F490987
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1160 | 403 | 2320 | 122 |
Family's Representative Sequence
| Representative Sequence | 3300005444|Ga0070694_100503762|Ga0070694_1005037622 |
| Length | 124 |
| Sequence | MSHLDDLDEYEAELELALKKEYQAVFALFRFCVLTQDATYLCNKLDVQQAAPSTAGGLPFFQLDLEDVWVWDKNRPTRIIPRAEVYTSSDVTVEELRAEGDEPKLTAEALAERIGEPLSTDEDL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 12 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 89 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 90 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 91 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 95 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 106 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 122 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 123 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 124 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 125 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 126 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 138 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 208 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 210 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 211 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 215 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 217 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 218 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 219 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 220 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 221 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 223 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 225 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 230 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 231 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 234 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 235 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 236 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 237 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 238 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 239 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 240 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 241 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 242 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 251 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 252 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 253 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 254 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 255 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 256 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 257 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 258 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 259 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 260 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 261 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 262 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 263 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 264 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 265 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 266 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 267 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 268 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 269 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 270 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 271 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 272 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 273 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 274 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 275 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 276 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 277 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 278 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 279 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 280 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 281 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 282 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 283 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 284 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 285 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 286 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 340 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 341 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 342 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 343 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 344 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 345 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 348 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 349 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 350 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 351 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 352 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 353 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 386 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 387 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 388 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 389 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 390 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 400 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 401 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 402 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.91 |
| Metatranscriptomes | 0.09 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.12 |
| Nodule | 0 |
| Rhizoplane | 9.74 |
| Rhizosphere | 88.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070694_100503762 | 3300005444 | Bacteria | 964 |
| 2 | 2214561612 | 2209111006 | Bacteria | 1208 |
| 3 | JGI24747J21853_1034346 | 3300001978 | Unclassified | 587 |
| 4 | JGI24740J21852_10131317 | 3300001979 | Bacteria | 625 |
| 5 | JGI24739J22299_10176192 | 3300001989 | Bacteria | 630 |
| 6 | JGI24737J22298_10252621 | 3300001990 | Bacteria | 521 |
| 7 | JGI24743J22301_10008947 | 3300001991 | Bacteria | 1766 |
| 8 | JGI24738J21930_10002351 | 3300002075 | Bacteria | 4980 |
| 9 | JGI24742J22300_10061582 | 3300002244 | Bacteria | 691 |
| 10 | JGI25406J46586_10007161 | 3300003203 | Bacteria | 5109 |
| 11 | JGI25407J50210_10001173 | 3300003373 | Bacteria | 5813 |
| 12 | JGI25407J50210_10006956 | 3300003373 | Bacteria | 2829 |
| 13 | JGI25407J50210_10014404 | 3300003373 | Bacteria | 2037 |
| 14 | JGI25405J52794_10018336 | 3300003911 | Bacteria | 1397 |
| 15 | JGI25405J52794_10045228 | 3300003911 | Unclassified | 937 |
| 16 | Ga0070658_10036507 | 3300005327 | Bacteria | 3961 |
| 17 | Ga0070676_10794519 | 3300005328 | Unclassified | 698 |
| 18 | Ga0070683_100063165 | 3300005329 | Bacteria | 3444 |
| 19 | Ga0070683_100075360 | 3300005329 | Bacteria | 3152 |
| 20 | Ga0070683_100420028 | 3300005329 | Bacteria | 1276 |
| 21 | Ga0070683_101007701 | 3300005329 | Unclassified | 800 |
| 22 | Ga0070683_101760672 | 3300005329 | Unclassified | 596 |
| 23 | Ga0070690_100101020 | 3300005330 | Bacteria | 1912 |
| 24 | Ga0070690_100294430 | 3300005330 | Bacteria | 1162 |
| 25 | Ga0070670_100042392 | 3300005331 | Bacteria | 3912 |
| 26 | Ga0070677_10202417 | 3300005333 | Bacteria | 959 |
| 27 | Ga0068869_100125665 | 3300005334 | Bacteria | 1966 |
| 28 | Ga0068869_101063993 | 3300005334 | Bacteria | 707 |
| 29 | Ga0070666_10232012 | 3300005335 | Bacteria | 1304 |
| 30 | Ga0070680_100042813 | 3300005336 | Bacteria | 3675 |
| 31 | Ga0070680_100073588 | 3300005336 | Bacteria | 2811 |
| 32 | Ga0070682_100028670 | 3300005337 | Bacteria | 3350 |
| 33 | Ga0070682_100052805 | 3300005337 | Bacteria | 2545 |
| 34 | Ga0070682_100069329 | 3300005337 | Bacteria | 2252 |
| 35 | Ga0070682_100416023 | 3300005337 | Bacteria | 1020 |
| 36 | Ga0068868_100048167 | 3300005338 | Bacteria | 3343 |
| 37 | Ga0068868_100343315 | 3300005338 | Bacteria | 1277 |
| 38 | Ga0068868_100650255 | 3300005338 | Bacteria | 939 |
| 39 | Ga0068868_100711250 | 3300005338 | Bacteria | 899 |
| 40 | Ga0068868_100719186 | 3300005338 | Unclassified | 895 |
| 41 | Ga0068868_101143133 | 3300005338 | Bacteria | 718 |
| 42 | Ga0070660_100015245 | 3300005339 | Bacteria | 5544 |
| 43 | Ga0070660_100032546 | 3300005339 | Bacteria | 3924 |
| 44 | Ga0070660_100074081 | 3300005339 | Bacteria | 2663 |
| 45 | Ga0070660_100107897 | 3300005339 | Bacteria | 2212 |
| 46 | Ga0070660_101042143 | 3300005339 | Bacteria | 692 |
| 47 | Ga0070660_101090104 | 3300005339 | Bacteria | 676 |
| 48 | Ga0070689_101059098 | 3300005340 | Unclassified | 723 |
| 49 | Ga0070691_10012025 | 3300005341 | Bacteria | 3963 |
| 50 | Ga0070691_10012486 | 3300005341 | Bacteria | 3890 |
| 51 | Ga0070687_100156863 | 3300005343 | Bacteria | 1342 |
| 52 | Ga0070687_100428447 | 3300005343 | Bacteria | 874 |
| 53 | Ga0070687_100687711 | 3300005343 | Bacteria | 713 |
| 54 | Ga0070687_101012775 | 3300005343 | Bacteria | 603 |
| 55 | Ga0070661_100005790 | 3300005344 | Bacteria | 8498 |
| 56 | Ga0070661_100076375 | 3300005344 | Bacteria | 2469 |
| 57 | Ga0070661_100733229 | 3300005344 | Bacteria | 807 |
| 58 | Ga0070692_10012500 | 3300005345 | Bacteria | 3931 |
| 59 | Ga0070692_10070647 | 3300005345 | Bacteria | 1859 |
| 60 | Ga0070692_10093709 | 3300005345 | Bacteria | 1636 |
| 61 | Ga0070692_10107927 | 3300005345 | Bacteria | 1536 |
| 62 | Ga0070668_100155740 | 3300005347 | Bacteria | 1851 |
| 63 | Ga0070668_100263598 | 3300005347 | Bacteria | 1434 |
| 64 | Ga0070668_100941613 | 3300005347 | Bacteria | 774 |
| 65 | Ga0070669_100107675 | 3300005353 | Bacteria | 2112 |
| 66 | Ga0070669_100293179 | 3300005353 | Bacteria | 1306 |
| 67 | Ga0070675_100036465 | 3300005354 | Bacteria | 4001 |
| 68 | Ga0070675_100148675 | 3300005354 | Bacteria | 2007 |
| 69 | Ga0070671_100115530 | 3300005355 | Bacteria | 2256 |
| 70 | Ga0070671_100192839 | 3300005355 | Bacteria | 1727 |
| 71 | Ga0070671_100617287 | 3300005355 | Unclassified | 937 |
| 72 | Ga0070671_101437286 | 3300005355 | Bacteria | 610 |
| 73 | Ga0070674_100002837 | 3300005356 | Bacteria | 9578 |
| 74 | Ga0070674_100012684 | 3300005356 | Bacteria | 5181 |
| 75 | Ga0070674_100198978 | 3300005356 | Bacteria | 1546 |
| 76 | Ga0070674_100613575 | 3300005356 | Bacteria | 921 |
| 77 | Ga0070674_100619603 | 3300005356 | Bacteria | 917 |
| 78 | Ga0070674_100859116 | 3300005356 | Unclassified | 788 |
| 79 | Ga0070674_101717240 | 3300005356 | Bacteria | 568 |
| 80 | Ga0070673_100007791 | 3300005364 | Bacteria | 7089 |
| 81 | Ga0070673_100517467 | 3300005364 | Unclassified | 1081 |
| 82 | Ga0070673_101308158 | 3300005364 | Unclassified | 681 |
| 83 | Ga0070673_102075914 | 3300005364 | Bacteria | 540 |
| 84 | Ga0070688_100010486 | 3300005365 | Bacteria | 5111 |
| 85 | Ga0070688_100071101 | 3300005365 | Bacteria | 2227 |
| 86 | Ga0070688_101395084 | 3300005365 | Unclassified | 568 |
| 87 | Ga0070659_100022477 | 3300005366 | Bacteria | 4815 |
| 88 | Ga0070659_100100790 | 3300005366 | Bacteria | 2324 |
| 89 | Ga0070659_101722058 | 3300005366 | Bacteria | 561 |
| 90 | Ga0070667_100224025 | 3300005367 | Bacteria | 1675 |
| 91 | Ga0070703_10195232 | 3300005406 | Unclassified | 791 |
| 92 | Ga0070714_100387467 | 3300005435 | Bacteria | 1319 |
| 93 | Ga0070710_10073841 | 3300005437 | Bacteria | 1973 |
| 94 | Ga0070701_10012028 | 3300005438 | Bacteria | 3887 |
| 95 | Ga0070701_10014614 | 3300005438 | Bacteria | 3604 |
| 96 | Ga0070711_100003231 | 3300005439 | Bacteria | 9461 |
| 97 | Ga0070711_100958128 | 3300005439 | Unclassified | 733 |
| 98 | Ga0070705_100017261 | 3300005440 | Bacteria | 3765 |
| 99 | Ga0070705_100406539 | 3300005440 | Bacteria | 1009 |
| 100 | Ga0070700_100013335 | 3300005441 | Bacteria | 4616 |
| 101 | Ga0070700_100054747 | 3300005441 | Bacteria | 2494 |
| 102 | Ga0070700_100256669 | 3300005441 | Bacteria | 1257 |
| 103 | Ga0070700_100289807 | 3300005441 | Bacteria | 1190 |
| 104 | Ga0070700_100448205 | 3300005441 | Bacteria | 981 |
| 105 | Ga0070694_100266182 | 3300005444 | Bacteria | 1302 |
| 106 | Ga0070694_100272880 | 3300005444 | Bacteria | 1287 |
| 107 | Ga0070708_100037151 | 3300005445 | Bacteria | 4247 |
| 108 | Ga0070708_100067748 | 3300005445 | Bacteria | 3207 |
| 109 | Ga0070708_100774791 | 3300005445 | Unclassified | 902 |
| 110 | Ga0070708_101012967 | 3300005445 | Bacteria | 779 |
| 111 | Ga0070663_100141482 | 3300005455 | Bacteria | 1837 |
| 112 | Ga0070663_100194151 | 3300005455 | Bacteria | 1581 |
| 113 | Ga0070663_100513166 | 3300005455 | Bacteria | 997 |
| 114 | Ga0070663_100702042 | 3300005455 | Bacteria | 860 |
