242_10376543 Ga0105242_103765431 327
729 3300009177 Ga0105248_10005836 Ga0105248_100058366 327
730 3300009177 Ga0105248_10072101 Ga0105248_100721013 327
731 3300009177 Ga0105248_10091853 Ga0105248_100918534 327
732 3300009545 Ga0105237_10008538 Ga0105237_1000853812 327
733 3300009545 Ga0105237_10019697 Ga0105237_100196972 327
734 3300009545 Ga0105237_10029884 Ga0105237_100298845 327
735 3300009545 Ga0105237_10151073 Ga0105237_101510732 327
736 3300009545 Ga0105237_10164956 Ga0105237_101649563 327
737 3300009551 Ga0105238_10000464 Ga0105238_1000046410 327
738 3300009551 Ga0105238_10016655 Ga0105238_100166551 327
739 3300009551 Ga0105238_10049855 Ga0105238_100498552 327
740 3300009551 Ga0105238_10200457 Ga0105238_102004572 327
741 3300009553 Ga0105249_10004737 Ga0105249_100047377 327
742 3300010375 Ga0105239_10053632 Ga0105239_100536324 327
743 3300010375 Ga0105239_10054173 Ga0105239_100541734 327
744 3300010375 Ga0105239_10248862 Ga0105239_102488622 327
745 3300011119 Ga0105246_10001854 Ga0105246_100018543 327
746 3300011119 Ga0105246_10034407 Ga0105246_100344072 327
747 3300013100 Ga0157373_10001119 Ga0157373_100011197 327
748 3300013100 Ga0157373_10017190 Ga0157373_100171907 327
749 3300013100 Ga0157373_10043524 Ga0157373_100435242 327
750 3300013100 Ga0157373_10049631 Ga0157373_100496312 327
751 3300013100 Ga0157373_10058555 Ga0157373_100585552 327
752 3300013100 Ga0157373_10177962 Ga0157373_101779621 327
753 3300013102 Ga0157371_10012556 Ga0157371_100125566 327
754 3300013102 Ga0157371_10013207 Ga0157371_100132076 327
755 3300013104 Ga0157370_10016231 Ga0157370_100162313 327
756 3300013104 Ga0157370_10158393 Ga0157370_101583932 327
757 3300013104 Ga0157370_10289527 Ga0157370_102895272 327
758 3300013105 Ga0157369_10000264 Ga0157369_1000026421 327
759 3300013105 Ga0157369_10010181 Ga0157369_100101817 327
760 3300013105 Ga0157369_10014322 Ga0157369_100143228 327
761 3300013105 Ga0157369_10078699 Ga0157369_100786992 327
762 3300013105 Ga0157369_10102065 Ga0157369_101020653 327
763 3300013105 Ga0157369_10150938 Ga0157369_101509383 327
764 3300013105 Ga0157369_10225621 Ga0157369_102256214 327
765 3300013105 Ga0157369_10256053 Ga0157369_102560532 327
766 3300013105 Ga0157369_10354439 Ga0157369_103544392 327
767 3300013105 Ga0157369_10365070 Ga0157369_103650702 327
768 3300013105 Ga0157369_10418488 Ga0157369_104184881 327
769 3300013296 Ga0157374_10000249 Ga0157374_1000024937 327
770 3300013296 Ga0157374_10000496 Ga0157374_1000049622 327
771 3300013296 Ga0157374_10001107 Ga0157374_1000110710 327
772 3300013296 Ga0157374_10005920 Ga0157374_100059206 327
773 3300013296 Ga0157374_10024491 Ga0157374_100244916 327
774 3300013296 Ga0157374_10078774 Ga0157374_100787742 327
775 3300013296 Ga0157374_10125558 Ga0157374_101255583 327
776 3300013296 Ga0157374_10229305 Ga0157374_102293053 327
777 3300013297 Ga0157378_10000008 Ga0157378_1000000848 327
778 3300013297 Ga0157378_10002765 Ga0157378_100027654 327
779 3300013297 Ga0157378_10003358 Ga0157378_1000335810 327
780 3300013297 Ga0157378_10045872 Ga0157378_100458722 327
781 3300013297 Ga0157378_10093841 Ga0157378_100938412 327
782 3300013297 Ga0157378_10255933 Ga0157378_102559332 327
783 3300013306 Ga0163162_10000777 Ga0163162_1000077717 327
784 3300013306 Ga0163162_10024543 Ga0163162_100245436 327
785 3300013306 Ga0163162_10288342 Ga0163162_102883422 327
786 3300013307 Ga0157372_10000436 Ga0157372_1000043636 327
787 3300013307 Ga0157372_10000611 Ga0157372_100006116 327
788 3300013307 Ga0157372_10001696 Ga0157372_100016964 327