| 115 | Ga0070663_101196489 | 3300005455 | Bacteria | 668 |
| 116 | Ga0070678_100008768 | 3300005456 | Bacteria | 6076 |
| 117 | Ga0070678_100156281 | 3300005456 | Bacteria | 1843 |
| 118 | Ga0070678_100556824 | 3300005456 | Bacteria | 1018 |
| 119 | Ga0070678_100587853 | 3300005456 | Bacteria | 992 |
| 120 | Ga0070662_100020948 | 3300005457 | Bacteria | 4459 |
| 121 | Ga0070662_100200004 | 3300005457 | Bacteria | 1585 |
| 122 | Ga0070662_100392038 | 3300005457 | Bacteria | 1145 |
| 123 | Ga0070662_100544646 | 3300005457 | Bacteria | 972 |
| 124 | Ga0070681_10256541 | 3300005458 | Bacteria | 1660 |
| 125 | Ga0068867_100141576 | 3300005459 | Unclassified | 1880 |
| 126 | Ga0068867_100302728 | 3300005459 | Bacteria | 1318 |
| 127 | Ga0068867_100459671 | 3300005459 | Bacteria | 1086 |
| 128 | Ga0068867_100564355 | 3300005459 | Bacteria | 988 |
| 129 | Ga0068867_101694732 | 3300005459 | Bacteria | 593 |
| 130 | Ga0070685_10012839 | 3300005466 | Bacteria | 4408 |
| 131 | Ga0070685_10022270 | 3300005466 | Bacteria | 3452 |
| 132 | Ga0070685_11164484 | 3300005466 | Unclassified | 585 |
| 133 | Ga0070706_100011096 | 3300005467 | Bacteria | 8366 |
| 134 | Ga0070706_100055613 | 3300005467 | Unclassified | 3653 |
| 135 | Ga0070706_100872731 | 3300005467 | Bacteria | 832 |
| 136 | Ga0070707_100001140 | 3300005468 | Bacteria | 26182 |
| 137 | Ga0070707_102149257 | 3300005468 | Bacteria | 526 |
| 138 | Ga0070698_100005110 | 3300005471 | Bacteria | 14361 |
| 139 | Ga0070698_100325334 | 3300005471 | Bacteria | 1468 |
| 140 | Ga0070698_100360830 | 3300005471 | Bacteria | 1385 |
| 141 | Ga0070698_100708532 | 3300005471 | Bacteria | 949 |
| 142 | Ga0070698_101363053 | 3300005471 | Bacteria | 660 |
| 143 | Ga0070699_100003245 | 3300005518 | Bacteria | 14380 |
| 144 | Ga0070699_100284676 | 3300005518 | Bacteria | 1481 |
| 145 | Ga0070699_100464548 | 3300005518 | Bacteria | 1148 |
| 146 | Ga0070699_100847582 | 3300005518 | Bacteria | 837 |
| 147 | Ga0070679_100170334 | 3300005530 | Bacteria | 2150 |
| 148 | Ga0070679_100982853 | 3300005530 | Bacteria | 788 |
| 149 | Ga0070684_100007592 | 3300005535 | Bacteria | 8449 |
| 150 | Ga0070684_100053314 | 3300005535 | Bacteria | 3520 |
| 151 | Ga0070684_100221922 | 3300005535 | Bacteria | 1724 |
| 152 | Ga0070684_100306937 | 3300005535 | Bacteria | 1457 |
| 153 | Ga0070684_100530618 | 3300005535 | Bacteria | 1091 |
| 154 | Ga0070684_100684557 | 3300005535 | Unclassified | 956 |
| 155 | Ga0070697_100057091 | 3300005536 | Bacteria | 3176 |
| 156 | Ga0070697_100070592 | 3300005536 | Unclassified | 2864 |
| 157 | Ga0070697_100631143 | 3300005536 | Bacteria | 943 |
| 158 | Ga0070697_100835260 | 3300005536 | Bacteria | 816 |
| 159 | Ga0068853_100078623 | 3300005539 | Bacteria | 2883 |
| 160 | Ga0068853_100120762 | 3300005539 | Unclassified | 2337 |
| 161 | Ga0068853_100310366 | 3300005539 | Bacteria | 1460 |
| 162 | Ga0070672_100288721 | 3300005543 | Bacteria | 1388 |
| 163 | Ga0070672_100418473 | 3300005543 | Unclassified | 1151 |
| 164 | Ga0070672_100565231 | 3300005543 | Bacteria | 988 |
| 165 | Ga0070672_100909242 | 3300005543 | Unclassified | 778 |
| 166 | Ga0070672_101179490 | 3300005543 | Bacteria | 682 |
| 167 | Ga0070686_100027183 | 3300005544 | Bacteria | 3461 |
| 168 | Ga0070686_100176567 | 3300005544 | Bacteria | 1514 |
| 169 | Ga0070695_100161181 | 3300005545 | Bacteria | 1574 |
| 170 | Ga0070695_100475545 | 3300005545 | Unclassified | 962 |
| 171 | Ga0070696_100019039 | 3300005546 | Bacteria | 4647 |
| 172 | Ga0070696_100046926 | 3300005546 | Bacteria | 2997 |
| 173 | Ga0070696_100053434 | 3300005546 | Bacteria | 2812 |
| 174 | Ga0070696_100692868 | 3300005546 | Bacteria | 830 |
| 175 | Ga0070693_100027999 | 3300005547 | Bacteria | 3060 |
| 176 | Ga0070693_100028027 | 3300005547 | Bacteria | 3058 |
| 177 | Ga0070693_100506041 | 3300005547 | Bacteria | 857 |
| 178 | Ga0070693_100942532 | 3300005547 | Bacteria | 650 |
| 179 | Ga0070665_100159340 | 3300005548 | Bacteria | 2258 |
| 180 | Ga0070665_101013004 | 3300005548 | Bacteria | 843 |
| 181 | Ga0070665_101083977 | 3300005548 | Bacteria | 813 |
| 182 | Ga0070704_100175320 | 3300005549 | Bacteria | 1709 |
| 183 | Ga0070704_100242746 | 3300005549 | Bacteria | 1475 |
| 184 | Ga0070704_100624938 | 3300005549 | Bacteria | 949 |
| 185 | Ga0070704_101352460 | 3300005549 | Bacteria | 653 |
| 186 | Ga0068855_100015300 | 3300005563 | Bacteria | 9236 |
| 187 | Ga0068855_100748770 | 3300005563 | Bacteria | 1042 |
| 188 | Ga0068855_100981243 | 3300005563 | Bacteria | 888 |
| 189 | Ga0070664_100126925 | 3300005564 | Bacteria | 2238 |
| 190 | Ga0070664_100142731 | 3300005564 | Bacteria | 2110 |
| 191 | Ga0070664_100209117 | 3300005564 | Bacteria | 1743 |
| 192 | Ga0070664_100317665 | 3300005564 | Bacteria | 1410 |
| 193 | Ga0070664_100370429 | 3300005564 | Bacteria | 1306 |
| 194 | Ga0070664_101353046 | 3300005564 | Bacteria | 673 |
| 195 | Ga0068857_100017139 | 3300005577 | Bacteria | 6345 |
| 196 | Ga0068857_101225628 | 3300005577 | Unclassified | 727 |
| 197 | Ga0068854_100029510 | 3300005578 | Bacteria | 3797 |
| 198 | Ga0068854_100173385 | 3300005578 | Bacteria | 1680 |
| 199 | Ga0068854_100233730 | 3300005578 | Bacteria | 1460 |
| 200 | Ga0068854_101811853 | 3300005578 | Bacteria | 560 |
| 201 | Ga0068856_100025558 | 3300005614 | Bacteria | 5758 |
| 202 | Ga0068856_100032522 | 3300005614 | Bacteria | 5107 |
| 203 | Ga0068856_101013131 | 3300005614 | Bacteria | 849 |
| 204 | Ga0068856_101156472 | 3300005614 | Bacteria | 791 |
| 205 | Ga0070702_100117565 | 3300005615 | Bacteria | 1659 |
| 206 | Ga0070702_100178823 | 3300005615 | Unclassified | 1386 |
| 207 | Ga0070702_100322214 | 3300005615 | Bacteria | 1077 |
| 208 | Ga0070702_101117195 | 3300005615 | Bacteria | 631 |
| 209 | Ga0068852_101303614 | 3300005616 | Bacteria | 748 |
| 210 | Ga0068852_101311780 | 3300005616 | Bacteria | 746 |
| 211 | Ga0068852_101773996 | 3300005616 | Bacteria | 639 |
| 212 | Ga0068859_100065944 | 3300005617 | Bacteria | 3655 |
| 213 | Ga0068859_100124067 | 3300005617 | Bacteria | 2650 |
| 214 | Ga0068859_100733312 | 3300005617 | Bacteria | 1078 |
| 215 | Ga0068859_101427254 | 3300005617 | Bacteria | 764 |
| 216 | Ga0068859_101876958 | 3300005617 | Bacteria | 662 |
| 217 | Ga0068864_100071508 | 3300005618 | Bacteria | 3021 |
| 218 | Ga0068864_100077079 | 3300005618 | Bacteria | 2914 |
| 219 | Ga0068864_100741969 | 3300005618 | Bacteria | 962 |
| 220 | Ga0068864_101523984 | 3300005618 | Bacteria | 672 |
| 221 | Ga0068866_10023145 | 3300005718 | Bacteria | 2885 |
| 222 | Ga0068866_10085225 | 3300005718 | Unclassified | 1707 |
| 223 | Ga0068866_11270275 | 3300005718 | Unclassified | 534 |
| 224 | Ga0068861_100157420 | 3300005719 | Bacteria | 1870 |
| 225 | Ga0068851_10358836 | 3300005834 | Bacteria | 850 |
| 226 | Ga0068870_10239947 | 3300005840 | Bacteria | 1118 |
| 227 | Ga0068863_100039417 | 3300005841 | Bacteria | 4494 |
| 228 | Ga0068863_100346938 | 3300005841 | Bacteria | 1445 |
| 229 | Ga0068863_101104263 | 3300005841 | Unclassified | 798 |
| 230 | Ga0068863_102024205 | 3300005841 | Unclassified | 586 |
| 231 | Ga0068858_100042091 | 3300005842 | Bacteria | 4235 |
| 232 | Ga0068858_100426474 | 3300005842 | Bacteria | 1276 |
| 233 | Ga0068860_100050463 | 3300005843 | Bacteria | 3961 |
| 234 | Ga0068860_100177932 | 3300005843 | Bacteria | 2056 |
| 235 | Ga0068862_100481106 | 3300005844 | Bacteria | 1175 |
| 236 | Ga0068862_100755101 | 3300005844 | Bacteria | 947 |
| 237 | Ga0068862_101163241 | 3300005844 | Bacteria | 769 |
| 238 | Ga0081455_10004989 | 3300005937 | Bacteria | 14680 |
| 239 | Ga0081455_10009742 | 3300005937 | Bacteria | 9844 |
| 240 | Ga0081455_10010644 | 3300005937 | Bacteria | 9306 |
| 241 | Ga0081455_10069673 | 3300005937 | Bacteria | 2923 |
| 242 | Ga0081455_10072475 | 3300005937 | Bacteria | 2851 |
| 243 | Ga0081455_10613987 | 3300005937 | Bacteria | 706 |
| 244 | Ga0081455_10714771 | 3300005937 | Bacteria | 637 |
| 245 | Ga0081455_10733579 | 3300005937 | Bacteria | 626 |
| 246 | Ga0081538_10000455 | 3300005981 | Bacteria | 45816 |
| 247 | Ga0081538_10001433 | 3300005981 | Bacteria | 24526 |
| 248 | Ga0081538_10009908 | 3300005981 | Bacteria | 7876 |
| 249 | Ga0081538_10040893 | 3300005981 | Bacteria | 2950 |
| 250 | Ga0081538_10082381 | 3300005981 | Bacteria | 1706 |
| 251 | Ga0081538_10146498 | 3300005981 | Bacteria | 1078 |
| 252 | Ga0081539_10000433 | 3300005985 | Bacteria | 89118 |
| 253 | Ga0081539_10002473 | 3300005985 | Bacteria | 26001 |
| 254 | Ga0081539_10270259 | 3300005985 | Bacteria | 745 |
| 255 | Ga0075365_10025373 | 3300006038 | Bacteria | 3751 |
| 256 | Ga0075365_10140751 | 3300006038 | Bacteria | 1675 |
| 257 | Ga0075363_100144464 | 3300006048 | Bacteria | 1341 |
| 258 | Ga0075364_10047149 | 3300006051 | Bacteria | 2806 |
| 259 | Ga0075364_10695121 | 3300006051 | Bacteria | 694 |
| 260 | Ga0075432_10000916 | 3300006058 | Bacteria | 9286 |
| 261 | Ga0075432_10200834 | 3300006058 | Bacteria | 789 |
| 262 | Ga0075432_10396740 | 3300006058 | Bacteria | 595 |
| 263 | Ga0070715_10232344 | 3300006163 | Bacteria | 954 |
| 264 | Ga0070712_100224560 | 3300006175 | Bacteria | 1488 |
| 265 | Ga0070712_100281618 | 3300006175 | Bacteria | 1339 |
| 266 | Ga0070712_101367267 | 3300006175 | Bacteria | 617 |
| 267 | Ga0075367_10103257 | 3300006178 | Bacteria | 1745 |
| 268 | Ga0075427_10022127 | 3300006194 | Bacteria | 1014 |
| 269 | Ga0097621_100121910 | 3300006237 | Bacteria | 2212 |
| 270 | Ga0097621_100357266 | 3300006237 | Unclassified | 1301 |
| 271 | Ga0097621_100697350 | 3300006237 | Bacteria | 934 |
| 272 | Ga0097621_100750221 | 3300006237 | Bacteria | 901 |
| 273 | Ga0097621_100896760 | 3300006237 | Bacteria | 826 |
| 274 | Ga0068871_100989417 | 3300006358 | Unclassified | 783 |
| 275 | Ga0075428_100041095 | 3300006844 | Bacteria | 5086 |
| 276 | Ga0075428_100289894 | 3300006844 | Bacteria | 1761 |
| 277 | Ga0075430_100463691 | 3300006846 | Bacteria | 1045 |
| 278 | Ga0075433_10009841 | 3300006852 | Bacteria | 7662 |
| 279 | Ga0075433_10156592 | 3300006852 | Bacteria | 2027 |
| 280 | Ga0075433_10762775 | 3300006852 | Bacteria | 846 |
| 281 | Ga0075433_11127767 | 3300006852 | Bacteria | 682 |
| 282 | Ga0075434_100035225 | 3300006871 | Bacteria | 4947 |
| 283 | Ga0075434_100348572 | 3300006871 | Bacteria | 1502 |
| 284 | Ga0075434_101268555 | 3300006871 | Bacteria | 748 |
| 285 | Ga0075434_102000246 | 3300006871 | Bacteria | 585 |
| 286 | Ga0075429_101950759 | 3300006880 | Bacteria | 509 |
| 287 | Ga0068865_100022607 | 3300006881 | Bacteria | 4105 |
| 288 | Ga0068865_100414153 | 3300006881 | Unclassified | 1106 |
| 289 | Ga0068865_100514963 | 3300006881 | Unclassified | 1000 |
| 290 | Ga0068865_100782559 | 3300006881 | Bacteria | 822 |
| 291 | Ga0068865_101100462 | 3300006881 | Bacteria | 700 |
| 292 | Ga0097620_100065943 | 3300006931 | Bacteria | 3655 |
| 293 | Ga0097620_100124078 | 3300006931 | Bacteria | 2650 |
| 294 | Ga0097620_100733262 | 3300006931 | Bacteria | 1078 |
| 295 | Ga0097620_101427294 | 3300006931 | Bacteria | 764 |
| 296 | Ga0097620_101876851 | 3300006931 | Bacteria | 662 |
| 297 | Ga0099794_10475768 | 3300007265 | Bacteria | 656 |
| 298 | Ga0105251_10527706 | 3300009011 | Bacteria | 554 |
| 299 | Ga0105244_10095722 | 3300009036 | Bacteria | 1457 |
| 300 | Ga0111539_10030693 | 3300009094 | Bacteria | 6534 |
| 301 | Ga0111539_10050110 | 3300009094 | Bacteria | 4975 |
| 302 | Ga0111539_10171496 | 3300009094 | Bacteria | 2535 |
| 303 | Ga0111539_10474282 | 3300009094 | Unclassified | 1457 |
| 304 | Ga0111539_10728048 | 3300009094 | Bacteria | 1155 |
| 305 | Ga0111539_11529214 | 3300009094 | Bacteria | 774 |
| 306 | Ga0111539_11764413 | 3300009094 | Bacteria | 718 |
| 307 | Ga0111539_11919891 | 3300009094 | Bacteria | 687 |
| 308 | Ga0105245_10014329 | 3300009098 | Bacteria | 6907 |
| 309 | Ga0105245_10021343 | 3300009098 | Bacteria | 5679 |
| 310 | Ga0105245_10030449 | 3300009098 | Bacteria | 4772 |
| 311 | Ga0105245_10088167 | 3300009098 | Bacteria | 2849 |
| 312 | Ga0105245_10090064 | 3300009098 | Bacteria | 2821 |
| 313 | Ga0105245_10115226 | 3300009098 | Bacteria | 2504 |
| 314 | Ga0105245_10262572 | 3300009098 | Bacteria | 1681 |
| 315 | Ga0105245_10868121 | 3300009098 | Unclassified | 943 |
| 316 | Ga0105245_10989227 | 3300009098 | Bacteria | 885 |
| 317 | Ga0105245_11013920 | 3300009098 | Bacteria | 875 |
| 318 | Ga0105245_11670879 | 3300009098 | Bacteria | 689 |
| 319 | Ga0105247_10022930 | 3300009101 | Bacteria | 3759 |
| 320 | Ga0105247_10192568 | 3300009101 | Bacteria | 1366 |
| 321 | Ga0105247_11765423 | 3300009101 | Unclassified | 514 |
| 322 | Ga0114129_10015075 | 3300009147 | Bacteria | 11003 |
| 323 | Ga0114129_10182701 | 3300009147 | Bacteria | 2853 |
| 324 | Ga0114129_10673280 | 3300009147 | Bacteria | 1333 |
| 325 | Ga0114129_10969677 | 3300009147 | Bacteria | 1073 |
| 326 | Ga0114129_11322094 | 3300009147 | Bacteria | 892 |
| 327 | Ga0105243_10005317 | 3300009148 | Bacteria | 10064 |
| 328 | Ga0105243_10006578 | 3300009148 | Bacteria | 8980 |
| 329 | Ga0105243_10010461 | 3300009148 | Bacteria | 7045 |
| 330 | Ga0105243_10022845 | 3300009148 | Bacteria | 4755 |
| 331 | Ga0105243_10259504 | 3300009148 | Bacteria | 1555 |
| 332 | Ga0105243_10361107 | 3300009148 | Bacteria | 1337 |
| 333 | Ga0105243_10776206 | 3300009148 | Bacteria | 942 |
| 334 | Ga0105243_13021997 | 3300009148 | Bacteria | 510 |
| 335 | Ga0105241_10063486 | 3300009174 | Bacteria | 2850 |
| 336 | Ga0105241_10184877 | 3300009174 | Bacteria | 1731 |
| 337 | Ga0105241_11275703 | 3300009174 | Bacteria | 699 |
| 338 | Ga0105242_10030820 | 3300009176 | Bacteria | 4284 |
| 339 | Ga0105242_10364404 | 3300009176 | Bacteria | 1338 |
| 340 | Ga0105242_10428682 | 3300009176 | Bacteria | 1241 |
| 341 | Ga0105242_11148020 | 3300009176 | Unclassified | 793 |
| 342 | Ga0105248_10047215 | 3300009177 | Bacteria | 4829 |
| 343 | Ga0105248_10107080 | 3300009177 | Bacteria | 3152 |
| 344 | Ga0105248_10330267 | 3300009177 | Bacteria | 1717 |
| 345 | Ga0105248_10376102 | 3300009177 | Bacteria | 1599 |
| 346 | Ga0105248_10473074 | 3300009177 | Bacteria | 1412 |
| 347 | Ga0105248_10981775 | 3300009177 | Bacteria | 954 |
| 348 | Ga0105237_10152886 | 3300009545 | Bacteria | 2304 |
| 349 | Ga0105237_10494816 | 3300009545 | Unclassified | 1229 |
| 350 | Ga0105237_11159942 | 3300009545 | Bacteria | 779 |
| 351 | Ga0105238_10232416 | 3300009551 | Bacteria | 1820 |
| 352 | Ga0105238_10573314 | 3300009551 | Bacteria | 1134 |
| 353 | Ga0105238_11966782 | 3300009551 | Bacteria | 618 |
| 354 | Ga0105249_10012027 | 3300009553 | Bacteria | 7616 |
| 355 | Ga0105249_10069580 | 3300009553 | Bacteria | 3248 |
| 356 | Ga0105249_10140403 | 3300009553 | Bacteria | 2316 |
| 357 | Ga0105249_10157047 | 3300009553 | Bacteria | 2194 |
| 358 | Ga0105249_10805161 | 3300009553 | Bacteria | 1004 |
| 359 | Ga0105249_12889210 | 3300009553 | Bacteria | 551 |
| 360 | Ga0105239_10035143 | 3300010375 | Bacteria | 5504 |
| 361 | Ga0105239_10067076 | 3300010375 | Bacteria | 3941 |
| 362 | Ga0105239_10178508 | 3300010375 | Bacteria | 2375 |
| 363 | Ga0105239_10312288 | 3300010375 | Bacteria | 1772 |
| 364 | Ga0105239_10325532 | 3300010375 | Bacteria | 1733 |
| 365 | Ga0105239_10749206 | 3300010375 | Bacteria | 1118 |
| 366 | Ga0105239_11142471 | 3300010375 | Bacteria | 897 |
| 367 | Ga0105246_10006081 | 3300011119 | Bacteria | 7365 |
| 368 | Ga0105246_10016508 | 3300011119 | Bacteria | 4676 |
| 369 | Ga0105246_10061149 | 3300011119 | Unclassified | 2619 |
| 370 | Ga0105246_10132994 | 3300011119 | Unclassified | 1860 |
| 371 | Ga0157325_1008815 | 3300012485 | Bacteria | 708 |
| 372 | Ga0157323_1032526 | 3300012495 | Bacteria | 561 |
| 373 | Ga0157345_1017880 | 3300012498 | Bacteria | 695 |
| 374 | Ga0157345_1023719 | 3300012498 | Unclassified | 643 |
| 375 | Ga0157345_1034043 | 3300012498 | Bacteria | 585 |
| 376 | Ga0157313_1063537 | 3300012503 | Bacteria | 510 |
| 377 | Ga0157326_1016137 | 3300012513 | Bacteria | 883 |
| 378 | Ga0157373_10393176 | 3300013100 | Bacteria | 993 |
| 379 | Ga0157373_10421005 | 3300013100 | Bacteria | 959 |
| 380 | Ga0157373_11050036 | 3300013100 | Bacteria | 610 |
| 381 | Ga0157371_10021612 | 3300013102 | Bacteria | 4722 |
| 382 | Ga0157370_10103065 | 3300013104 | Bacteria | 2671 |
| 383 | Ga0157370_10449617 | 3300013104 | Bacteria | 1185 |
| 384 | Ga0157370_10872439 | 3300013104 | Unclassified | 817 |
| 385 | Ga0157370_11542637 | 3300013104 | Bacteria | 597 |
| 386 | Ga0157369_10068725 | 3300013105 | Bacteria | 3806 |
| 387 | Ga0157369_10143234 | 3300013105 | Bacteria | 2528 |
| 388 | Ga0157369_11681930 | 3300013105 | Unclassified | 645 |
| 389 | Ga0157374_10223079 | 3300013296 | Unclassified | 1850 |
| 390 | Ga0157374_10263156 | 3300013296 | Bacteria | 1699 |
| 391 | Ga0157374_10356400 | 3300013296 | Bacteria | 1454 |
| 392 | Ga0157374_10386513 | 3300013296 | Bacteria | 1395 |
| 393 | Ga0157378_10182730 | 3300013297 | Bacteria | 1974 |
| 394 | Ga0157378_10687528 | 3300013297 | Bacteria | 1041 |
| 395 | Ga0157378_10710622 | 3300013297 | Bacteria | 1025 |
| 396 | Ga0157378_11381213 | 3300013297 | Bacteria | 747 |
| 397 | Ga0157378_12091381 | 3300013297 | Unclassified | 617 |
| 398 | Ga0163162_10074008 | 3300013306 | Bacteria | 3464 |
| 399 | Ga0163162_10172146 | 3300013306 | Bacteria | 2290 |
| 400 | Ga0163162_10288659 | 3300013306 | Bacteria | 1772 |
| 401 | Ga0163162_10365155 | 3300013306 | Bacteria | 1576 |
| 402 | Ga0163162_11222852 | 3300013306 | Unclassified | 853 |
| 403 | Ga0157372_10010570 | 3300013307 | Bacteria | 9817 |
| 404 | Ga0157372_10019388 | 3300013307 | Bacteria | 7330 |
| 405 | Ga0157372_10037591 | 3300013307 | Bacteria | 5342 |
| 406 | Ga0157372_10714908 | 3300013307 | Unclassified | 1165 |
| 407 | Ga0157372_10782081 | 3300013307 | Bacteria | 1109 |
| 408 | Ga0157372_10882040 | 3300013307 | Bacteria | 1038 |
| 409 | Ga0157372_13049456 | 3300013307 | Bacteria | 535 |
| 410 | Ga0157375_10006932 | 3300013308 | Bacteria | 9892 |
| 411 | Ga0157375_10024250 | 3300013308 | Bacteria | 5611 |
| 412 | Ga0157375_10037257 | 3300013308 | Bacteria | 4658 |
| 413 | Ga0157375_10137598 | 3300013308 | Bacteria | 2567 |
| 414 | Ga0157375_10999639 | 3300013308 | Bacteria | 976 |
| 415 | Ga0157375_11466925 | 3300013308 | Bacteria | 805 |
| 416 | Ga0157375_11555529 | 3300013308 | Unclassified | 781 |
| 417 | Ga0157375_11829584 | 3300013308 | Bacteria | 720 |
| 418 | Ga0163163_10027729 | 3300014325 | Bacteria | 5430 |
| 419 | Ga0163163_10841957 | 3300014325 | Bacteria | 981 |
| 420 | Ga0163163_11294371 | 3300014325 | Unclassified | 791 |
| 421 | Ga0157380_10014720 | 3300014326 | Bacteria | 5727 |
| 422 | Ga0157380_10065983 | 3300014326 | Bacteria | 2911 |
| 423 | Ga0157380_11130552 | 3300014326 | Unclassified | 824 |
| 424 | Ga0157380_12174787 | 3300014326 | Bacteria | 618 |
| 425 | Ga0182008_10517117 | 3300014497 | Bacteria | 659 |
| 426 | Ga0157377_10004373 | 3300014745 | Bacteria | 6494 |
| 427 | Ga0157377_10006704 | 3300014745 | Bacteria | 5513 |
| 428 | Ga0157377_10007184 | 3300014745 | Bacteria | 5362 |
| 429 | Ga0157377_10113716 | 3300014745 | Bacteria | 1630 |
| 430 | Ga0157377_10134914 | 3300014745 | Bacteria | 1511 |
| 431 | Ga0157379_10023710 | 3300014968 | Bacteria | 5448 |
| 432 | Ga0157379_10147312 | 3300014968 | Bacteria | 2123 |
| 433 | Ga0157379_10534903 | 3300014968 | Bacteria | 1089 |
| 434 | Ga0157379_10615395 | 3300014968 | Bacteria | 1015 |
| 435 | Ga0157379_10621041 | 3300014968 | Bacteria | 1010 |
| 436 | Ga0157379_10925148 | 3300014968 | Bacteria | 828 |
| 437 | Ga0157379_11062946 | 3300014968 | Unclassified | 774 |
| 438 | Ga0157379_12328083 | 3300014968 | Unclassified | 534 |
| 439 | Ga0157376_10058622 | 3300014969 | Bacteria | 3226 |
| 440 | Ga0157376_10111583 | 3300014969 | Bacteria | 2408 |
| 441 | Ga0157376_10493049 | 3300014969 | Bacteria | 1202 |
| 442 | Ga0157376_10736064 | 3300014969 | Bacteria | 994 |
| 443 | Ga0157376_11128424 | 3300014969 | Bacteria | 810 |
| 444 | Ga0163161_10501362 | 3300017792 | Bacteria | 989 |
| 445 | Ga0163161_10682542 | 3300017792 | Bacteria | 854 |
| 446 | Ga0206352_10759126 | 3300020078 | Bacteria | 630 |
| 447 | Ga0207697_10363673 | 3300025315 | Bacteria | 642 |
| 448 | Ga0207653_10361244 | 3300025885 | Unclassified | 568 |
| 449 | Ga0207692_10011250 | 3300025898 | Bacteria | 3799 |
| 450 | Ga0207642_11012012 | 3300025899 | Bacteria | 535 |
| 451 | Ga0207710_10131411 | 3300025900 | Bacteria | 1203 |
| 452 | Ga0207688_10007299 | 3300025901 | Bacteria | 6013 |
| 453 | Ga0207688_10134796 | 3300025901 | Bacteria | 1449 |
| 454 | Ga0207688_10257604 | 3300025901 | Unclassified | 1058 |
| 455 | Ga0207688_10624642 | 3300025901 | Unclassified | 680 |
| 456 | Ga0207680_10245322 | 3300025903 | Bacteria | 1235 |
| 457 | Ga0207647_10237412 | 3300025904 | Unclassified | 1048 |
| 458 | Ga0207647_10432737 | 3300025904 | Bacteria | 739 |
| 459 | Ga0207685_10378344 | 3300025905 | Unclassified | 721 |
| 460 | Ga0207643_10340200 | 3300025908 | Bacteria | 940 |
| 461 | Ga0207705_11277532 | 3300025909 | Bacteria | 561 |
| 462 | Ga0207684_10005731 | 3300025910 | Bacteria | 11405 |
| 463 | Ga0207684_10106749 | 3300025910 | Bacteria | 2396 |
| 464 | Ga0207684_11168896 | 3300025910 | Unclassified | 638 |
| 465 | Ga0207654_10079750 | 3300025911 | Bacteria | 1967 |
| 466 | Ga0207654_10606875 | 3300025911 | Bacteria | 781 |
| 467 | Ga0207707_10201253 | 3300025912 | Bacteria | 1736 |
| 468 | Ga0207693_10001943 | 3300025915 | Bacteria | 18114 |
| 469 | Ga0207663_10280586 | 3300025916 | Bacteria | 1237 |
| 470 | Ga0207660_10062179 | 3300025917 | Bacteria | 2689 |
| 471 | Ga0207660_11036114 | 3300025917 | Unclassified | 669 |
| 472 | Ga0207662_10049964 | 3300025918 | Bacteria | 2483 |
| 473 | Ga0207662_10203884 | 3300025918 | Bacteria | 1281 |
| 474 | Ga0207662_10852172 | 3300025918 | Bacteria | 644 |
| 475 | Ga0207657_10021706 | 3300025919 | Bacteria | 6035 |
| 476 | Ga0207657_10047357 | 3300025919 | Bacteria | 3760 |
| 477 | Ga0207657_10051759 | 3300025919 | Bacteria | 3568 |
| 478 | Ga0207657_10390858 | 3300025919 | Bacteria | 1094 |
| 479 | Ga0207652_10255659 | 3300025921 | Bacteria | 1580 |
| 480 | Ga0207652_10327869 | 3300025921 | Bacteria | 1382 |
| 481 | Ga0207652_10537375 | 3300025921 | Bacteria | 1051 |
| 482 | Ga0207652_10884027 | 3300025921 | Bacteria | 790 |
| 483 | Ga0207646_10011914 | 3300025922 | Bacteria | 8385 |
| 484 | Ga0207646_10214101 | 3300025922 | Bacteria | 1740 |
| 485 | Ga0207681_10051803 | 3300025923 | Bacteria | 2782 |
| 486 | Ga0207681_10285906 | 3300025923 | Bacteria | 1300 |
| 487 | Ga0207681_10482708 | 3300025923 | Bacteria | 1012 |
| 488 | Ga0207681_10818100 | 3300025923 | Bacteria | 779 |
| 489 | Ga0207694_10569964 | 3300025924 | Bacteria | 951 |
| 490 | Ga0207650_10097773 | 3300025925 | Bacteria | 2254 |
| 491 | Ga0207650_10176937 | 3300025925 | Bacteria | 1698 |
| 492 | Ga0207650_11580123 | 3300025925 | Bacteria | 557 |
| 493 | Ga0207659_10616438 | 3300025926 | Bacteria | 926 |
| 494 | Ga0207687_10020639 | 3300025927 | Bacteria | 4372 |
| 495 | Ga0207687_10053134 | 3300025927 | Bacteria | 2829 |
| 496 | Ga0207687_10061082 | 3300025927 | Bacteria | 2660 |
| 497 | Ga0207687_10075211 | 3300025927 | Bacteria | 2423 |
| 498 | Ga0207687_10108427 | 3300025927 | Bacteria | 2056 |
| 499 | Ga0207687_10152582 | 3300025927 | Bacteria | 1764 |
| 500 | Ga0207687_11233921 | 3300025927 | Bacteria | 643 |
| 501 | Ga0207687_11574431 | 3300025927 | Bacteria | 564 |
| 502 | Ga0207644_10327002 | 3300025931 | Bacteria | 1241 |
| 503 | Ga0207644_10555926 | 3300025931 | Bacteria | 950 |
| 504 | Ga0207690_10014001 | 3300025932 | Bacteria | 4835 |
| 505 | Ga0207690_10057756 | 3300025932 | Bacteria | 2622 |
| 506 | Ga0207690_10758768 | 3300025932 | Bacteria | 800 |
| 507 | Ga0207690_11009896 | 3300025932 | Unclassified | 692 |
| 508 | Ga0207706_10200937 | 3300025933 | Bacteria | 1748 |
| 509 | Ga0207706_10451583 | 3300025933 | Bacteria | 1112 |
| 510 | Ga0207686_10052207 | 3300025934 | Bacteria | 2550 |
| 511 | Ga0207686_10057574 | 3300025934 | Unclassified | 2447 |
| 512 | Ga0207686_10577855 | 3300025934 | Bacteria | 882 |
| 513 | Ga0207686_10763294 | 3300025934 | Bacteria | 773 |
| 514 | Ga0207686_11067083 | 3300025934 | Bacteria | 657 |
| 515 | Ga0207686_11639897 | 3300025934 | Unclassified | 531 |
| 516 | Ga0207709_10007458 | 3300025935 | Bacteria | 6090 |
| 517 | Ga0207709_10024515 | 3300025935 | Bacteria | 3446 |
| 518 | Ga0207709_10086123 | 3300025935 | Bacteria | 2039 |
| 519 | Ga0207709_10160439 | 3300025935 | Bacteria | 1568 |
| 520 | Ga0207709_10668334 | 3300025935 | Bacteria | 829 |
| 521 | Ga0207709_11159446 | 3300025935 | Unclassified | 636 |
| 522 | Ga0207670_10056928 | 3300025936 | Bacteria | 2649 |
| 523 | Ga0207669_10040581 | 3300025937 | Unclassified | 2701 |
| 524 | Ga0207669_10077546 | 3300025937 | Bacteria | 2114 |
| 525 | Ga0207669_10319301 | 3300025937 | Bacteria | 1188 |
| 526 | Ga0207669_10634888 | 3300025937 | Unclassified | 872 |
| 527 | Ga0207669_10923591 | 3300025937 | Bacteria | 730 |
| 528 | Ga0207669_11117961 | 3300025937 | Bacteria | 665 |
| 529 | Ga0207704_10036661 | 3300025938 | Bacteria | 2824 |
| 530 | Ga0207704_10068434 | 3300025938 | Bacteria | 2238 |
| 531 | Ga0207704_10773163 | 3300025938 | Unclassified | 800 |
| 532 | Ga0207704_11086616 | 3300025938 | Unclassified | 679 |
| 533 | Ga0207691_10154403 | 3300025940 | Bacteria | 2017 |
| 534 | Ga0207691_10260242 | 3300025940 | Bacteria | 1496 |