789 3300013307 Ga0157372_10004250 Ga0157372_100042508 327
790 3300013307 Ga0157372_10008298 Ga0157372_100082986 327
791 3300013307 Ga0157372_10019394 Ga0157372_100193948 327
792 3300013307 Ga0157372_10049516 Ga0157372_100495161 327
793 3300013307 Ga0157372_10065331 Ga0157372_100653311 327
794 3300013307 Ga0157372_10078438 Ga0157372_100784384 327
795 3300013307 Ga0157372_10122925 Ga0157372_101229252 327
796 3300013307 Ga0157372_10247006 Ga0157372_102470062 327
797 3300013308 Ga0157375_10003580 Ga0157375_100035808 327
798 3300013308 Ga0157375_10015367 Ga0157375_100153674 327
799 3300013308 Ga0157375_10030491 Ga0157375_100304913 327
800 3300013308 Ga0157375_10356373 Ga0157375_103563732 327
801 3300014325 Ga0163163_10020441 Ga0163163_100204413 327
802 3300014325 Ga0163163_10025274 Ga0163163_100252745 327
803 3300014325 Ga0163163_10059974 Ga0163163_100599746 327
804 3300014325 Ga0163163_10110393 Ga0163163_101103933 327
805 3300014325 Ga0163163_10360639 Ga0163163_103606392 327
806 3300014497 Ga0182008_10044746 Ga0182008_100447463 327
807 3300014745 Ga0157377_10007969 Ga0157377_100079693 327
808 3300014968 Ga0157379_10001812 Ga0157379_100018124 327
809 3300014968 Ga0157379_10026975 Ga0157379_100269754 327
810 3300014968 Ga0157379_10055120 Ga0157379_100551203 327
811 3300014968 Ga0157379_10060793 Ga0157379_100607935 327
812 3300014968 Ga0157379_10175320 Ga0157379_101753202 327
813 3300014969 Ga0157376_10004063 Ga0157376_100040637 327
814 3300014969 Ga0157376_10042115 Ga0157376_100421156 327
815 3300014969 Ga0157376_10049476 Ga0157376_100494765 327
816 3300014969 Ga0157376_10272741 Ga0157376_102727411 327
817 3300015261 Ga0182006_1021588 Ga0182006_10215883 327
818 3300015261 Ga0182006_1072942 Ga0182006_10729421 327
819 3300015262 Ga0182007_10002409 Ga0182007_100024093 327
820 3300015262 Ga0182007_10039680 Ga0182007_100396801 327
821 3300015265 Ga0182005_1009264 Ga0182005_10092645 327
822 3300017792 Ga0163161_10051815 Ga0163161_100518153 327
823 3300020081 Ga0206354_10265616 Ga0206354_102656163 327
824 3300021358 Ga0213873_10020908 Ga0213873_100209082 327
825 3300022467 Ga0224712_10026682 Ga0224712_100266822 327
826 3300022467 Ga0224712_10044458 Ga0224712_100444583 327
827 3300022730 Ga0224570_100565 Ga0224570_1005654 327
828 3300024225 Ga0224572_1000257 Ga0224572_10002573 327
829 3300024227 Ga0228598_1001074 Ga0228598_10010744 327
830 3300024227 Ga0228598_1001256 Ga0228598_10012566 327
831 3300025321 Ga0207656_10036251 Ga0207656_100362513 327
832 3300025898 Ga0207692_10063997 Ga0207692_100639973 327
833 3300025899 Ga0207642_10005304 Ga0207642_100053044 327
834 3300025899 Ga0207642_10018358 Ga0207642_100183583 327
835 3300025901 Ga0207688_10003069 Ga0207688_100030697 327
836 3300025904 Ga0207647_10002063 Ga0207647_1000206310 327
837 3300025904 Ga0207647_10016048 Ga0207647_100160486 327
838 3300025904 Ga0207647_10049796 Ga0207647_100497963 327
839 3300025904 Ga0207647_10098194 Ga0207647_100981942 327
840 3300025905 Ga0207685_10003074 Ga0207685_100030745 327
841 3300025905 Ga0207685_10038958 Ga0207685_100389582 327
842 3300025906 Ga0207699_10012015 Ga0207699_100120152 327
843 3300025906 Ga0207699_10050642 Ga0207699_100506422 327
844 3300025906 Ga0207699_10146111 Ga0207699_101461112 327
845 3300025906 Ga0207699_10334304 Ga0207699_103343041 327
846 3300025907 Ga0207645_10000901 Ga0207645_1000090121 327
847 3300025907 Ga0207645_10006268 Ga0207645_100062683 327
848 3300025908 Ga0207643_10000172 Ga0207643_1000017212 327
849 3300025909 Ga0207705_10045267 Ga0207705_100452673 327
850 3300025910 Ga0207684_10005976 Ga0207684_100059766 327
851 3300025910 Ga0207684_10017175 Ga0207684_100171751 327
852 3300025910 Ga0207684_10062474 Ga0207684_100624744 327
853 3300025910 Ga0207684_10094980 Ga0207684_100949802 327
854 3300025911 Ga0207654_10029582 Ga0207654_100295822 327
855 3300025911 Ga0207654_10032668 Ga0207654_100326683 327
856 3300025912 Ga0207707_10000266 Ga0207707_1000026643 327
857 3300025912 Ga0207707_10003379 Ga0207707_100033796 327
858 3300025912 Ga0207707_10007460 Ga0207707_100074607 327
859 3300025912 Ga0207707_10011097 Ga0207707_100110978 327
860 3300025912 Ga0207707_10021147 Ga0207707_100211471 327
861 3300025912 Ga0207707_10065929 Ga0207707_100659292 327
862 3300025912 Ga0207707_10101188 Ga0207707_101011884 327
863 3300025913 Ga0207695_10003740 Ga0207695_1000374018 327
864 3300025913 Ga0207695_10007402 Ga0207695_100074025 327
865 3300025913 Ga0207695_10016105 Ga0207695_100161059 327
866 3300025913 Ga0207695_10037550 Ga0207695_100375502 327
867 3300025913 Ga0207695_10178963 Ga0207695_101789633 327
868 3300025913 Ga0207695_10373813 Ga0207695_103738131 327
869 3300025913 Ga0207695_10480551 Ga0207695_104805511 327
870 3300025914 Ga0207671_10027073 Ga0207671_100270735 327
871 3300025914 Ga0207671_10064810 Ga0207671_100648102 327
872 3300025914 Ga0207671_10133740 Ga0207671_101337401 327
873 3300025915 Ga0207693_10000098 Ga0207693_1000009849 327
874 3300025915 Ga0207693_10000884 Ga0207693_1000088424 327
875 3300025915 Ga0207693_10012227 Ga0207693_100122273 327
876 3300025915 Ga0207693_10044284 Ga0207693_100442843 327
877 3300025915 Ga0207693_10079310 Ga0207693_100793103 327
878 3300025915 Ga0207693_10112274 Ga0207693_101122743 327
879 3300025915 Ga0207693_10237676 Ga0207693_102376762 327
880 3300025916 Ga0207663_10007568 Ga0207663_100075683 327
881 3300025916 Ga0207663_10087264 Ga0207663_100872643 327
882 3300025916 Ga0207663_10089454 Ga0207663_100894541 327
883 3300025916 Ga0207663_10095862 Ga0207663_100958622 327
884 3300025917 Ga0207660_10002995 Ga0207660_100029952 327
885 3300025917 Ga0207660_10061997 Ga0207660_100619971 327
886 3300025917 Ga0207660_10074438 Ga0207660_100744383 327
887 3300025917 Ga0207660_10178146 Ga0207660_101781462 327
888 3300025917 Ga0207660_10285284 Ga0207660_102852842 327
889 3300025918 Ga0207662_10002090 Ga0207662_100020907 327
890 3300025918 Ga0207662_10174525 Ga0207662_101745252 327
891 3300025919 Ga0207657_10000660 Ga0207657_1000066019 327
892 3300025919 Ga0207657_10002292 Ga0207657_1000229216 327
893 3300025919 Ga0207657_10016937 Ga0207657_100169375 327
894 3300025920 Ga0207649_10001125 Ga0207649_1000112513 327
895 3300025920 Ga0207649_10023104 Ga0207649_100231041 327
896 3300025920 Ga0207649_10156878 Ga0207649_101568782 327
897 3300025921 Ga0207652_10001598 Ga0207652_1000159814 327
898 3300025921 Ga0207652_10003545 Ga0207652_100035454 327
899 3300025921 Ga0207652_10038171 Ga0207652_100381714 327
900 3300025921 Ga0207652_10064198 Ga0207652_100641982 327
901 3300025921 Ga0207652_10106214 Ga0207652_101062142 327
902 3300025921 Ga0207652_10139802 Ga0207652_101398023 327
903 3300025922 Ga0207646_10004709 Ga0207646_1000470910 327
904 3300025922 Ga0207646_10045908 Ga0207646_100459083 327
905 3300025922 Ga0207646_10046574 Ga0207646_100465745 327
906 3300025922 Ga0207646_10077799 Ga0207646_100777993 327
907 3300025923 Ga0207681_10064112 Ga0207681_100641123 327
908 3300025924 Ga0207694_10002762 Ga0207694_100027624 327
909 3300025924 Ga0207694_10029240 Ga0207694_100292404 327
910 3300025924 Ga0207694_10065154 Ga0207694_100651542 327