| 535 | Ga0207691_10357376 | 3300025940 | Bacteria | 1249 |
| 536 | Ga0207691_10886940 | 3300025940 | Unclassified | 747 |
| 537 | Ga0207711_10101714 | 3300025941 | Bacteria | 2543 |
| 538 | Ga0207711_10159167 | 3300025941 | Bacteria | 2042 |
| 539 | Ga0207711_10266614 | 3300025941 | Bacteria | 1575 |
| 540 | Ga0207711_10307870 | 3300025941 | Bacteria | 1462 |
| 541 | Ga0207711_10471904 | 3300025941 | Bacteria | 1169 |
| 542 | Ga0207689_10033678 | 3300025942 | Bacteria | 4256 |
| 543 | Ga0207689_10349344 | 3300025942 | Bacteria | 1229 |
| 544 | Ga0207661_10000201 | 3300025944 | Bacteria | 38650 |
| 545 | Ga0207661_10033747 | 3300025944 | Bacteria | 3974 |
| 546 | Ga0207661_10145573 | 3300025944 | Bacteria | 2044 |
| 547 | Ga0207661_10179996 | 3300025944 | Bacteria | 1846 |
| 548 | Ga0207661_10383468 | 3300025944 | Bacteria | 1272 |
| 549 | Ga0207661_10634518 | 3300025944 | Bacteria | 981 |
| 550 | Ga0207679_10103030 | 3300025945 | Bacteria | 2236 |
| 551 | Ga0207679_10184224 | 3300025945 | Bacteria | 1730 |
| 552 | Ga0207679_10307648 | 3300025945 | Bacteria | 1368 |
| 553 | Ga0207679_11317594 | 3300025945 | Bacteria | 663 |
| 554 | Ga0207679_12078597 | 3300025945 | Bacteria | 516 |
| 555 | Ga0207667_11213177 | 3300025949 | Bacteria | 734 |
| 556 | Ga0207651_10075159 | 3300025960 | Bacteria | 2409 |
| 557 | Ga0207651_10488230 | 3300025960 | Bacteria | 1063 |
| 558 | Ga0207712_10082938 | 3300025961 | Bacteria | 2338 |
| 559 | Ga0207712_10150551 | 3300025961 | Bacteria | 1797 |
| 560 | Ga0207712_10157589 | 3300025961 | Bacteria | 1760 |
| 561 | Ga0207712_10205645 | 3300025961 | Bacteria | 1564 |
| 562 | Ga0207712_11186000 | 3300025961 | Unclassified | 681 |
| 563 | Ga0207668_10310213 | 3300025972 | Bacteria | 1305 |
| 564 | Ga0207668_10586938 | 3300025972 | Bacteria | 969 |
| 565 | Ga0207668_10715844 | 3300025972 | Unclassified | 881 |
| 566 | Ga0207668_11371177 | 3300025972 | Bacteria | 637 |
| 567 | Ga0207668_11459029 | 3300025972 | Bacteria | 617 |
| 568 | Ga0207640_10081176 | 3300025981 | Bacteria | 2216 |
| 569 | Ga0207640_10494085 | 3300025981 | Unclassified | 1018 |
| 570 | Ga0207640_10672688 | 3300025981 | Bacteria | 884 |
| 571 | Ga0207658_11955213 | 3300025986 | Unclassified | 534 |
| 572 | Ga0207677_10014458 | 3300026023 | Bacteria | 4610 |
| 573 | Ga0207677_10024296 | 3300026023 | Bacteria | 3762 |
| 574 | Ga0207677_10094988 | 3300026023 | Bacteria | 2178 |
| 575 | Ga0207677_10343185 | 3300026023 | Bacteria | 1248 |
| 576 | Ga0207677_10408538 | 3300026023 | Bacteria | 1153 |
| 577 | Ga0207677_10616637 | 3300026023 | Bacteria | 954 |
| 578 | Ga0207703_10227412 | 3300026035 | Bacteria | 1671 |
| 579 | Ga0207703_10511509 | 3300026035 | Bacteria | 1128 |
| 580 | Ga0207639_10006229 | 3300026041 | Bacteria | 8104 |
| 581 | Ga0207639_10316424 | 3300026041 | Bacteria | 1384 |
| 582 | Ga0207639_10397553 | 3300026041 | Bacteria | 1241 |
| 583 | Ga0207639_10770099 | 3300026041 | Unclassified | 896 |
| 584 | Ga0207678_10446655 | 3300026067 | Unclassified | 1123 |
| 585 | Ga0207678_10516197 | 3300026067 | Bacteria | 1042 |
| 586 | Ga0207678_10929306 | 3300026067 | Bacteria | 769 |
| 587 | Ga0207708_10008436 | 3300026075 | Bacteria | 7625 |
| 588 | Ga0207708_10014138 | 3300026075 | Bacteria | 5967 |
| 589 | Ga0207708_10015442 | 3300026075 | Bacteria | 5727 |
| 590 | Ga0207708_10079925 | 3300026075 | Bacteria | 2512 |
| 591 | Ga0207708_11661714 | 3300026075 | Bacteria | 561 |
| 592 | Ga0207708_11703477 | 3300026075 | Bacteria | 554 |
| 593 | Ga0207702_10441500 | 3300026078 | Bacteria | 1261 |
| 594 | Ga0207702_10443468 | 3300026078 | Bacteria | 1258 |
| 595 | Ga0207702_10737322 | 3300026078 | Bacteria | 972 |
| 596 | Ga0207702_10958677 | 3300026078 | Bacteria | 848 |
| 597 | Ga0207641_10153875 | 3300026088 | Bacteria | 2085 |
| 598 | Ga0207641_10455801 | 3300026088 | Bacteria | 1237 |
| 599 | Ga0207648_10009931 | 3300026089 | Bacteria | 9070 |
| 600 | Ga0207648_10065012 | 3300026089 | Bacteria | 3180 |
| 601 | Ga0207648_10155599 | 3300026089 | Bacteria | 2018 |
| 602 | Ga0207648_11036299 | 3300026089 | Bacteria | 769 |
| 603 | Ga0207676_10144401 | 3300026095 | Bacteria | 2042 |
| 604 | Ga0207676_10339480 | 3300026095 | Bacteria | 1385 |
| 605 | Ga0207676_11262606 | 3300026095 | Bacteria | 733 |
| 606 | Ga0207674_10036913 | 3300026116 | Bacteria | 5086 |
| 607 | Ga0207674_10129499 | 3300026116 | Bacteria | 2488 |
| 608 | Ga0207674_10276682 | 3300026116 | Bacteria | 1626 |
| 609 | Ga0207674_10299058 | 3300026116 | Bacteria | 1558 |
| 610 | Ga0207674_10453880 | 3300026116 | Bacteria | 1239 |
| 611 | Ga0207675_100147146 | 3300026118 | Bacteria | 2240 |
| 612 | Ga0207675_100545992 | 3300026118 | Bacteria | 1158 |
| 613 | Ga0207675_100815580 | 3300026118 | Bacteria | 947 |
| 614 | Ga0207683_10049311 | 3300026121 | Bacteria | 3686 |
| 615 | Ga0207683_10052414 | 3300026121 | Bacteria | 3575 |
| 616 | Ga0207683_11403105 | 3300026121 | Bacteria | 646 |
| 617 | Ga0207698_10080840 | 3300026142 | Bacteria | 2620 |
| 618 | Ga0207698_10921078 | 3300026142 | Bacteria | 882 |
| 619 | Ga0207698_11192379 | 3300026142 | Bacteria | 775 |
| 620 | Ga0207698_11379564 | 3300026142 | Unclassified | 720 |
| 621 | Ga0209970_1046001 | 3300027614 | Bacteria | 783 |
| 622 | Ga0209983_1138022 | 3300027665 | Bacteria | 558 |
| 623 | Ga0207428_10000181 | 3300027907 | Bacteria | 88299 |
| 624 | Ga0207428_10092718 | 3300027907 | Bacteria | 2344 |
| 625 | Ga0207428_10312886 | 3300027907 | Bacteria | 1161 |
| 626 | Ga0268266_10409601 | 3300028379 | Bacteria | 1283 |
| 627 | Ga0268265_10085490 | 3300028380 | Bacteria | 2504 |
| 628 | Ga0268265_10520806 | 3300028380 | Bacteria | 1124 |
| 629 | Ga0268265_10617289 | 3300028380 | Bacteria | 1038 |
| 630 | Ga0268265_10872902 | 3300028380 | Unclassified | 882 |
| 631 | Ga0268264_10118885 | 3300028381 | Bacteria | 2326 |
| 632 | Ga0268264_10209075 | 3300028381 | Bacteria | 1790 |
| 633 | Ga0268264_10576626 | 3300028381 | Unclassified | 1106 |
| 634 | Ga0265319_1019848 | 3300028563 | Bacteria | 2502 |
| 635 | Ga0265319_1111882 | 3300028563 | Unclassified | 853 |
| 636 | Ga0265334_10293024 | 3300028573 | Bacteria | 557 |
| 637 | Ga0265318_10041523 | 3300028577 | Unclassified | 1749 |
| 638 | Ga0265322_10208511 | 3300028654 | Bacteria | 559 |
| 639 | Ga0265338_10103776 | 3300028800 | Bacteria | 2308 |
| 640 | Ga0265330_10316026 | 3300031235 | Bacteria | 659 |
| 641 | Ga0265320_10076132 | 3300031240 | Bacteria | 1573 |
| 642 | Ga0265340_10104531 | 3300031247 | Bacteria | 1314 |
| 643 | Ga0265327_10357831 | 3300031251 | Bacteria | 637 |
| 644 | Ga0265316_10471756 | 3300031344 | Bacteria | 899 |
| 645 | Ga0307408_100357206 | 3300031548 | Bacteria | 1242 |
| 646 | Ga0307409_102217660 | 3300031995 | Bacteria | 579 |
| 647 | Ga0307416_102184605 | 3300032002 | Bacteria | 655 |
| 648 | Ga0373950_0005073 | 3300034818 | Bacteria | 1954 |
| 649 | Ga0373958_0047854 | 3300034819 | Bacteria | 895 |
| 650 | Ga0373952_0005081 | 3300035092 | Bacteria | 2398 |
| 651 | Ga0373932_0063775 | 3300035112 | Bacteria | 1126 |
| 652 | Ga0373939_0013207 | 3300035114 | Bacteria | 2121 |
| 653 | Ga0373941_0024348 | 3300035115 | Bacteria | 1738 |
| 654 | Ga0373960_0025189 | 3300035121 | Bacteria | 1615 |
| 655 | Ga0373960_0043032 | 3300035121 | Bacteria | 1314 |
| 656 | Ga0373931_0036985 | 3300035691 | Bacteria | 2547 |
| 657 | Ga0373931_0326681 | 3300035691 | Bacteria | 954 |
| 658 | Ga0373931_0588758 | 3300035691 | Bacteria | 726 |
| 659 | Ga0373935_0225660 | 3300035692 | Unclassified | 1303 |
| 660 | Ga0373935_1246748 | 3300035692 | Unclassified | 555 |
| 661 | Ga0373933_0159854 | 3300035724 | Bacteria | 1430 |
| 662 | Ga0373947_0093388 | 3300035725 | Bacteria | 1880 |
| 663 | Ga0373937_0481842 | 3300036401 | Bacteria | 1178 |
| 664 | Ga0373937_0862869 | 3300036401 | Bacteria | 854 |
| 665 | Ga0373925_0108139 | 3300037068 | Bacteria | 2146 |
| 666 | Ga0395899_0002410 | 3300037312 | Bacteria | 15195 |
| 667 | Ga0395899_0162090 | 3300037312 | Bacteria | 1579 |
| 668 | Ga0395899_0373710 | 3300037312 | Bacteria | 949 |
| 669 | Ga0395899_0375464 | 3300037312 | Bacteria | 946 |
| 670 | Ga0395900_0037086 | 3300037418 | Bacteria | 5027 |
| 671 | Ga0395900_0093680 | 3300037418 | Bacteria | 3085 |
| 672 | Ga0395900_0306984 | 3300037418 | Bacteria | 1571 |
| 673 | Ga0395900_0538730 | 3300037418 | Bacteria | 1113 |
| 674 | Ga0395900_1088184 | 3300037418 | Bacteria | 717 |
| 675 | Ga0395900_1185296 | 3300037418 | Bacteria | 679 |
| 676 | Ga0395900_1366112 | 3300037418 | Bacteria | 622 |
| 677 | Ga0395898_0027945 | 3300037466 | Bacteria | 5657 |
| 678 | Ga0395898_0272236 | 3300037466 | Bacteria | 1615 |
| 679 | Ga0395898_0743156 | 3300037466 | Bacteria | 922 |
| 680 | Ga0395898_1599391 | 3300037466 | Bacteria | 576 |
| 681 | Ga0395905_0017680 | 3300037471 | Bacteria | 6768 |
| 682 | Ga0395905_0091134 | 3300037471 | Bacteria | 2858 |
| 683 | Ga0395905_0130280 | 3300037471 | Bacteria | 2366 |
| 684 | Ga0395905_0447148 | 3300037471 | Bacteria | 1190 |
| 685 | Ga0395901_0013531 | 3300038443 | Bacteria | 8298 |
| 686 | Ga0395901_0015304 | 3300038443 | Bacteria | 7806 |
| 687 | Ga0395901_0186381 | 3300038443 | Bacteria | 2176 |
| 688 | Ga0395901_0296794 | 3300038443 | Bacteria | 1676 |
| 689 | Ga0395901_0505207 | 3300038443 | Bacteria | 1230 |
| 690 | Ga0395901_0710709 | 3300038443 | Unclassified | 1002 |
| 691 | Ga0395901_0952091 | 3300038443 | Bacteria | 837 |
| 692 | Ga0395901_1189976 | 3300038443 | Unclassified | 728 |
| 693 | Ga0395901_1822921 | 3300038443 | Unclassified | 557 |
| 694 | Ga0436363_0964356 | 3300039450 | Unclassified | 678 |
| 695 | Ga0439438_019152 | 3300041405 | Bacteria | 1938 |
| 696 | Ga0439439_0102789 | 3300041406 | Bacteria | 787 |
| 697 | Ga0439461_0009791 | 3300041410 | Bacteria | 1746 |
| 698 | Ga0451789_0642567 | 3300041443 | Bacteria | 632 |
| 699 | Ga0451789_0705988 | 3300041443 | Bacteria | 3256 |
| 700 | Ga0451793_1835854 | 3300041452 | Bacteria | 2751 |
| 701 | Ga0451795_1672069 | 3300041456 | Unclassified | 840 |
| 702 | Ga0451798_0302062 | 3300041458 | Unclassified | 679 |
| 703 | Ga0451800_0895528 | 3300041459 | Bacteria | 1538 |
| 704 | Ga0451802_1507214 | 3300041460 | Bacteria | 512 |
| 705 | Ga0451802_1622626 | 3300041460 | Bacteria | 1466 |
| 706 | Ga0451806_214887 | 3300041462 | Bacteria | 545 |
| 707 | Ga0451807_2304833 | 3300041486 | Unclassified | 629 |
| 708 | Ga0451835_1106107 | 3300041492 | Bacteria | 1666 |
| 709 | Ga0451837_0478409 | 3300041494 | Bacteria | 1947 |
| 710 | Ga0451841_0498631 | 3300041498 | Unclassified | 672 |
| 711 | Ga0451847_0681374 | 3300041503 | Bacteria | 1781 |
| 712 | Ga0451847_0964514 | 3300041503 | Bacteria | 648 |
| 713 | Ga0451849_0546038 | 3300041505 | Bacteria | 723 |
| 714 | Ga0451849_1384475 | 3300041505 | Bacteria | 3357 |
| 715 | Ga0451851_1373888 | 3300041507 | Unclassified | 1069 |
| 716 | Ga0451855_1021945 | 3300041511 | Bacteria | 1560 |
| 717 | Ga0451853_0898650 | 3300041512 | Bacteria | 2713 |
| 718 | Ga0451853_3186600 | 3300041512 | Bacteria | 1511 |
| 719 | Ga0451853_3220247 | 3300041512 | Bacteria | 1501 |
| 720 | Ga0439431_0020889 | 3300041997 | Bacteria | 1568 |
| 721 | Ga0439433_0012263 | 3300041999 | Bacteria | 1879 |
| 722 | Ga0439442_020575 | 3300042002 | Bacteria | 1367 |
| 723 | Ga0439442_126195 | 3300042002 | Bacteria | 562 |
| 724 | Ga0439445_0091320 | 3300042004 | Bacteria | 858 |
| 725 | Ga0439445_0273859 | 3300042004 | Bacteria | 506 |
| 726 | Ga0439448_0020329 | 3300042005 | Bacteria | 2053 |
| 727 | Ga0439448_0071909 | 3300042005 | Bacteria | 1153 |
| 728 | Ga0439448_0292575 | 3300042005 | Bacteria | 578 |
| 729 | Ga0439449_0085359 | 3300042007 | Bacteria | 1165 |
| 730 | Ga0439454_021992 | 3300042011 | Bacteria | 947 |
| 731 | Ga0439455_0082899 | 3300042012 | Bacteria | 873 |
| 732 | Ga0439462_0001379 | 3300042015 | Bacteria | 5372 |
| 733 | Ga0439463_109442 | 3300042016 | Bacteria | 713 |
| 734 | Ga0450917_017775 | 3300042120 | Bacteria | 616 |
| 735 | Ga0450920_017030 | 3300042122 | Bacteria | 1388 |
| 736 | Ga0439446_0000134 | 3300042156 | Bacteria | 12718 |
| 737 | Ga0439446_0041217 | 3300042156 | Bacteria | 1361 |
| 738 | Ga0450909_063762 | 3300042185 | Bacteria | 584 |
| 739 | Ga0439434_0001405 | 3300042435 | Bacteria | 6943 |
| 740 | Ga0439459_0223251 | 3300042438 | Bacteria | 523 |
| 741 | Ga0439460_0046694 | 3300042461 | Unclassified | 1288 |
| 742 | Ga0451577_0566956 | 3300042876 | Bacteria | 1031 |
| 743 | Ga0466972_0251107 | 3300044658 | Unclassified | 827 |
| 744 | Ga0466965_0059606 | 3300044683 | Bacteria | 1906 |
| 745 | Ga0466961_0931581 | 3300044693 | Bacteria | 517 |
| 746 | Ga0466964_0000687 | 3300044706 | Bacteria | 10931 |
| 747 | Ga0453684_1388152 | 3300044712 | Bacteria | 729 |
| 748 | Ga0466968_0246921 | 3300044735 | Bacteria | 847 |
| 749 | Ga0466960_0042952 | 3300044901 | Bacteria | 2148 |
| 750 | Ga0466960_0085149 | 3300044901 | Bacteria | 1601 |
| 751 | Ga0466959_0669586 | 3300045049 | Bacteria | 696 |
| 752 | Ga0451576_0143988 | 3300045051 | Bacteria | 2485 |
| 753 | Ga0451576_0398041 | 3300045051 | Bacteria | 1444 |
| 754 | Ga0466967_0002463 | 3300045976 | Bacteria | 11533 |
| 755 | Ga0495627_120760 | 3300046453 | Bacteria | 740 |
| 756 | Ga0495592_0094192 | 3300046454 | Bacteria | 2144 |
| 757 | Ga0495603_0025590 | 3300046455 | Bacteria | 3569 |
| 758 | Ga0495603_0046806 | 3300046455 | Bacteria | 2577 |
| 759 | Ga0495603_0150121 | 3300046455 | Bacteria | 1354 |
| 760 | Ga0495603_0184128 | 3300046455 | Bacteria | 1208 |
| 761 | Ga0495603_0609722 | 3300046455 | Unclassified | 625 |
| 762 | Ga0495603_0889165 | 3300046455 | Bacteria | 506 |
| 763 | Ga0495629_0004952 | 3300046459 | Bacteria | 9989 |
| 764 | Ga0495629_0434593 | 3300046459 | Bacteria | 890 |
| 765 | Ga0495641_0037152 | 3300046461 | Bacteria | 2285 |
| 766 | Ga0495641_0217535 | 3300046461 | Bacteria | 857 |
| 767 | Ga0495651_0361833 | 3300046462 | Bacteria | 956 |
| 768 | Ga0495582_0007730 | 3300046473 | Bacteria | 5944 |
| 769 | Ga0495582_0146238 | 3300046473 | Bacteria | 1341 |
| 770 | Ga0495582_0372461 | 3300046473 | Bacteria | 823 |
| 771 | Ga0495605_0048655 | 3300046474 | Bacteria | 2075 |
| 772 | Ga0495605_0176868 | 3300046474 | Bacteria | 940 |
| 773 | Ga0495639_0555036 | 3300046475 | Unclassified | 589 |
| 774 | Ga0495664_0289607 | 3300046477 | Bacteria | 989 |
| 775 | Ga0495584_0013077 | 3300046491 | Bacteria | 4233 |
| 776 | Ga0495584_0058376 | 3300046491 | Bacteria | 1941 |
| 777 | Ga0495585_0115353 | 3300046492 | Bacteria | 1425 |
| 778 | Ga0495585_0133648 | 3300046492 | Bacteria | 1304 |
| 779 | Ga0495585_0146195 | 3300046492 | Bacteria | 1235 |
| 780 | Ga0495594_0215415 | 3300046499 | Bacteria | 1095 |
| 781 | Ga0495594_0224413 | 3300046499 | Bacteria | 1071 |
| 782 | Ga0495594_0846387 | 3300046499 | Unclassified | 515 |
| 783 | Ga0495596_0058627 | 3300046500 | Bacteria | 1501 |
| 784 | Ga0495596_0069157 | 3300046500 | Unclassified | 1372 |
| 785 | Ga0495596_0337005 | 3300046500 | Bacteria | 587 |
| 786 | Ga0495607_0272606 | 3300046501 | Bacteria | 806 |
| 787 | Ga0495608_0269329 | 3300046511 | Bacteria | 1059 |
| 788 | Ga0495620_0175061 | 3300046515 | Unclassified | 831 |
| 789 | Ga0495628_0225283 | 3300046516 | Bacteria | 1407 |
| 790 | Ga0495630_0003626 | 3300046517 | Bacteria | 10761 |
| 791 | Ga0495630_0116291 | 3300046517 | Bacteria | 2027 |
| 792 | Ga0495630_0857783 | 3300046517 | Bacteria | 692 |
| 793 | Ga0495631_0261248 | 3300046518 | Bacteria | 738 |
| 794 | Ga0495644_0003843 | 3300046523 | Bacteria | 5912 |
| 795 | Ga0495644_0304787 | 3300046523 | Unclassified | 623 |
| 796 | Ga0495644_0409050 | 3300046523 | Bacteria | 538 |
| 797 | Ga0495663_0134614 | 3300046525 | Bacteria | 836 |
| 798 | Ga0495663_0149674 | 3300046525 | Bacteria | 796 |
| 799 | Ga0495666_0093922 | 3300046526 | Bacteria | 1415 |
| 800 | Ga0495642_0031845 | 3300046528 | Unclassified | 2115 |
| 801 | Ga0495642_0159635 | 3300046528 | Bacteria | 977 |
| 802 | Ga0495642_0162161 | 3300046528 | Bacteria | 970 |
| 803 | Ga0495652_0211691 | 3300046529 | Bacteria | 1463 |
| 804 | Ga0495654_0354238 | 3300046530 | Archaea | 590 |
| 805 | Ga0495586_0108998 | 3300046535 | Bacteria | 1540 |
| 806 | Ga0495587_0215066 | 3300046536 | Bacteria | 1085 |
| 807 | Ga0495598_0297659 | 3300046537 | Bacteria | 609 |
| 808 | Ga0495621_0106189 | 3300046539 | Bacteria | 1073 |
| 809 | Ga0495633_0161779 | 3300046558 | Bacteria | 1033 |
| 810 | Ga0495656_0028510 | 3300046615 | Bacteria | 2240 |
| 811 | Ga0495656_0138524 | 3300046615 | Bacteria | 1165 |
| 812 | Ga0495656_0479338 | 3300046615 | Bacteria | 658 |
| 813 | Ga0495656_0536243 | 3300046615 | Bacteria | 623 |
| 814 | Ga0495668_0616900 | 3300046616 | Unclassified | 599 |
| 815 | Ga0495634_0026588 | 3300046642 | Bacteria | 4037 |
| 816 | Ga0495611_0064335 | 3300046648 | Bacteria | 1670 |
| 817 | Ga0495611_0512869 | 3300046648 | Bacteria | 544 |
| 818 | Ga0495661_0047956 | 3300046665 | Bacteria | 2598 |
| 819 | Ga0495588_0388380 | 3300046674 | Bacteria | 733 |
| 820 | Ga0495657_0169828 | 3300046675 | Bacteria | 1344 |
| 821 | Ga0495658_0053902 | 3300046683 | Bacteria | 2286 |
| 822 | Ga0495658_0292846 | 3300046683 | Unclassified | 1029 |
| 823 | Ga0495658_0428246 | 3300046683 | Bacteria | 844 |
| 824 | Ga0495613_0055639 | 3300046689 | Bacteria | 2906 |
| 825 | Ga0495613_0207777 | 3300046689 | Bacteria | 1378 |
| 826 | Ga0495624_0390257 | 3300046690 | Unclassified | 836 |
| 827 | Ga0495624_0768111 | 3300046690 | Unclassified | 570 |
| 828 | Ga0495670_0301540 | 3300046691 | Bacteria | 859 |
| 829 | Ga0495589_0043218 | 3300046794 | Bacteria | 2244 |
| 830 | Ga0495589_0167809 | 3300046794 | Bacteria | 1044 |
| 831 | Ga0495589_0199509 | 3300046794 | Unclassified | 945 |
| 832 | Ga0495589_0218610 | 3300046794 | Bacteria | 896 |
| 833 | Ga0495589_0275050 | 3300046794 | Bacteria | 784 |
| 834 | Ga0495589_0552659 | 3300046794 | Bacteria | 525 |
| 835 | Ga0495581_0054475 | 3300047315 | Bacteria | 2309 |
| 836 | Ga0495581_0204912 | 3300047315 | Bacteria | 1154 |
| 837 | Ga0495636_0118995 | 3300047318 | Bacteria | 1167 |
| 838 | Ga0495636_0556835 | 3300047318 | Unclassified | 558 |
| 839 | Ga0495676_0045078 | 3300047321 | Bacteria | 3593 |
| 840 | Ga0495676_0219605 | 3300047321 | Bacteria | 1311 |
| 841 | Ga0495676_0234782 | 3300047321 | Bacteria | 1258 |
| 842 | Ga0495676_0271738 | 3300047321 | Bacteria | 1150 |
| 843 | Ga0495676_0360656 | 3300047321 | Bacteria | 970 |
| 844 | Ga0495676_0561934 | 3300047321 | Bacteria | 745 |
| 845 | Ga0495677_0192726 | 3300047445 | Bacteria | 791 |
| 846 | Ga0495677_0220200 | 3300047445 | Unclassified | 739 |
| 847 | Ga0495685_064728 | 3300047447 | Bacteria | 1229 |
| 848 | Ga0495593_0223010 | 3300047673 | Bacteria | 946 |
| 849 | Ga0495614_0404076 | 3300048089 | Unclassified | 642 |
| 850 | Ga0495615_0149251 | 3300048090 | Bacteria | 695 |
| 851 | Ga0496100_0025949 | 3300048903 | Bacteria | 3587 |
| 852 | Ga0496100_0071282 | 3300048903 | Bacteria | 2320 |
| 853 | Ga0496100_0074115 | 3300048903 | Bacteria | 2280 |
| 854 | Ga0496100_0099783 | 3300048903 | Bacteria | 1998 |
| 855 | Ga0496100_0273295 | 3300048903 | Bacteria | 1257 |
| 856 | Ga0496100_0492563 | 3300048903 | Bacteria | 944 |
| 857 | Ga0496100_0882239 | 3300048903 | Unclassified | 702 |
| 858 | Ga0496101_0049882 | 3300048904 | Bacteria | 3012 |
| 859 | Ga0496101_0069442 | 3300048904 | Bacteria | 2578 |
| 860 | Ga0496101_0114938 | 3300048904 | Bacteria | 2029 |
| 861 | Ga0496101_0117177 | 3300048904 | Bacteria | 2011 |
| 862 | Ga0496101_0123380 | 3300048904 | Bacteria | 1960 |
| 863 | Ga0496101_0159002 | 3300048904 | Bacteria | 1732 |
| 864 | Ga0496101_0537469 | 3300048904 | Bacteria | 924 |
| 865 | Ga0496101_0546331 | 3300048904 | Bacteria | 916 |
| 866 | Ga0496101_1380550 | 3300048904 | Unclassified | 550 |
| 867 | Ga0496102_0201032 | 3300048905 | Bacteria | 1878 |
| 868 | Ga0496102_0218369 | 3300048905 | Bacteria | 1797 |
| 869 | Ga0496102_1084586 | 3300048905 | Bacteria | 721 |
| 870 | Ga0496102_1100691 | 3300048905 | Unclassified | 714 |
| 871 | Ga0496102_1398780 | 3300048905 | Bacteria | 619 |
| 872 | Ga0496103_0029164 | 3300048906 | Bacteria | 3352 |
| 873 | Ga0496103_0502982 | 3300048906 | Bacteria | 775 |
| 874 | Ga0496103_0716525 | 3300048906 | Bacteria | 634 |
| 875 | Ga0496104_0055919 | 3300048907 | Bacteria | 3731 |
| 876 | Ga0496104_0056825 | 3300048907 | Bacteria | 3702 |
| 877 | Ga0496104_0080874 | 3300048907 | Bacteria | 3098 |
| 878 | Ga0496104_0088138 | 3300048907 | Bacteria | 2964 |
| 879 | Ga0496104_0112843 | 3300048907 | Bacteria | 2607 |
| 880 | Ga0496104_0142234 | 3300048907 | Bacteria | 2305 |
| 881 | Ga0496104_0524276 | 3300048907 | Bacteria | 1096 |
| 882 | Ga0496104_0656533 | 3300048907 | Unclassified | 958 |
| 883 | Ga0496105_0029673 | 3300048908 | Bacteria | 4477 |
| 884 | Ga0496105_0053886 | 3300048908 | Bacteria | 3322 |
| 885 | Ga0496105_0077219 | 3300048908 | Bacteria | 2750 |
| 886 | Ga0496105_0113427 | 3300048908 | Bacteria | 2237 |
| 887 | Ga0496105_0133102 | 3300048908 | Bacteria | 2049 |
| 888 | Ga0496105_0719195 | 3300048908 | Bacteria | 765 |
| 889 | Ga0496105_0950618 | 3300048908 | Unclassified | 645 |
| 890 | Ga0496106_0066358 | 3300048909 | Bacteria | 2748 |
| 891 | Ga0496106_0123448 | 3300048909 | Bacteria | 2026 |
| 892 | Ga0496106_0152282 | 3300048909 | Bacteria | 1825 |
| 893 | Ga0496106_0452398 | 3300048909 | Bacteria | 1031 |
| 894 | Ga0496107_0014736 | 3300048910 | Bacteria | 5474 |
| 895 | Ga0496107_0033365 | 3300048910 | Bacteria | 3683 |
| 896 | Ga0496107_0230606 | 3300048910 | Bacteria | 1378 |
| 897 | Ga0496107_0320596 | 3300048910 | Bacteria | 1153 |
| 898 | Ga0496107_0366672 | 3300048910 | Bacteria | 1071 |
| 899 | Ga0496107_0692775 | 3300048910 | Unclassified | 750 |
| 900 | Ga0496108_0003242 | 3300048911 | Bacteria | 13082 |
| 901 | Ga0496108_0009627 | 3300048911 | Bacteria | 7834 |
| 902 | Ga0496108_0012326 | 3300048911 | Bacteria | 6955 |
| 903 | Ga0496108_0045169 | 3300048911 | Bacteria | 3679 |
| 904 | Ga0496108_0070735 | 3300048911 | Bacteria | 2944 |
| 905 | Ga0496108_0170194 | 3300048911 | Bacteria | 1885 |
| 906 | Ga0496108_0505438 | 3300048911 | Bacteria | 1055 |
| 907 | Ga0496108_0598600 | 3300048911 | Bacteria | 961 |
| 908 | Ga0496108_0688755 | 3300048911 | Bacteria | 887 |
| 909 | Ga0496109_0002074 | 3300048912 | Bacteria | 16648 |
| 910 | Ga0496109_0003469 | 3300048912 | Bacteria | 13163 |
| 911 | Ga0496109_0030617 | 3300048912 | Bacteria | 4823 |
| 912 | Ga0496109_0083045 | 3300048912 | Bacteria | 2954 |
| 913 | Ga0496109_0185294 | 3300048912 | Bacteria | 1956 |
| 914 | Ga0496109_0187953 | 3300048912 | Bacteria | 1941 |
| 915 | Ga0496109_0203567 | 3300048912 | Bacteria | 1861 |
| 916 | Ga0496109_0463027 | 3300048912 | Unclassified | 1197 |
| 917 | Ga0496109_1245012 | 3300048912 | Unclassified | 680 |
| 918 | Ga0496109_1273136 | 3300048912 | Bacteria | 671 |
| 919 | Ga0496109_1320648 | 3300048912 | Bacteria | 657 |
| 920 | Ga0496109_1490362 | 3300048912 | Bacteria | 611 |
| 921 | Ga0496109_1595417 | 3300048912 | Bacteria | 587 |
| 922 | Ga0496110_0004092 | 3300048913 | Bacteria | 11258 |
| 923 | Ga0496110_0024616 | 3300048913 | Bacteria | 5133 |
| 924 | Ga0496110_0071796 | 3300048913 | Bacteria | 3070 |
| 925 | Ga0496110_0308903 | 3300048913 | Bacteria | 1440 |
| 926 | Ga0496110_0535971 | 3300048913 | Bacteria | 1064 |
| 927 | Ga0496110_0567454 | 3300048913 | Bacteria | 1031 |
| 928 | Ga0496110_0902190 | 3300048913 | Bacteria | 790 |
| 929 | Ga0496111_0001796 | 3300048914 | Bacteria | 12589 |
| 930 | Ga0496111_0010431 | 3300048914 | Bacteria | 6234 |
| 931 | Ga0496111_0037840 | 3300048914 | Bacteria | 3454 |
| 932 | Ga0496111_0041933 | 3300048914 | Bacteria | 3285 |
| 933 | Ga0496111_0057593 | 3300048914 | Bacteria | 2813 |
| 934 | Ga0496111_0065084 | 3300048914 | Unclassified | 2646 |
| 935 | Ga0496111_0084613 | 3300048914 | Bacteria | 2318 |
| 936 | Ga0496111_0559248 | 3300048914 | Bacteria | 839 |
| 937 | Ga0496112_0032546 | 3300048915 | Bacteria | 5064 |
| 938 | Ga0496112_0175055 | 3300048915 | Bacteria | 2111 |
| 939 | Ga0496112_0255248 | 3300048915 | Bacteria | 1704 |
| 940 | Ga0496112_0429510 | 3300048915 | Bacteria | 1259 |
| 941 | Ga0496112_1549024 | 3300048915 | Unclassified | 576 |
| 942 | Ga0496113_0007449 | 3300048916 | Bacteria | 7045 |
| 943 | Ga0496113_0071030 | 3300048916 | Bacteria | 2648 |
| 944 | Ga0496113_0284184 | 3300048916 | Unclassified | 1323 |
| 945 | Ga0496114_0013425 | 3300048917 | Bacteria | 6567 |
| 946 | Ga0496114_0016448 | 3300048917 | Bacteria | 5962 |
| 947 | Ga0496114_0157776 | 3300048917 | Bacteria | 1971 |
| 948 | Ga0496114_0185582 | 3300048917 | Bacteria | 1817 |
| 949 | Ga0496114_0272537 | 3300048917 | Bacteria | 1491 |
| 950 | Ga0496114_0320453 | 3300048917 | Unclassified | 1370 |
| 951 | Ga0496114_0609961 | 3300048917 | Bacteria | 962 |
| 952 | Ga0496115_0045173 | 3300048918 | Bacteria | 3516 |
| 953 | Ga0496115_0082106 | 3300048918 | Bacteria | 2625 |
| 954 | Ga0501031_0014359 | 3300049568 | Bacteria | 5149 |
| 955 | Ga0501031_0020193 | 3300049568 | Bacteria | 4342 |
| 956 | Ga0501031_0031268 | 3300049568 | Bacteria | 3472 |
| 957 | Ga0501031_0366826 | 3300049568 | Bacteria | 932 |
| 958 | Ga0501031_0462683 | 3300049568 | Bacteria | 819 |
| 959 | Ga0501032_0014903 | 3300049569 | Bacteria | 5502 |
| 960 | Ga0501032_0037929 | 3300049569 | Bacteria | 3284 |
| 961 | Ga0501032_0130410 | 3300049569 | Bacteria | 1659 |
| 962 | Ga0501032_0224216 | 3300049569 | Bacteria | 1223 |