911 3300025924 Ga0207694_10122260 Ga0207694_101222602 327
912 3300025924 Ga0207694_10245779 Ga0207694_102457791 327
913 3300025925 Ga0207650_10000059 Ga0207650_1000005935 327
914 3300025927 Ga0207687_10006015 Ga0207687_100060154 327
915 3300025927 Ga0207687_10009700 Ga0207687_100097006 327
916 3300025928 Ga0207700_10008946 Ga0207700_100089464 327
917 3300025928 Ga0207700_10015310 Ga0207700_100153102 327
918 3300025928 Ga0207700_10018692 Ga0207700_100186924 327
919 3300025928 Ga0207700_10063197 Ga0207700_100631973 327
920 3300025928 Ga0207700_10099797 Ga0207700_100997973 327
921 3300025928 Ga0207700_10144330 Ga0207700_101443303 327
922 3300025928 Ga0207700_10151979 Ga0207700_101519791 327
923 3300025928 Ga0207700_10186426 Ga0207700_101864261 327
924 3300025928 Ga0207700_10296062 Ga0207700_102960622 327
925 3300025929 Ga0207664_10066656 Ga0207664_100666563 327
926 3300025929 Ga0207664_10138936 Ga0207664_101389362 327
927 3300025929 Ga0207664_10138971 Ga0207664_101389712 327
928 3300025929 Ga0207664_10448275 Ga0207664_104482751 327
929 3300025932 Ga0207690_10089161 Ga0207690_100891613 327
930 3300025933 Ga0207706_10000098 Ga0207706_1000009831 327
931 3300025933 Ga0207706_10000723 Ga0207706_1000072316 327
932 3300025934 Ga0207686_10069416 Ga0207686_100694162 327
933 3300025936 Ga0207670_10205381 Ga0207670_102053812 327
934 3300025938 Ga0207704_10048954 Ga0207704_100489542 327
935 3300025938 Ga0207704_10075112 Ga0207704_100751122 327
936 3300025939 Ga0207665_10020494 Ga0207665_100204944 327
937 3300025939 Ga0207665_10037720 Ga0207665_100377201 327
938 3300025939 Ga0207665_10067103 Ga0207665_100671032 327
939 3300025939 Ga0207665_10104350 Ga0207665_101043502 327
940 3300025940 Ga0207691_10001129 Ga0207691_1000112919 327
941 3300025941 Ga0207711_10004346 Ga0207711_100043467 327
942 3300025941 Ga0207711_10035400 Ga0207711_100354002 327
943 3300025941 Ga0207711_10114209 Ga0207711_101142093 327
944 3300025942 Ga0207689_10000353 Ga0207689_1000035317 327
945 3300025942 Ga0207689_10038519 Ga0207689_100385193 327
946 3300025942 Ga0207689_10098949 Ga0207689_100989492 327
947 3300025942 Ga0207689_10141747 Ga0207689_101417472 327
948 3300025944 Ga0207661_10096946 Ga0207661_100969464 327
949 3300025945 Ga0207679_10000415 Ga0207679_1000041520 327
950 3300025945 Ga0207679_10031074 Ga0207679_100310742 327
951 3300025949 Ga0207667_10000413 Ga0207667_1000041339 327
952 3300025949 Ga0207667_10006238 Ga0207667_100062384 327
953 3300025949 Ga0207667_10012296 Ga0207667_100122963 327
954 3300025949 Ga0207667_10018332 Ga0207667_100183326 327
955 3300025949 Ga0207667_10083898 Ga0207667_100838982 327
956 3300025949 Ga0207667_10148903 Ga0207667_101489032 327
957 3300025949 Ga0207667_10348265 Ga0207667_103482653 327
958 3300025961 Ga0207712_10007011 Ga0207712_100070114 327
959 3300025961 Ga0207712_10268382 Ga0207712_102683822 327
960 3300025972 Ga0207668_10008891 Ga0207668_100088913 327
961 3300025981 Ga0207640_10060567 Ga0207640_100605672 327
962 3300025981 Ga0207640_10079021 Ga0207640_100790212 327
963 3300025981 Ga0207640_10089505 Ga0207640_100895052 327
964 3300025981 Ga0207640_10149792 Ga0207640_101497922 327
965 3300026023 Ga0207677_10001543 Ga0207677_100015439 327
966 3300026023 Ga0207677_10001745 Ga0207677_100017458 327
967 3300026023 Ga0207677_10003837 Ga0207677_100038372 327
968 3300026023 Ga0207677_10004382 Ga0207677_100043826 327
969 3300026023 Ga0207677_10011658 Ga0207677_100116583 327
970 3300026023 Ga0207677_10078138 Ga0207677_100781381 327