| 963 | Ga0501033_0032289 | 3300049570 | Bacteria | 3932 |
| 964 | Ga0501033_0032405 | 3300049570 | Bacteria | 3925 |
| 965 | Ga0501034_0382252 | 3300049571 | Bacteria | 1333 |
| 966 | Ga0501034_0452376 | 3300049571 | Bacteria | 1202 |
| 967 | Ga0501036_0024247 | 3300049572 | Bacteria | 5113 |
| 968 | Ga0501036_0079455 | 3300049572 | Bacteria | 2774 |
| 969 | Ga0501036_0093417 | 3300049572 | Bacteria | 2542 |
| 970 | Ga0501036_0135909 | 3300049572 | Bacteria | 2075 |
| 971 | Ga0501037_0054259 | 3300049573 | Bacteria | 2931 |
| 972 | Ga0501037_0055569 | 3300049573 | Bacteria | 2894 |
| 973 | Ga0501037_0731316 | 3300049573 | Bacteria | 657 |
| 974 | Ga0501038_0003877 | 3300049574 | Bacteria | 13903 |
| 975 | Ga0501038_0083953 | 3300049574 | Bacteria | 2680 |
| 976 | Ga0501038_0187419 | 3300049574 | Bacteria | 1666 |
| 977 | Ga0501038_1001588 | 3300049574 | Unclassified | 613 |
| 978 | Ga0501039_0018570 | 3300049575 | Bacteria | 5338 |
| 979 | Ga0501039_0031033 | 3300049575 | Bacteria | 4119 |
| 980 | Ga0501039_0109839 | 3300049575 | Bacteria | 2156 |
| 981 | Ga0501039_0145097 | 3300049575 | Bacteria | 1865 |
| 982 | Ga0501039_0166625 | 3300049575 | Bacteria | 1732 |
| 983 | Ga0501039_0294584 | 3300049575 | Bacteria | 1275 |
| 984 | Ga0501040_0004530 | 3300049576 | Bacteria | 9017 |
| 985 | Ga0501040_0005859 | 3300049576 | Bacteria | 7955 |
| 986 | Ga0501040_0010738 | 3300049576 | Bacteria | 5989 |
| 987 | Ga0501040_0186667 | 3300049576 | Bacteria | 1470 |
| 988 | Ga0501041_0011667 | 3300049577 | Bacteria | 5199 |
| 989 | Ga0501041_0013767 | 3300049577 | Bacteria | 4796 |
| 990 | Ga0501041_0017186 | 3300049577 | Bacteria | 4304 |
| 991 | Ga0501041_0020589 | 3300049577 | Bacteria | 3945 |
| 992 | Ga0501041_0039623 | 3300049577 | Bacteria | 2860 |
| 993 | Ga0501041_0224941 | 3300049577 | Bacteria | 1178 |
| 994 | Ga0501041_0324022 | 3300049577 | Bacteria | 972 |
| 995 | Ga0501042_0001284 | 3300049578 | Bacteria | 14616 |
| 996 | Ga0501042_0006125 | 3300049578 | Bacteria | 7793 |
| 997 | Ga0501042_0019924 | 3300049578 | Bacteria | 4664 |
| 998 | Ga0501042_0036108 | 3300049578 | Bacteria | 3506 |
| 999 | Ga0501042_0404211 | 3300049578 | Bacteria | 989 |
| 1000 | Ga0501042_0990942 | 3300049578 | Bacteria | 612 |
| 1001 | Ga0501043_0046745 | 3300049579 | Bacteria | 3404 |
| 1002 | Ga0501043_0536931 | 3300049579 | Bacteria | 870 |
| 1003 | Ga0501043_0766072 | 3300049579 | Bacteria | 700 |
| 1004 | Ga0501046_0011716 | 3300049580 | Bacteria | 7490 |
| 1005 | Ga0501046_0072244 | 3300049580 | Bacteria | 2679 |
| 1006 | Ga0501046_0197401 | 3300049580 | Bacteria | 1498 |
| 1007 | Ga0501046_0488815 | 3300049580 | Bacteria | 882 |
| 1008 | Ga0501048_0008728 | 3300049582 | Bacteria | 7641 |
| 1009 | Ga0501048_0012732 | 3300049582 | Bacteria | 6255 |
| 1010 | Ga0501048_0019366 | 3300049582 | Bacteria | 4993 |
| 1011 | Ga0501048_0089983 | 3300049582 | Bacteria | 2165 |
| 1012 | Ga0501048_0281092 | 3300049582 | Bacteria | 1183 |
| 1013 | Ga0501048_0696277 | 3300049582 | Unclassified | 730 |
| 1014 | Ga0501048_0884932 | 3300049582 | Bacteria | 642 |
| 1015 | Ga0501067_0373297 | 3300049583 | Bacteria | 795 |
| 1016 | Ga0501068_0010561 | 3300049584 | Bacteria | 5191 |
| 1017 | Ga0501068_0031211 | 3300049584 | Bacteria | 3164 |
| 1018 | Ga0501068_0047173 | 3300049584 | Bacteria | 2599 |
| 1019 | Ga0501068_0121208 | 3300049584 | Bacteria | 1630 |
| 1020 | Ga0501068_0989559 | 3300049584 | Bacteria | 555 |
| 1021 | Ga0501069_0136543 | 3300049585 | Bacteria | 1405 |
| 1022 | Ga0501069_0149501 | 3300049585 | Bacteria | 1342 |
| 1023 | Ga0501069_0178230 | 3300049585 | Bacteria | 1228 |
| 1024 | Ga0501069_0196326 | 3300049585 | Bacteria | 1169 |
| 1025 | Ga0501070_0067481 | 3300049586 | Bacteria | 2962 |
| 1026 | Ga0501070_0384898 | 3300049586 | Bacteria | 1136 |
| 1027 | Ga0501071_0005871 | 3300049587 | Bacteria | 7935 |
| 1028 | Ga0501071_0011907 | 3300049587 | Bacteria | 5876 |
| 1029 | Ga0501071_0012278 | 3300049587 | Bacteria | 5804 |
| 1030 | Ga0501071_0034955 | 3300049587 | Bacteria | 3578 |
| 1031 | Ga0501071_0071118 | 3300049587 | Bacteria | 2535 |
| 1032 | Ga0501071_0201649 | 3300049587 | Bacteria | 1494 |
| 1033 | Ga0501071_0699172 | 3300049587 | Unclassified | 781 |
| 1034 | Ga0501072_0001680 | 3300049588 | Bacteria | 16477 |
| 1035 | Ga0501072_0044866 | 3300049588 | Bacteria | 3475 |
| 1036 | Ga0501072_0064369 | 3300049588 | Bacteria | 2891 |
| 1037 | Ga0501072_0116870 | 3300049588 | Bacteria | 2124 |
| 1038 | Ga0501072_0213518 | 3300049588 | Bacteria | 1538 |
| 1039 | Ga0501072_0213846 | 3300049588 | Bacteria | 1536 |
| 1040 | Ga0501072_0286216 | 3300049588 | Bacteria | 1310 |
| 1041 | Ga0501072_0346635 | 3300049588 | Bacteria | 1179 |
| 1042 | Ga0501073_0031616 | 3300049589 | Bacteria | 3776 |
| 1043 | Ga0501073_0049246 | 3300049589 | Bacteria | 2955 |
| 1044 | Ga0501073_0137575 | 3300049589 | Bacteria | 1693 |
| 1045 | Ga0501073_0341909 | 3300049589 | Bacteria | 1033 |
| 1046 | Ga0501073_0629360 | 3300049589 | Bacteria | 741 |
| 1047 | Ga0501074_0008808 | 3300049590 | Bacteria | 7314 |
| 1048 | Ga0501074_0014764 | 3300049590 | Bacteria | 5681 |
| 1049 | Ga0501074_0020248 | 3300049590 | Bacteria | 4834 |
| 1050 | Ga0501074_0058319 | 3300049590 | Bacteria | 2781 |
| 1051 | Ga0501074_0072007 | 3300049590 | Bacteria | 2484 |
| 1052 | Ga0501074_0116833 | 3300049590 | Bacteria | 1908 |
| 1053 | Ga0501074_0304812 | 3300049590 | Bacteria | 1131 |
| 1054 | Ga0501074_0598783 | 3300049590 | Bacteria | 779 |
| 1055 | Ga0501075_0002089 | 3300049591 | Bacteria | 13202 |
| 1056 | Ga0501075_0014557 | 3300049591 | Bacteria | 5638 |
| 1057 | Ga0501075_0017741 | 3300049591 | Bacteria | 5140 |
| 1058 | Ga0501075_0037673 | 3300049591 | Bacteria | 3613 |
| 1059 | Ga0501075_0055048 | 3300049591 | Bacteria | 2993 |
| 1060 | Ga0501075_0222869 | 3300049591 | Bacteria | 1438 |
| 1061 | Ga0501075_0226320 | 3300049591 | Bacteria | 1426 |
| 1062 | Ga0501076_0028703 | 3300049592 | Bacteria | 4322 |
| 1063 | Ga0501076_0044969 | 3300049592 | Bacteria | 3484 |
| 1064 | Ga0501076_0048690 | 3300049592 | Bacteria | 3349 |
| 1065 | Ga0501076_0321945 | 3300049592 | Bacteria | 1268 |
| 1066 | Ga0501076_0458005 | 3300049592 | Bacteria | 1050 |
| 1067 | Ga0501076_0550594 | 3300049592 | Bacteria | 951 |
| 1068 | Ga0501076_0666698 | 3300049592 | Unclassified | 858 |
| 1069 | Ga0501076_0748407 | 3300049592 | Bacteria | 806 |
| 1070 | Ga0501077_0009698 | 3300049593 | Bacteria | 5985 |
| 1071 | Ga0501077_0010445 | 3300049593 | Bacteria | 5778 |
| 1072 | Ga0501077_0092772 | 3300049593 | Bacteria | 1913 |
| 1073 | Ga0501077_0099298 | 3300049593 | Bacteria | 1845 |
| 1074 | Ga0501077_0109115 | 3300049593 | Bacteria | 1753 |
| 1075 | Ga0501077_0135899 | 3300049593 | Bacteria | 1559 |
| 1076 | Ga0501077_0475644 | 3300049593 | Bacteria | 800 |
| 1077 | Ga0501079_0005575 | 3300049741 | Bacteria | 9393 |
| 1078 | Ga0501079_0019555 | 3300049741 | Bacteria | 5172 |
| 1079 | Ga0501079_0030431 | 3300049741 | Bacteria | 4147 |
| 1080 | Ga0501079_0051205 | 3300049741 | Bacteria | 3188 |
| 1081 | Ga0501079_0272766 | 3300049741 | Bacteria | 1322 |
| 1082 | Ga0501079_0363713 | 3300049741 | Bacteria | 1134 |
| 1083 | Ga0501079_0410344 | 3300049741 | Bacteria | 1062 |
| 1084 | Ga0501079_0444923 | 3300049741 | Bacteria | 1017 |
| 1085 | Ga0501080_0018197 | 3300049742 | Bacteria | 6503 |
| 1086 | Ga0501080_0036126 | 3300049742 | Bacteria | 4612 |
| 1087 | Ga0501080_0238948 | 3300049742 | Bacteria | 1658 |
| 1088 | Ga0501080_0256724 | 3300049742 | Bacteria | 1593 |
| 1089 | Ga0501081_0004310 | 3300049743 | Bacteria | 9119 |
| 1090 | Ga0501081_0011332 | 3300049743 | Bacteria | 5834 |
| 1091 | Ga0501081_0012644 | 3300049743 | Bacteria | 5549 |
| 1092 | Ga0501081_0115418 | 3300049743 | Bacteria | 1908 |
| 1093 | Ga0501081_0124534 | 3300049743 | Bacteria | 1838 |
| 1094 | Ga0501081_0140668 | 3300049743 | Bacteria | 1729 |
| 1095 | Ga0501081_1264670 | 3300049743 | Unclassified | 559 |
| 1096 | Ga0501083_0060316 | 3300049744 | Bacteria | 2534 |
| 1097 | Ga0501083_0155966 | 3300049744 | Bacteria | 1494 |
| 1098 | Ga0501035_0016684 | 3300049822 | Bacteria | 6770 |
| 1099 | Ga0501035_0028556 | 3300049822 | Bacteria | 5092 |
| 1100 | Ga0501035_0394374 | 3300049822 | Bacteria | 1152 |
| 1101 | Ga0501035_0512786 | 3300049822 | Bacteria | 986 |
| 1102 | Ga0501044_0109521 | 3300049823 | Bacteria | 2771 |
| 1103 | Ga0501045_0012060 | 3300049824 | Bacteria | 6079 |
| 1104 | Ga0501045_0020928 | 3300049824 | Bacteria | 4676 |
| 1105 | Ga0501045_0025587 | 3300049824 | Bacteria | 4244 |
| 1106 | Ga0501045_0027954 | 3300049824 | Bacteria | 4067 |
| 1107 | Ga0501045_0040793 | 3300049824 | Bacteria | 3376 |
| 1108 | Ga0501045_0096801 | 3300049824 | Bacteria | 2183 |
| 1109 | Ga0501045_0266683 | 3300049824 | Bacteria | 1275 |
| 1110 | Ga0501045_0446514 | 3300049824 | Bacteria | 961 |
| 1111 | nmdc:mga00v17_622294_c1 | 3300050491 | Bacteria | 695 |
| 1112 | nmdc:mga00v17_69881_c1 | 3300050491 | Bacteria | 2174 |
| 1113 | nmdc:mga0yw44_48089_c1 | 3300050492 | Bacteria | 2571 |
| 1114 | nmdc:mga0yw44_737117_c1 | 3300050492 | Bacteria | 669 |
| 1115 | nmdc:mga0k408_233719_c1 | 3300050493 | Bacteria | 1097 |
| 1116 | nmdc:mga06z11_367628_c1 | 3300050494 | Bacteria | 863 |
| 1117 | nmdc:mga07m45_365020_c1 | 3300050496 | Bacteria | 839 |
| 1118 | nmdc:mga05p37_1135628_c1 | 3300050507 | Bacteria | 814 |
| 1119 | nmdc:mga05p37_15232_c1 | 3300050507 | Bacteria | 3161 |
| 1120 | nmdc:mga05p37_278379_c1 | 3300050507 | Bacteria | 1996 |
| 1121 | nmdc:mga06r32_591117_c1 | 3300050510 | Bacteria | 1081 |
| 1122 | nmdc:mga08y16_1197823_c1 | 3300050511 | Bacteria | 730 |
| 1123 | nmdc:mga08y16_1294113_c1 | 3300050511 | Bacteria | 696 |
| 1124 | nmdc:mga08y16_21827_c1 | 3300050511 | Bacteria | 6756 |
| 1125 | nmdc:mga08y16_226456_c1 | 3300050511 | Bacteria | 1935 |
| 1126 | nmdc:mga08y16_238598_c1 | 3300050511 | Bacteria | 1880 |
| 1127 | nmdc:mga0n895_1348624_c1 | 3300050512 | Bacteria | 683 |
| 1128 | nmdc:mga0n895_172472_c1 | 3300050512 | Bacteria | 2195 |
| 1129 | nmdc:mga0n895_287362_c1 | 3300050512 | Bacteria | 1667 |
| 1130 | nmdc:mga0n895_556856_c1 | 3300050512 | Bacteria | 1152 |
| 1131 | nmdc:mga0a205_13272_c1 | 3300050515 | Bacteria | 7662 |
| 1132 | nmdc:mga0a205_237110_c1 | 3300050515 | Bacteria | 1706 |
| 1133 | nmdc:mga0a205_512820_c1 | 3300050515 | Bacteria | 1056 |
| 1134 | nmdc:mga0a205_856565_c1 | 3300050515 | Bacteria | 756 |
| 1135 | Ga0495612_0062066 | 3300053078 | Bacteria | 1549 |
| 1136 | Ga0495655_0263330 | 3300053083 | Unclassified | 583 |
| 1137 | Ga0495619_0133463 | 3300053085 | Bacteria | 1707 |
| 1138 | Ga0501084_0006164 | 3300054114 | Bacteria | 9863 |
| 1139 | Ga0501084_0013047 | 3300054114 | Bacteria | 6876 |
| 1140 | Ga0501084_0023920 | 3300054114 | Bacteria | 5096 |
| 1141 | Ga0501084_0028142 | 3300054114 | Bacteria | 4697 |
| 1142 | Ga0501084_0058863 | 3300054114 | Bacteria | 3215 |
| 1143 | Ga0501084_0232143 | 3300054114 | Bacteria | 1557 |
| 1144 | Ga0501084_0239235 | 3300054114 | Bacteria | 1532 |
| 1145 | Ga0501084_0411345 | 3300054114 | Bacteria | 1143 |
| 1146 | Ga0590071_075624 | 3300059421 | Bacteria | 833 |
| 1147 | Ga0590074_073527 | 3300059423 | Bacteria | 646 |
| 1148 | Ga0590075_038867 | 3300059424 | Bacteria | 1214 |
| 1149 | Ga0501082_0009620 | 3300060353 | Bacteria | 8320 |
| 1150 | Ga0501082_0019151 | 3300060353 | Bacteria | 5896 |
| 1151 | Ga0501082_0033797 | 3300060353 | Bacteria | 4411 |
| 1152 | Ga0501082_0089115 | 3300060353 | Bacteria | 2663 |
| 1153 | Ga0501082_0119301 | 3300060353 | Bacteria | 2286 |
| 1154 | Ga0501082_0122306 | 3300060353 | Bacteria | 2256 |
| 1155 | Ga0530510_0013639 | 3300061734 | Bacteria | 5718 |
| 1156 | Ga0530510_0112433 | 3300061734 | Bacteria | 1995 |
| 1157 | Ga0530510_0150467 | 3300061734 | Bacteria | 1718 |
| 1158 | Ga0530510_0173364 | 3300061734 | Bacteria | 1598 |
| 1159 | Ga0530510_0199807 | 3300061734 | Bacteria | 1484 |
| 1160 | Ga0530510_0679132 | 3300061734 | Unclassified | 784 |
| 1161 | Ga0070694_100503762 | |||
| 1162 | 2214561612 | |||
| 1163 | JGI24747J21853_1034346 | |||
| 1164 | JGI24740J21852_10131317 | |||
| 1165 | JGI24739J22299_10176192 | |||
| 1166 | JGI24737J22298_10252621 | |||
| 1167 | JGI24743J22301_10008947 | |||
| 1168 | JGI24738J21930_10002351 | |||
| 1169 | JGI24742J22300_10061582 | |||
| 1170 | JGI25406J46586_10007161 | |||
| 1171 | JGI25407J50210_10001173 | |||
| 1172 | JGI25407J50210_10006956 | |||
| 1173 | JGI25407J50210_10014404 | |||
| 1174 | JGI25405J52794_10018336 | |||
| 1175 | JGI25405J52794_10045228 | |||
| 1176 | Ga0070658_10036507 | |||
| 1177 | Ga0070676_10794519 | |||
| 1178 | Ga0070683_100063165 | |||
| 1179 | Ga0070683_100075360 | |||