971 3300026023 Ga0207677_10192605 Ga0207677_101926053 327
972 3300026035 Ga0207703_10006204 Ga0207703_100062043 327
973 3300026035 Ga0207703_10007234 Ga0207703_100072346 327
974 3300026035 Ga0207703_10010063 Ga0207703_100100636 327
975 3300026035 Ga0207703_10050625 Ga0207703_100506253 327
976 3300026035 Ga0207703_10069955 Ga0207703_100699552 327
977 3300026035 Ga0207703_10373062 Ga0207703_103730622 327
978 3300026041 Ga0207639_10016209 Ga0207639_100162093 327
979 3300026041 Ga0207639_10038468 Ga0207639_100384682 327
980 3300026041 Ga0207639_10077952 Ga0207639_100779522 327
981 3300026067 Ga0207678_10000581 Ga0207678_1000058120 327
982 3300026067 Ga0207678_10006094 Ga0207678_1000609410 327
983 3300026078 Ga0207702_10000209 Ga0207702_1000020921 327
984 3300026078 Ga0207702_10001199 Ga0207702_100011999 327
985 3300026078 Ga0207702_10003037 Ga0207702_100030377 327
986 3300026078 Ga0207702_10055790 Ga0207702_100557902 327
987 3300026078 Ga0207702_10073539 Ga0207702_100735395 327
988 3300026078 Ga0207702_10099952 Ga0207702_100999522 327
989 3300026078 Ga0207702_10173363 Ga0207702_101733631 327
990 3300026078 Ga0207702_10222748 Ga0207702_102227483 327
991 3300026078 Ga0207702_10313036 Ga0207702_103130361 327
992 3300026078 Ga0207702_10396022 Ga0207702_103960222 327
993 3300026078 Ga0207702_10432168 Ga0207702_104321681 327
994 3300026088 Ga0207641_10000025 Ga0207641_1000002537 327
995 3300026088 Ga0207641_10008027 Ga0207641_100080277 327
996 3300026088 Ga0207641_10020912 Ga0207641_100209123 327
997 3300026088 Ga0207641_10059041 Ga0207641_100590412 327
998 3300026089 Ga0207648_10003458 Ga0207648_100034586 327
999 3300026089 Ga0207648_10047694 Ga0207648_100476942 327
1000 3300026095 Ga0207676_10000252 Ga0207676_1000025232 327
1001 3300026095 Ga0207676_10002695 Ga0207676_1000269510 327
1002 3300026095 Ga0207676_10008202 Ga0207676_100082023 327
1003 3300026116 Ga0207674_10000162 Ga0207674_1000016227 327
1004 3300026116 Ga0207674_10003030 Ga0207674_100030302 327
1005 3300026116 Ga0207674_10042580 Ga0207674_100425803 327
1006 3300026116 Ga0207674_10078029 Ga0207674_100780294 327
1007 3300026116 Ga0207674_10127467 Ga0207674_101274672 327
1008 3300026116 Ga0207674_10214815 Ga0207674_102148152 327
1009 3300026118 Ga0207675_100017450 Ga0207675_1000174506 327
1010 3300026118 Ga0207675_100078474 Ga0207675_1000784742 327
1011 3300026121 Ga0207683_10001306 Ga0207683_1000130619 327
1012 3300026121 Ga0207683_10083016 Ga0207683_100830163 327
1013 3300026142 Ga0207698_10029146 Ga0207698_100291463 327
1014 3300028017 Ga0265356_1000857 Ga0265356_10008575 327
1015 3300028379 Ga0268266_10010266 Ga0268266_100102663 327
1016 3300028381 Ga0268264_10025084 Ga0268264_100250844 327
1017 3300028381 Ga0268264_10050987 Ga0268264_100509873 327
1018 3300028381 Ga0268264_10063001 Ga0268264_100630012 327
1019 3300028381 Ga0268264_10307434 Ga0268264_103074342 327
1020 3300028800 Ga0265338_10024675 Ga0265338_100246753 327
1021 3300028800 Ga0265338_10148870 Ga0265338_101488701 327
1022 3300028800 Ga0265338_10196671 Ga0265338_101966711 327
1023 3300030760 Ga0265762_1001781 Ga0265762_10017814 327
1024 3300031090 Ga0265760_10002278 Ga0265760_100022785 327
1025 3300031090 Ga0265760_10002457 Ga0265760_100024575 327
1026 3300031090 Ga0265760_10018115 Ga0265760_100181151 327
1027 3300031241 Ga0265325_10025527 Ga0265325_100255272 327
1028 3300031241 Ga0265325_10047993 Ga0265325_100479932 327
1029 3300031249 Ga0265339_10018777 Ga0265339_100187773 327
1030 3300031249 Ga0265339_10019646 Ga0265339_100196463 327
1031 3300031249 Ga0265339_10159198 Ga0265339_101591982 327