| 1180 | Ga0070683_100420028 | |||
| 1181 | Ga0070683_101007701 | |||
| 1182 | Ga0070683_101760672 | |||
| 1183 | Ga0070690_100101020 | |||
| 1184 | Ga0070690_100294430 | |||
| 1185 | Ga0070670_100042392 | |||
| 1186 | Ga0070677_10202417 | |||
| 1187 | Ga0068869_100125665 | |||
| 1188 | Ga0068869_101063993 | |||
| 1189 | Ga0070666_10232012 | |||
| 1190 | Ga0070680_100042813 | |||
| 1191 | Ga0070680_100073588 | |||
| 1192 | Ga0070682_100028670 | |||
| 1193 | Ga0070682_100052805 | |||
| 1194 | Ga0070682_100069329 | |||
| 1195 | Ga0070682_100416023 | |||
| 1196 | Ga0068868_100048167 | |||
| 1197 | Ga0068868_100343315 | |||
| 1198 | Ga0068868_100650255 | |||
| 1199 | Ga0068868_100711250 | |||
| 1200 | Ga0068868_100719186 | |||
| 1201 | Ga0068868_101143133 | |||
| 1202 | Ga0070660_100015245 | |||
| 1203 | Ga0070660_100032546 | |||
| 1204 | Ga0070660_100074081 | |||
| 1205 | Ga0070660_100107897 | |||
| 1206 | Ga0070660_101042143 | |||
| 1207 | Ga0070660_101090104 | |||
| 1208 | Ga0070689_101059098 | |||
| 1209 | Ga0070691_10012025 | |||
| 1210 | Ga0070691_10012486 | |||
| 1211 | Ga0070687_100156863 | |||
| 1212 | Ga0070687_100428447 | |||
| 1213 | Ga0070687_100687711 | |||
| 1214 | Ga0070687_101012775 | |||
| 1215 | Ga0070661_100005790 | |||
| 1216 | Ga0070661_100076375 | |||
| 1217 | Ga0070661_100733229 | |||
| 1218 | Ga0070692_10012500 | |||
| 1219 | Ga0070692_10070647 | |||
| 1220 | Ga0070692_10093709 | |||
| 1221 | Ga0070692_10107927 | |||
| 1222 | Ga0070668_100155740 | |||
| 1223 | Ga0070668_100263598 | |||
| 1224 | Ga0070668_100941613 | |||
| 1225 | Ga0070669_100107675 | |||
| 1226 | Ga0070669_100293179 | |||
| 1227 | Ga0070675_100036465 | |||
| 1228 | Ga0070675_100148675 | |||
| 1229 | Ga0070671_100115530 | |||
| 1230 | Ga0070671_100192839 | |||
| 1231 | Ga0070671_100617287 | |||
| 1232 | Ga0070671_101437286 | |||
| 1233 | Ga0070674_100002837 | |||
| 1234 | Ga0070674_100012684 | |||
| 1235 | Ga0070674_100198978 | |||
| 1236 | Ga0070674_100613575 | |||
| 1237 | Ga0070674_100619603 | |||
| 1238 | Ga0070674_100859116 | |||
| 1239 | Ga0070674_101717240 | |||
| 1240 | Ga0070673_100007791 | |||
| 1241 | Ga0070673_100517467 | |||
| 1242 | Ga0070673_101308158 | |||
| 1243 | Ga0070673_102075914 | |||
| 1244 | Ga0070688_100010486 | |||
| 1245 | Ga0070688_100071101 | |||
| 1246 | Ga0070688_101395084 | |||
| 1247 | Ga0070659_100022477 | |||
| 1248 | Ga0070659_100100790 | |||
| 1249 | Ga0070659_101722058 | |||
| 1250 | Ga0070667_100224025 | |||
| 1251 | Ga0070703_10195232 | |||
| 1252 | Ga0070714_100387467 | |||
| 1253 | Ga0070710_10073841 | |||
| 1254 | Ga0070701_10012028 | |||
| 1255 | Ga0070701_10014614 | |||
| 1256 | Ga0070711_100003231 | |||
| 1257 | Ga0070711_100958128 | |||
| 1258 | Ga0070705_100017261 | |||
| 1259 | Ga0070705_100406539 | |||
| 1260 | Ga0070700_100013335 | |||
| 1261 | Ga0070700_100054747 | |||
| 1262 | Ga0070700_100256669 | |||
| 1263 | Ga0070700_100289807 | |||
| 1264 | Ga0070700_100448205 | |||
| 1265 | Ga0070694_100266182 | |||
| 1266 | Ga0070694_100272880 | |||
| 1267 | Ga0070708_100037151 | |||
| 1268 | Ga0070708_100067748 | |||
| 1269 | Ga0070708_100774791 | |||
| 1270 | Ga0070708_101012967 | |||
| 1271 | Ga0070663_100141482 | |||
| 1272 | Ga0070663_100194151 | |||
| 1273 | Ga0070663_100513166 | |||
| 1274 | Ga0070663_100702042 | |||
| 1275 | Ga0070663_101196489 | |||
| 1276 | Ga0070678_100008768 | |||
| 1277 | Ga0070678_100156281 | |||
| 1278 | Ga0070678_100556824 | |||
| 1279 | Ga0070678_100587853 | |||
| 1280 | Ga0070662_100020948 | |||
| 1281 | Ga0070662_100200004 | |||
| 1282 | Ga0070662_100392038 | |||
| 1283 | Ga0070662_100544646 | |||
| 1284 | Ga0070681_10256541 | |||
| 1285 | Ga0068867_100141576 | |||
| 1286 | Ga0068867_100302728 | |||
| 1287 | Ga0068867_100459671 | |||
| 1288 | Ga0068867_100564355 | |||
| 1289 | Ga0068867_101694732 | |||
| 1290 | Ga0070685_10012839 | |||
| 1291 | Ga0070685_10022270 | |||
| 1292 | Ga0070685_11164484 | |||
| 1293 | Ga0070706_100011096 | |||
| 1294 | Ga0070706_100055613 | |||
| 1295 | Ga0070706_100872731 | |||
| 1296 | Ga0070707_100001140 | |||
| 1297 | Ga0070707_102149257 | |||
| 1298 | Ga0070698_100005110 | |||
| 1299 | Ga0070698_100325334 | |||
| 1300 | Ga0070698_100360830 | |||
| 1301 | Ga0070698_100708532 | |||
| 1302 | Ga0070698_101363053 | |||
| 1303 | Ga0070699_100003245 | |||
| 1304 | Ga0070699_100284676 | |||
| 1305 | Ga0070699_100464548 | |||
| 1306 | Ga0070699_100847582 | |||
| 1307 | Ga0070679_100170334 | |||
| 1308 | Ga0070679_100982853 | |||
| 1309 | Ga0070684_100007592 | |||
| 1310 | Ga0070684_100053314 | |||
| 1311 | Ga0070684_100221922 | |||
| 1312 | Ga0070684_100306937 | |||
| 1313 | Ga0070684_100530618 | |||
| 1314 | Ga0070684_100684557 | |||
| 1315 | Ga0070697_100057091 | |||
| 1316 | Ga0070697_100070592 | |||
| 1317 | Ga0070697_100631143 | |||
| 1318 | Ga0070697_100835260 | |||
| 1319 | Ga0068853_100078623 | |||
| 1320 | Ga0068853_100120762 | |||
| 1321 | Ga0068853_100310366 | |||
| 1322 | Ga0070672_100288721 | |||
| 1323 | Ga0070672_100418473 | |||
| 1324 | Ga0070672_100565231 | |||
| 1325 | Ga0070672_100909242 | |||
| 1326 | Ga0070672_101179490 | |||
| 1327 | Ga0070686_100027183 | |||
| 1328 | Ga0070686_100176567 | |||
| 1329 | Ga0070695_100161181 | |||
| 1330 | Ga0070695_100475545 | |||
| 1331 | Ga0070696_100019039 | |||
| 1332 | Ga0070696_100046926 | |||
| 1333 | Ga0070696_100053434 | |||
| 1334 | Ga0070696_100692868 | |||
| 1335 | Ga0070693_100027999 | |||
| 1336 | Ga0070693_100028027 | |||
| 1337 | Ga0070693_100506041 | |||
| 1338 | Ga0070693_100942532 | |||
| 1339 | Ga0070665_100159340 | |||
| 1340 | Ga0070665_101013004 | |||
| 1341 | Ga0070665_101083977 | |||
| 1342 | Ga0070704_100175320 | |||
| 1343 | Ga0070704_100242746 | |||
| 1344 | Ga0070704_100624938 | |||
| 1345 | Ga0070704_101352460 | |||
| 1346 | Ga0068855_100015300 | |||
| 1347 | Ga0068855_100748770 | |||
| 1348 | Ga0068855_100981243 | |||
| 1349 | Ga0070664_100126925 | |||
| 1350 | Ga0070664_100142731 | |||
| 1351 | Ga0070664_100209117 | |||
| 1352 | Ga0070664_100317665 | |||
| 1353 | Ga0070664_100370429 | |||
| 1354 | Ga0070664_101353046 | |||
| 1355 | Ga0068857_100017139 | |||
| 1356 | Ga0068857_101225628 | |||
| 1357 | Ga0068854_100029510 | |||
| 1358 | Ga0068854_100173385 | |||
| 1359 | Ga0068854_100233730 | |||
| 1360 | Ga0068854_101811853 | |||
| 1361 | Ga0068856_100025558 | |||
| 1362 | Ga0068856_100032522 | |||
| 1363 | Ga0068856_101013131 | |||
| 1364 | Ga0068856_101156472 | |||
| 1365 | Ga0070702_100117565 | |||
| 1366 | Ga0070702_100178823 | |||
| 1367 | Ga0070702_100322214 | |||
| 1368 | Ga0070702_101117195 | |||
| 1369 | Ga0068852_101303614 | |||
| 1370 | Ga0068852_101311780 | |||
| 1371 | Ga0068852_101773996 | |||
| 1372 | Ga0068859_100065944 | |||
| 1373 | Ga0068859_100124067 | |||
| 1374 | Ga0068859_100733312 | |||
| 1375 | Ga0068859_101427254 | |||
| 1376 | Ga0068859_101876958 | |||
| 1377 | Ga0068864_100071508 | |||
| 1378 | Ga0068864_100077079 | |||
| 1379 | Ga0068864_100741969 | |||
| 1380 | Ga0068864_101523984 | |||
| 1381 | Ga0068866_10023145 | |||
| 1382 | Ga0068866_10085225 | |||
| 1383 | Ga0068866_11270275 | |||
| 1384 | Ga0068861_100157420 | |||
| 1385 | Ga0068851_10358836 | |||
| 1386 | Ga0068870_10239947 | |||
| 1387 | Ga0068863_100039417 | |||
| 1388 | Ga0068863_100346938 | |||
| 1389 | Ga0068863_101104263 | |||
| 1390 | Ga0068863_102024205 | |||
| 1391 | Ga0068858_100042091 | |||
| 1392 | Ga0068858_100426474 | |||
| 1393 | Ga0068860_100050463 | |||
| 1394 | Ga0068860_100177932 | |||
| 1395 | Ga0068862_100481106 | |||
| 1396 | Ga0068862_100755101 | |||
| 1397 | Ga0068862_101163241 | |||
| 1398 | Ga0081455_10004989 | |||
| 1399 | Ga0081455_10009742 | |||
| 1400 | Ga0081455_10010644 | |||
| 1401 | Ga0081455_10069673 | |||
| 1402 | Ga0081455_10072475 | |||
| 1403 | Ga0081455_10613987 | |||
| 1404 | Ga0081455_10714771 | |||
| 1405 | Ga0081455_10733579 | |||
| 1406 | Ga0081538_10000455 | |||
| 1407 | Ga0081538_10001433 | |||
| 1408 | Ga0081538_10009908 | |||
| 1409 | Ga0081538_10040893 | |||
| 1410 | Ga0081538_10082381 | |||
| 1411 | Ga0081538_10146498 | |||
| 1412 | Ga0081539_10000433 | |||
| 1413 | Ga0081539_10002473 | |||
| 1414 | Ga0081539_10270259 | |||
| 1415 | Ga0075365_10025373 | |||
| 1416 | Ga0075365_10140751 | |||
| 1417 | Ga0075363_100144464 | |||
| 1418 | Ga0075364_10047149 | |||
| 1419 | Ga0075364_10695121 | |||
| 1420 | Ga0075432_10000916 | |||
| 1421 | Ga0075432_10200834 | |||
| 1422 | Ga0075432_10396740 | |||
| 1423 | Ga0070715_10232344 | |||
| 1424 | Ga0070712_100224560 | |||
| 1425 | Ga0070712_100281618 | |||
| 1426 | Ga0070712_101367267 | |||
| 1427 | Ga0075367_10103257 | |||
| 1428 | Ga0075427_10022127 | |||
| 1429 | Ga0097621_100121910 | |||
| 1430 | Ga0097621_100357266 | |||
| 1431 | Ga0097621_100697350 | |||
| 1432 | Ga0097621_100750221 | |||
| 1433 | Ga0097621_100896760 | |||
| 1434 | Ga0068871_100989417 | |||
| 1435 | Ga0075428_100041095 | |||
| 1436 | Ga0075428_100289894 | |||
| 1437 | Ga0075430_100463691 | |||
| 1438 | Ga0075433_10009841 | |||
| 1439 | Ga0075433_10156592 | |||
| 1440 | Ga0075433_10762775 | |||
| 1441 | Ga0075433_11127767 | |||
| 1442 | Ga0075434_100035225 | |||
| 1443 | Ga0075434_100348572 | |||
| 1444 | Ga0075434_101268555 | |||
| 1445 | Ga0075434_102000246 | |||
| 1446 | Ga0075429_101950759 | |||
| 1447 | Ga0068865_100022607 | |||
| 1448 | Ga0068865_100414153 | |||
| 1449 | Ga0068865_100514963 | |||
| 1450 | Ga0068865_100782559 | |||
| 1451 | Ga0068865_101100462 | |||
| 1452 | Ga0097620_100065943 | |||
| 1453 | Ga0097620_100124078 | |||
| 1454 | Ga0097620_100733262 | |||
| 1455 | Ga0097620_101427294 | |||
| 1456 | Ga0097620_101876851 | |||
| 1457 | Ga0099794_10475768 | |||
| 1458 | Ga0105251_10527706 | |||
| 1459 | Ga0105244_10095722 | |||
| 1460 | Ga0111539_10030693 | |||
| 1461 | Ga0111539_10050110 | |||
| 1462 | Ga0111539_10171496 | |||
| 1463 | Ga0111539_10474282 | |||
| 1464 | Ga0111539_10728048 | |||
| 1465 | Ga0111539_11529214 | |||
| 1466 | Ga0111539_11764413 | |||
| 1467 | Ga0111539_11919891 | |||
| 1468 | Ga0105245_10014329 | |||
| 1469 | Ga0105245_10021343 | |||
| 1470 | Ga0105245_10030449 | |||
| 1471 | Ga0105245_10088167 | |||
| 1472 | Ga0105245_10090064 | |||
| 1473 | Ga0105245_10115226 | |||
| 1474 | Ga0105245_10262572 | |||
| 1475 | Ga0105245_10868121 | |||
| 1476 | Ga0105245_10989227 | |||
| 1477 | Ga0105245_11013920 | |||
| 1478 | Ga0105245_11670879 | |||
| 1479 | Ga0105247_10022930 | |||
| 1480 | Ga0105247_10192568 | |||
| 1481 | Ga0105247_11765423 | |||
| 1482 | Ga0114129_10015075 | |||
| 1483 | Ga0114129_10182701 | |||
| 1484 | Ga0114129_10673280 | |||
| 1485 | Ga0114129_10969677 | |||
| 1486 | Ga0114129_11322094 | |||
| 1487 | Ga0105243_10005317 | |||
| 1488 | Ga0105243_10006578 | |||
| 1489 | Ga0105243_10010461 | |||
| 1490 | Ga0105243_10022845 | |||
| 1491 | Ga0105243_10259504 | |||
| 1492 | Ga0105243_10361107 | |||
| 1493 | Ga0105243_10776206 | |||
| 1494 | Ga0105243_13021997 | |||
| 1495 | Ga0105241_10063486 | |||
| 1496 | Ga0105241_10184877 | |||
| 1497 | Ga0105241_11275703 | |||
| 1498 | Ga0105242_10030820 | |||
| 1499 | Ga0105242_10364404 | |||
| 1500 | Ga0105242_10428682 | |||
| 1501 | Ga0105242_11148020 | |||
| 1502 | Ga0105248_10047215 | |||
| 1503 | Ga0105248_10107080 | |||
| 1504 | Ga0105248_10330267 | |||
| 1505 | Ga0105248_10376102 | |||
| 1506 | Ga0105248_10473074 | |||
| 1507 | Ga0105248_10981775 | |||
| 1508 | Ga0105237_10152886 | |||
| 1509 | Ga0105237_10494816 | |||
| 1510 | Ga0105237_11159942 | |||
| 1511 | Ga0105238_10232416 | |||
| 1512 | Ga0105238_10573314 | |||
| 1513 | Ga0105238_11966782 | |||
| 1514 | Ga0105249_10012027 | |||
| 1515 | Ga0105249_10069580 | |||
| 1516 | Ga0105249_10140403 | |||
| 1517 | Ga0105249_10157047 | |||
| 1518 | Ga0105249_10805161 | |||
| 1519 | Ga0105249_12889210 | |||
| 1520 | Ga0105239_10035143 | |||
| 1521 | Ga0105239_10067076 | |||
| 1522 | Ga0105239_10178508 | |||
| 1523 | Ga0105239_10312288 | |||
| 1524 | Ga0105239_10325532 | |||
| 1525 | Ga0105239_10749206 | |||
| 1526 | Ga0105239_11142471 | |||
| 1527 | Ga0105246_10006081 | |||
| 1528 | Ga0105246_10016508 | |||
| 1529 | Ga0105246_10061149 | |||
| 1530 | Ga0105246_10132994 | |||
| 1531 | Ga0157325_1008815 | |||
| 1532 | Ga0157323_1032526 | |||
| 1533 | Ga0157345_1017880 | |||
| 1534 | Ga0157345_1023719 | |||
| 1535 | Ga0157345_1034043 | |||
| 1536 | Ga0157313_1063537 | |||
| 1537 | Ga0157326_1016137 | |||
| 1538 | Ga0157373_10393176 | |||
| 1539 | Ga0157373_10421005 | |||
| 1540 | Ga0157373_11050036 | |||
| 1541 | Ga0157371_10021612 | |||
| 1542 | Ga0157370_10103065 | |||
| 1543 | Ga0157370_10449617 | |||
| 1544 | Ga0157370_10872439 | |||
| 1545 | Ga0157370_11542637 | |||
| 1546 | Ga0157369_10068725 | |||