1032 3300031344 Ga0265316_10041782 Ga0265316_100417824 327
1033 3300031344 Ga0265316_10048446 Ga0265316_100484464 327
1034 3300031344 Ga0265316_10113095 Ga0265316_101130952 327
1035 3300031711 Ga0265314_10004435 Ga0265314_1000443514 327
1036 3300031711 Ga0265314_10080937 Ga0265314_100809372 327
1037 3300031711 Ga0265314_10169979 Ga0265314_101699791 327
1038 3300032002 Ga0307416_100047412 Ga0307416_1000474123 327
1039 3300035111 Ga0373923_0090879 Ga0373923_0090879_256_1254 327
1040 3300035116 Ga0373945_0001313 Ga0373945_0001313_3526_4521 327
1041 3300035119 Ga0373956_0007158 Ga0373956_0007158_3125_4120 327
1042 3300035119 Ga0373956_0073444 Ga0373956_0073444_329_1327 327
1043 3300035170 Ga0373943_0016294 Ga0373943_0016294_1069_2058 327
1044 3300035410 Ga0373924_0000248 Ga0373924_0000248_140_1135 327
1045 3300035691 Ga0373931_0007410 Ga0373931_0007410_2268_3263 327
1046 3300035691 Ga0373931_0032147 Ga0373931_0032147_1134_2123 327
1047 3300035691 Ga0373931_0045293 Ga0373931_0045293_202_1191 327
1048 3300035692 Ga0373935_0003124 Ga0373935_0003124_7995_8984 327
1049 3300035692 Ga0373935_0010148 Ga0373935_0010148_402_1397 327
1050 3300035692 Ga0373935_0032320 Ga0373935_0032320_1580_2569 327
1051 3300035695 Ga0373927_0058122 Ga0373927_0058122_165_1163 327
1052 3300035695 Ga0373927_0078965 Ga0373927_0078965_819_1808 327
1053 3300035695 Ga0373927_0111053 Ga0373927_0111053_109_1101 327
1054 3300035725 Ga0373947_0017382 Ga0373947_0017382_121_1110 327
1055 3300035725 Ga0373947_0087873 Ga0373947_0087873_805_1794 327
1056 3300036401 Ga0373937_0000090 Ga0373937_0000090_81620_82609 327
1057 3300036401 Ga0373937_0049245 Ga0373937_0049245_2631_3629 327
1058 3300036401 Ga0373937_0076551 Ga0373937_0076551_1616_2608 327
1059 3300036401 Ga0373937_0440853 Ga0373937_0440853_79_1074 327
1060 3300037068 Ga0373925_0005732 Ga0373925_0005732_4545_5543 327
1061 3300037068 Ga0373925_0006084 Ga0373925_0006084_7111_8100 327
1062 3300037068 Ga0373925_0127295 Ga0373925_0127295_231_1226 327
1063 3300037068 Ga0373925_0226782 Ga0373925_0226782_55_1044 327
1064 3300037466 Ga0395898_0049727 Ga0395898_0049727_3073_4065 327
1065 3300037471 Ga0395905_0090299 Ga0395905_0090299_329_1327 327
1066 3300037853 Ga0436364_0366631 Ga0436364_0366631_62_1057 327
1067 3300039450 Ga0436363_0375979 Ga0436363_0375979_986_1975 327
1068 3300039450 Ga0436363_1252730 Ga0436363_1252730_1245_2240 327
1069 3300039450 Ga0436363_1383135 Ga0436363_1383135_39_1034 327
1070 3300039450 Ga0436363_1663027 Ga0436363_1663027_129_1124 327
1071 3300039453 Ga0436362_1104320 Ga0436362_1104320_19_1014 327
1072 3300039453 Ga0436362_1148430 Ga0436362_1148430_5059_6054 327
1073 3300042876 Ga0451577_0001555 Ga0451577_0001555_28711_29700 327
1074 3300042876 Ga0451577_0113458 Ga0451577_0113458_477_1472 327
1075 3300044694 Ga0466963_0005503 Ga0466963_0005503_3693_4682 327
1076 3300044712 Ga0453684_0000289 Ga0453684_0000289_70898_71887 327
1077 3300044842 Ga0466957_0095683 Ga0466957_0095683_430_1419 327
1078 3300044842 Ga0466957_0132345 Ga0466957_0132345_539_1528 327
1079 3300045049 Ga0466959_0033530 Ga0466959_0033530_902_1891 327
1080 3300045049 Ga0466959_0035415 Ga0466959_0035415_2089_3084 327
1081 3300045051 Ga0451576_0035560 Ga0451576_0035560_256_1245 327
1082 3300045051 Ga0451576_0420030 Ga0451576_0420030_145_1140 327
1083 3300045836 Ga0466958_0026948 Ga0466958_0026948_1875_2864 327
1084 3300045836 Ga0466958_0147300 Ga0466958_0147300_167_1156 327
1085 3300045976 Ga0466967_0055328 Ga0466967_0055328_723_1712 327
1086 3300046472 Ga0495580_0000354 Ga0495580_0000354_17995_18987 327
1087 3300046472 Ga0495580_0004478 Ga0495580_0004478_4690_5679 327
1088 3300046472 Ga0495580_0019736 Ga0495580_0019736_3426_4421 327
1089 3300046472 Ga0495580_0046482 Ga0495580_0046482_885_1877 327
1090 3300046472 Ga0495580_0051886 Ga0495580_0051886_1861_2856 327
1091 3300046472 Ga0495580_0078652 Ga0495580_0078652_757_1746 327
1092 3300046499 Ga0495594_0008908 Ga0495594_0008908_2627_3625 327
1093 3300046517 Ga0495630_0074146 Ga0495630_0074146_1477_2466 327
1094 3300046526 Ga0495666_0112078 Ga0495666_0112078_125_1123 327
1095 3300046531 Ga0495665_0014305 Ga0495665_0014305_146_1138 327
1096 3300046678 Ga0495599_0060721 Ga0495599_0060721_1296_2291 327
1097 3300046679 Ga0495623_0039822 Ga0495623_0039822_1456_2445 327
1098 3300046683 Ga0495658_0035332 Ga0495658_0035332_1121_2119 327
1099 3300046809 Ga0495600_0126297 Ga0495600_0126297_268_1260 327
1100 3300047317 Ga0495604_0028162 Ga0495604_0028162_353_1342 327
1101 3300047319 Ga0495674_0078187 Ga0495674_0078187_141_1136 327
1102 3300047444 Ga0495675_0090400 Ga0495675_0090400_893_1885 327
1103 3300048089 Ga0495614_0108478 Ga0495614_0108478_128_1120 327
1104 3300048904 Ga0496101_0057320 Ga0496101_0057320_1124_2119 327
1105 3300048904 Ga0496101_0109408 Ga0496101_0109408_222_1205 327
1106 3300048904 Ga0496101_0281897 Ga0496101_0281897_178_1173 327
1107 3300048905 Ga0496102_0002608 Ga0496102_0002608_2113_3108 327
1108 3300048905 Ga0496102_0026380 Ga0496102_0026380_3064_4059 327
1109 3300048905 Ga0496102_0028897 Ga0496102_0028897_3324_4319 327
1110 3300048905 Ga0496102_0042036 Ga0496102_0042036_1893_2888 327
1111 3300048905 Ga0496102_0107895 Ga0496102_0107895_1251_2246 327
1112 3300048905 Ga0496102_0224927 Ga0496102_0224927_695_1684 327
1113 3300048906 Ga0496103_0063905 Ga0496103_0063905_1254_2249 327
1114 3300048907 Ga0496104_0008792 Ga0496104_0008792_1281_2276 327
1115 3300048907 Ga0496104_0163570 Ga0496104_0163570_306_1301 327
1116 3300048907 Ga0496104_0326605 Ga0496104_0326605_239_1228 327
1117 3300048907 Ga0496104_0457469 Ga0496104_0457469_84_1073 327
1118 3300048908 Ga0496105_0000584 Ga0496105_0000584_8501_9493 327
1119 3300048908 Ga0496105_0053823 Ga0496105_0053823_1273_2268 327
1120 3300048909 Ga0496106_0085428 Ga0496106_0085428_46_1041 327
1121 3300048909 Ga0496106_0353486 Ga0496106_0353486_29_1024 327
1122 3300048910 Ga0496107_0139938 Ga0496107_0139938_241_1236 327
1123 3300048911 Ga0496108_0000203 Ga0496108_0000203_37659_38642 327
1124 3300048911 Ga0496108_0135570 Ga0496108_0135570_571_1566 327
1125 3300048911 Ga0496108_0306696 Ga0496108_0306696_124_1119 327
1126 3300048912 Ga0496109_0000228 Ga0496109_0000228_49730_50713 327
1127 3300048913 Ga0496110_0000145 Ga0496110_0000145_29875_30858 327
1128 3300048913 Ga0496110_0023501 Ga0496110_0023501_1083_2078 327
1129 3300048913 Ga0496110_0076017 Ga0496110_0076017_1730_2725 327
1130 3300048913 Ga0496110_0179781 Ga0496110_0179781_587_1582 327
1131 3300048913 Ga0496110_0479489 Ga0496110_0479489_121_1116 327
1132 3300048914 Ga0496111_0003439 Ga0496111_0003439_1036_2031 327
1133 3300048914 Ga0496111_0060610 Ga0496111_0060610_425_1420 327
1134 3300048914 Ga0496111_0187711 Ga0496111_0187711_55_1050 327
1135 3300048915 Ga0496112_0000048 Ga0496112_0000048_49439_50422 327
1136 3300048915 Ga0496112_0001123 Ga0496112_0001123_16609_17604 327
1137 3300048915 Ga0496112_0002435 Ga0496112_0002435_2732_3721 327
1138 3300048915 Ga0496112_0004578 Ga0496112_0004578_2079_3074 327
1139 3300048915 Ga0496112_0006190 Ga0496112_0006190_5995_6990 327
1140 3300048915 Ga0496112_0008072 Ga0496112_0008072_1830_2825 327
1141 3300048915 Ga0496112_0063880 Ga0496112_0063880_1751_2740 327
1142 3300048916 Ga0496113_0002647 Ga0496113_0002647_8421_9416 327
1143 3300048918 Ga0496115_0051371 Ga0496115_0051371_1094_2083 327
1144 3300048918 Ga0496115_0086899 Ga0496115_0086899_418_1407 327
1145 3300048918 Ga0496115_0357787 Ga0496115_0357787_112_1107 327
1146 3300050507 nmdc:mga05p37_98700_c1 nmdc:mga05p37_98700_c1_2134_3129 327
1147 3300050512 nmdc:mga0n895_22018_c1 nmdc:mga0n895_22018_c1_973_1968 327
1148 3300050512 nmdc:mga0n895_37706_c1 nmdc:mga0n895_37706_c1_1257_2246 327
1149 3300050513 nmdc:mga0rr50_2479_c1 nmdc:mga0rr50_2479_c1_3056_4051 327
1150 3300050513 nmdc:mga0rr50_52962_c1 nmdc:mga0rr50_52962_c1_922_1917 327
1151 3300050513 nmdc:mga0rr50_7501_c1 nmdc:mga0rr50_7501_c1_4482_5471 327
1152 3300050514 nmdc:mga08x19_1403_c1 nmdc:mga08x19_1403_c1_2630_3619 327
1153 3300050514 nmdc:mga08x19_18118_c1 nmdc:mga08x19_18118_c1_3097_4092 327
1154 3300050515 nmdc:mga0a205_57878_c1 nmdc:mga0a205_57878_c1_308_1297 327
1155 3300053077 Ga0495601_0004055 Ga0495601_0004055_2511_3500 327
1156 3300053078 Ga0495612_0025640 Ga0495612_0025640_120_1115 327
1157 3300053078 Ga0495612_0113032 Ga0495612_0113032_144_1139 327
1158 3300054114 Ga0501084_0055804 Ga0501084_0055804_251_1246 327
1159 3300059492 Ga0587073_0005958 Ga0587073_0005958_818_1810 327
1160 3300059511 Ga0587091_009615 Ga0587091_009615_28_1020 327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00766

ETF_alpha

Electron transfer flavoprotein FAD-binding domain

223

303

0.99

PF01012

ETF

Electron transfer flavoprotein domain

23

203

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o95-assembly1.cif.gz_F ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.8811 1 193
1t9g-assembly1.cif.gz_R structure of the human mcad:etf complex 0.8739 1 193
1o95-assembly1.cif.gz_F ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.8681 1 193
1t9g-assembly1.cif.gz_R structure of the human mcad:etf complex 0.8606 1 193
3ih5-assembly1.cif.gz_B crystal structure of electron transfer flavoprotein alpha-subunit from bacteroides thetaiotaomicron 0.8217 2 197
ID Description Score Start End Superfamily
af_P9WNG9_187_318_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.97 204 327 3.40.50.1220
af_P77378_184_312_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9577 197 322 3.40.50.1220
af_Q46907_159_286_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9319 204 327 3.40.50.1220
af_P77378_184_312_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9291 197 322 3.40.50.1220
af_P9WNG9_187_318_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9058 204 327 3.40.50.1220
ID Description Score Start End GO Terms
AF-X0S2B0-F1-model_v4 Electron transfer flavoprotein alpha subunit C-terminal domain-containing protein 0.9809 204 326 GO:0009055
GO:0033539
GO:0050660
AF-A0A382AUL2-F1-model_v4 Electron transfer flavoprotein alpha/beta-subunit N-terminal domain-containing protein 0.977 1 176 GO:0009055
GO:0033539
GO:0050660
AF-A0A2N2ZBZ4-F1-model_v4 Electron transfer flavoprotein subunit alpha 0.9748 214 326 GO:0009055
GO:0033539
GO:0050660
AF-A0A1C5DSN9-F1-model_v4 Electron transfer flavoprotein alpha subunit apoprotein 0.9739 203 327 GO:0009055
GO:0033539
GO:0050660
AF-S7U661-F1-model_v4 Electron transfer flavoprotein alpha subunit 0.9738 219 325 GO:0009055
GO:0033539
GO:0050660

Feature Viewer

pLDDT pTM Quality
91.92 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map