| 1547 | Ga0157369_10143234 | |||
| 1548 | Ga0157369_11681930 | |||
| 1549 | Ga0157374_10223079 | |||
| 1550 | Ga0157374_10263156 | |||
| 1551 | Ga0157374_10356400 | |||
| 1552 | Ga0157374_10386513 | |||
| 1553 | Ga0157378_10182730 | |||
| 1554 | Ga0157378_10687528 | |||
| 1555 | Ga0157378_10710622 | |||
| 1556 | Ga0157378_11381213 | |||
| 1557 | Ga0157378_12091381 | |||
| 1558 | Ga0163162_10074008 | |||
| 1559 | Ga0163162_10172146 | |||
| 1560 | Ga0163162_10288659 | |||
| 1561 | Ga0163162_10365155 | |||
| 1562 | Ga0163162_11222852 | |||
| 1563 | Ga0157372_10010570 | |||
| 1564 | Ga0157372_10019388 | |||
| 1565 | Ga0157372_10037591 | |||
| 1566 | Ga0157372_10714908 | |||
| 1567 | Ga0157372_10782081 | |||
| 1568 | Ga0157372_10882040 | |||
| 1569 | Ga0157372_13049456 | |||
| 1570 | Ga0157375_10006932 | |||
| 1571 | Ga0157375_10024250 | |||
| 1572 | Ga0157375_10037257 | |||
| 1573 | Ga0157375_10137598 | |||
| 1574 | Ga0157375_10999639 | |||
| 1575 | Ga0157375_11466925 | |||
| 1576 | Ga0157375_11555529 | |||
| 1577 | Ga0157375_11829584 | |||
| 1578 | Ga0163163_10027729 | |||
| 1579 | Ga0163163_10841957 | |||
| 1580 | Ga0163163_11294371 | |||
| 1581 | Ga0157380_10014720 | |||
| 1582 | Ga0157380_10065983 | |||
| 1583 | Ga0157380_11130552 | |||
| 1584 | Ga0157380_12174787 | |||
| 1585 | Ga0182008_10517117 | |||
| 1586 | Ga0157377_10004373 | |||
| 1587 | Ga0157377_10006704 | |||
| 1588 | Ga0157377_10007184 | |||
| 1589 | Ga0157377_10113716 | |||
| 1590 | Ga0157377_10134914 | |||
| 1591 | Ga0157379_10023710 | |||
| 1592 | Ga0157379_10147312 | |||
| 1593 | Ga0157379_10534903 | |||
| 1594 | Ga0157379_10615395 | |||
| 1595 | Ga0157379_10621041 | |||
| 1596 | Ga0157379_10925148 | |||
| 1597 | Ga0157379_11062946 | |||
| 1598 | Ga0157379_12328083 | |||
| 1599 | Ga0157376_10058622 | |||
| 1600 | Ga0157376_10111583 | |||
| 1601 | Ga0157376_10493049 | |||
| 1602 | Ga0157376_10736064 | |||
| 1603 | Ga0157376_11128424 | |||
| 1604 | Ga0163161_10501362 | |||
| 1605 | Ga0163161_10682542 | |||
| 1606 | Ga0206352_10759126 | |||
| 1607 | Ga0207697_10363673 | |||
| 1608 | Ga0207653_10361244 | |||
| 1609 | Ga0207692_10011250 | |||
| 1610 | Ga0207642_11012012 | |||
| 1611 | Ga0207710_10131411 | |||
| 1612 | Ga0207688_10007299 | |||
| 1613 | Ga0207688_10134796 | |||
| 1614 | Ga0207688_10257604 | |||
| 1615 | Ga0207688_10624642 | |||
| 1616 | Ga0207680_10245322 | |||
| 1617 | Ga0207647_10237412 | |||
| 1618 | Ga0207647_10432737 | |||
| 1619 | Ga0207685_10378344 | |||
| 1620 | Ga0207643_10340200 | |||
| 1621 | Ga0207705_11277532 | |||
| 1622 | Ga0207684_10005731 | |||
| 1623 | Ga0207684_10106749 | |||
| 1624 | Ga0207684_11168896 | |||
| 1625 | Ga0207654_10079750 | |||
| 1626 | Ga0207654_10606875 | |||
| 1627 | Ga0207707_10201253 | |||
| 1628 | Ga0207693_10001943 | |||
| 1629 | Ga0207663_10280586 | |||
| 1630 | Ga0207660_10062179 | |||
| 1631 | Ga0207660_11036114 | |||
| 1632 | Ga0207662_10049964 | |||
| 1633 | Ga0207662_10203884 | |||
| 1634 | Ga0207662_10852172 | |||
| 1635 | Ga0207657_10021706 | |||
| 1636 | Ga0207657_10047357 | |||
| 1637 | Ga0207657_10051759 | |||
| 1638 | Ga0207657_10390858 | |||
| 1639 | Ga0207652_10255659 | |||
| 1640 | Ga0207652_10327869 | |||
| 1641 | Ga0207652_10537375 | |||
| 1642 | Ga0207652_10884027 | |||
| 1643 | Ga0207646_10011914 | |||
| 1644 | Ga0207646_10214101 | |||
| 1645 | Ga0207681_10051803 | |||
| 1646 | Ga0207681_10285906 | |||
| 1647 | Ga0207681_10482708 | |||
| 1648 | Ga0207681_10818100 | |||
| 1649 | Ga0207694_10569964 | |||
| 1650 | Ga0207650_10097773 | |||
| 1651 | Ga0207650_10176937 | |||
| 1652 | Ga0207650_11580123 | |||
| 1653 | Ga0207659_10616438 | |||
| 1654 | Ga0207687_10020639 | |||
| 1655 | Ga0207687_10053134 | |||
| 1656 | Ga0207687_10061082 | |||
| 1657 | Ga0207687_10075211 | |||
| 1658 | Ga0207687_10108427 | |||
| 1659 | Ga0207687_10152582 | |||
| 1660 | Ga0207687_11233921 | |||
| 1661 | Ga0207687_11574431 | |||
| 1662 | Ga0207644_10327002 | |||
| 1663 | Ga0207644_10555926 | |||
| 1664 | Ga0207690_10014001 | |||
| 1665 | Ga0207690_10057756 | |||
| 1666 | Ga0207690_10758768 | |||
| 1667 | Ga0207690_11009896 | |||
| 1668 | Ga0207706_10200937 | |||
| 1669 | Ga0207706_10451583 | |||
| 1670 | Ga0207686_10052207 | |||
| 1671 | Ga0207686_10057574 | |||
| 1672 | Ga0207686_10577855 | |||
| 1673 | Ga0207686_10763294 | |||
| 1674 | Ga0207686_11067083 | |||
| 1675 | Ga0207686_11639897 | |||
| 1676 | Ga0207709_10007458 | |||
| 1677 | Ga0207709_10024515 | |||
| 1678 | Ga0207709_10086123 | |||
| 1679 | Ga0207709_10160439 | |||
| 1680 | Ga0207709_10668334 | |||
| 1681 | Ga0207709_11159446 | |||
| 1682 | Ga0207670_10056928 | |||
| 1683 | Ga0207669_10040581 | |||
| 1684 | Ga0207669_10077546 | |||
| 1685 | Ga0207669_10319301 | |||
| 1686 | Ga0207669_10634888 | |||
| 1687 | Ga0207669_10923591 | |||
| 1688 | Ga0207669_11117961 | |||
| 1689 | Ga0207704_10036661 | |||
| 1690 | Ga0207704_10068434 | |||
| 1691 | Ga0207704_10773163 | |||
| 1692 | Ga0207704_11086616 | |||
| 1693 | Ga0207691_10154403 | |||
| 1694 | Ga0207691_10260242 | |||
| 1695 | Ga0207691_10357376 | |||
| 1696 | Ga0207691_10886940 | |||
| 1697 | Ga0207711_10101714 | |||
| 1698 | Ga0207711_10159167 | |||
| 1699 | Ga0207711_10266614 | |||
| 1700 | Ga0207711_10307870 | |||
| 1701 | Ga0207711_10471904 | |||
| 1702 | Ga0207689_10033678 | |||
| 1703 | Ga0207689_10349344 | |||
| 1704 | Ga0207661_10000201 | |||
| 1705 | Ga0207661_10033747 | |||
| 1706 | Ga0207661_10145573 | |||
| 1707 | Ga0207661_10179996 | |||
| 1708 | Ga0207661_10383468 | |||
| 1709 | Ga0207661_10634518 | |||
| 1710 | Ga0207679_10103030 | |||
| 1711 | Ga0207679_10184224 | |||
| 1712 | Ga0207679_10307648 | |||
| 1713 | Ga0207679_11317594 | |||
| 1714 | Ga0207679_12078597 | |||
| 1715 | Ga0207667_11213177 | |||
| 1716 | Ga0207651_10075159 | |||
| 1717 | Ga0207651_10488230 | |||
| 1718 | Ga0207712_10082938 | |||
| 1719 | Ga0207712_10150551 | |||
| 1720 | Ga0207712_10157589 | |||
| 1721 | Ga0207712_10205645 | |||
| 1722 | Ga0207712_11186000 | |||
| 1723 | Ga0207668_10310213 | |||
| 1724 | Ga0207668_10586938 | |||
| 1725 | Ga0207668_10715844 | |||
| 1726 | Ga0207668_11371177 | |||
| 1727 | Ga0207668_11459029 | |||
| 1728 | Ga0207640_10081176 | |||
| 1729 | Ga0207640_10494085 | |||
| 1730 | Ga0207640_10672688 | |||
| 1731 | Ga0207658_11955213 | |||
| 1732 | Ga0207677_10014458 | |||
| 1733 | Ga0207677_10024296 | |||
| 1734 | Ga0207677_10094988 | |||
| 1735 | Ga0207677_10343185 | |||
| 1736 | Ga0207677_10408538 | |||
| 1737 | Ga0207677_10616637 | |||
| 1738 | Ga0207703_10227412 | |||
| 1739 | Ga0207703_10511509 | |||
| 1740 | Ga0207639_10006229 | |||
| 1741 | Ga0207639_10316424 | |||
| 1742 | Ga0207639_10397553 | |||
| 1743 | Ga0207639_10770099 | |||
| 1744 | Ga0207678_10446655 | |||
| 1745 | Ga0207678_10516197 | |||
| 1746 | Ga0207678_10929306 | |||
| 1747 | Ga0207708_10008436 | |||
| 1748 | Ga0207708_10014138 | |||
| 1749 | Ga0207708_10015442 | |||
| 1750 | Ga0207708_10079925 | |||
| 1751 | Ga0207708_11661714 | |||
| 1752 | Ga0207708_11703477 | |||
| 1753 | Ga0207702_10441500 | |||
| 1754 | Ga0207702_10443468 | |||
| 1755 | Ga0207702_10737322 | |||
| 1756 | Ga0207702_10958677 | |||
| 1757 | Ga0207641_10153875 | |||
| 1758 | Ga0207641_10455801 | |||
| 1759 | Ga0207648_10009931 | |||
| 1760 | Ga0207648_10065012 | |||
| 1761 | Ga0207648_10155599 | |||
| 1762 | Ga0207648_11036299 | |||
| 1763 | Ga0207676_10144401 | |||
| 1764 | Ga0207676_10339480 | |||
| 1765 | Ga0207676_11262606 | |||
| 1766 | Ga0207674_10036913 | |||
| 1767 | Ga0207674_10129499 | |||
| 1768 | Ga0207674_10276682 | |||
| 1769 | Ga0207674_10299058 | |||
| 1770 | Ga0207674_10453880 | |||
| 1771 | Ga0207675_100147146 | |||
| 1772 | Ga0207675_100545992 | |||
| 1773 | Ga0207675_100815580 | |||
| 1774 | Ga0207683_10049311 | |||
| 1775 | Ga0207683_10052414 | |||
| 1776 | Ga0207683_11403105 | |||
| 1777 | Ga0207698_10080840 | |||
| 1778 | Ga0207698_10921078 | |||
| 1779 | Ga0207698_11192379 | |||
| 1780 | Ga0207698_11379564 | |||
| 1781 | Ga0209970_1046001 | |||
| 1782 | Ga0209983_1138022 | |||
| 1783 | Ga0207428_10000181 | |||
| 1784 | Ga0207428_10092718 | |||
| 1785 | Ga0207428_10312886 | |||
| 1786 | Ga0268266_10409601 | |||
| 1787 | Ga0268265_10085490 | |||
| 1788 | Ga0268265_10520806 | |||
| 1789 | Ga0268265_10617289 | |||
| 1790 | Ga0268265_10872902 | |||
| 1791 | Ga0268264_10118885 | |||
| 1792 | Ga0268264_10209075 | |||
| 1793 | Ga0268264_10576626 | |||
| 1794 | Ga0265319_1019848 | |||
| 1795 | Ga0265319_1111882 | |||
| 1796 | Ga0265334_10293024 | |||
| 1797 | Ga0265318_10041523 | |||
| 1798 | Ga0265322_10208511 | |||
| 1799 | Ga0265338_10103776 | |||
| 1800 | Ga0265330_10316026 | |||
| 1801 | Ga0265320_10076132 | |||
| 1802 | Ga0265340_10104531 | |||
| 1803 | Ga0265327_10357831 | |||
| 1804 | Ga0265316_10471756 | |||
| 1805 | Ga0307408_100357206 | |||
| 1806 | Ga0307409_102217660 | |||
| 1807 | Ga0307416_102184605 | |||
| 1808 | Ga0373950_0005073 | |||
| 1809 | Ga0373958_0047854 | |||
| 1810 | Ga0373952_0005081 | |||
| 1811 | Ga0373932_0063775 | |||
| 1812 | Ga0373939_0013207 | |||
| 1813 | Ga0373941_0024348 | |||
| 1814 | Ga0373960_0025189 | |||
| 1815 | Ga0373960_0043032 | |||
| 1816 | Ga0373931_0036985 | |||
| 1817 | Ga0373931_0326681 | |||
| 1818 | Ga0373931_0588758 | |||
| 1819 | Ga0373935_0225660 | |||
| 1820 | Ga0373935_1246748 | |||
| 1821 | Ga0373933_0159854 | |||
| 1822 | Ga0373947_0093388 | |||
| 1823 | Ga0373937_0481842 | |||
| 1824 | Ga0373937_0862869 | |||
| 1825 | Ga0373925_0108139 | |||
| 1826 | Ga0395899_0002410 | |||
| 1827 | Ga0395899_0162090 | |||
| 1828 | Ga0395899_0373710 | |||
| 1829 | Ga0395899_0375464 | |||
| 1830 | Ga0395900_0037086 | |||
| 1831 | Ga0395900_0093680 | |||
| 1832 | Ga0395900_0306984 | |||
| 1833 | Ga0395900_0538730 | |||
| 1834 | Ga0395900_1088184 | |||
| 1835 | Ga0395900_1185296 | |||
| 1836 | Ga0395900_1366112 | |||
| 1837 | Ga0395898_0027945 | |||
| 1838 | Ga0395898_0272236 | |||
| 1839 | Ga0395898_0743156 | |||
| 1840 | Ga0395898_1599391 | |||
| 1841 | Ga0395905_0017680 | |||
| 1842 | Ga0395905_0091134 | |||
| 1843 | Ga0395905_0130280 | |||
| 1844 | Ga0395905_0447148 | |||
| 1845 | Ga0395901_0013531 | |||
| 1846 | Ga0395901_0015304 | |||
| 1847 | Ga0395901_0186381 | |||
| 1848 | Ga0395901_0296794 | |||
| 1849 | Ga0395901_0505207 | |||
| 1850 | Ga0395901_0710709 | |||
| 1851 | Ga0395901_0952091 | |||
| 1852 | Ga0395901_1189976 | |||
| 1853 | Ga0395901_1822921 | |||
| 1854 | Ga0436363_0964356 | |||
| 1855 | Ga0439438_019152 | |||
| 1856 | Ga0439439_0102789 | |||
| 1857 | Ga0439461_0009791 | |||
| 1858 | Ga0451789_0642567 | |||
| 1859 | Ga0451789_0705988 | |||
| 1860 | Ga0451793_1835854 | |||
| 1861 | Ga0451795_1672069 | |||
| 1862 | Ga0451798_0302062 | |||
| 1863 | Ga0451800_0895528 | |||
| 1864 | Ga0451802_1507214 | |||
| 1865 | Ga0451802_1622626 | |||
| 1866 | Ga0451806_214887 | |||
| 1867 | Ga0451807_2304833 | |||
| 1868 | Ga0451835_1106107 | |||
| 1869 | Ga0451837_0478409 | |||
| 1870 | Ga0451841_0498631 | |||
| 1871 | Ga0451847_0681374 | |||
| 1872 | Ga0451847_0964514 | |||
| 1873 | Ga0451849_0546038 | |||
| 1874 | Ga0451849_1384475 | |||
| 1875 | Ga0451851_1373888 | |||
| 1876 | Ga0451855_1021945 | |||
| 1877 | Ga0451853_0898650 | |||
| 1878 | Ga0451853_3186600 | |||
| 1879 | Ga0451853_3220247 | |||
| 1880 | Ga0439431_0020889 | |||
| 1881 | Ga0439433_0012263 | |||
| 1882 | Ga0439442_020575 | |||
| 1883 | Ga0439442_126195 | |||
| 1884 | Ga0439445_0091320 | |||
| 1885 | Ga0439445_0273859 | |||
| 1886 | Ga0439448_0020329 | |||
| 1887 | Ga0439448_0071909 | |||
| 1888 | Ga0439448_0292575 | |||
| 1889 | Ga0439449_0085359 | |||
| 1890 | Ga0439454_021992 | |||
| 1891 | Ga0439455_0082899 | |||
| 1892 | Ga0439462_0001379 | |||
| 1893 | Ga0439463_109442 | |||
| 1894 | Ga0450917_017775 | |||
| 1895 | Ga0450920_017030 | |||
| 1896 | Ga0439446_0000134 | |||
| 1897 | Ga0439446_0041217 | |||
| 1898 | Ga0450909_063762 | |||
| 1899 | Ga0439434_0001405 | |||
| 1900 | Ga0439459_0223251 | |||
| 1901 | Ga0439460_0046694 | |||
| 1902 | Ga0451577_0566956 | |||
| 1903 | Ga0466972_0251107 | |||
| 1904 | Ga0466965_0059606 | |||
| 1905 | Ga0466961_0931581 | |||
| 1906 | Ga0466964_0000687 | |||
| 1907 | Ga0453684_1388152 | |||
| 1908 | Ga0466968_0246921 | |||
| 1909 | Ga0466960_0042952 | |||
| 1910 | Ga0466960_0085149 | |||
| 1911 | Ga0466959_0669586 | |||
| 1912 | Ga0451576_0143988 | |||
| 1913 | Ga0451576_0398041 | |||
| 1914 | Ga0466967_0002463 | |||
| 1915 | Ga0495627_120760 | |||
| 1916 | Ga0495592_0094192 | |||
| 1917 | Ga0495603_0025590 | |||
| 1918 | Ga0495603_0046806 | |||
| 1919 | Ga0495603_0150121 | |||
| 1920 | Ga0495603_0184128 | |||
| 1921 | Ga0495603_0609722 | |||
| 1922 | Ga0495603_0889165 | |||
| 1923 | Ga0495629_0004952 | |||
| 1924 | Ga0495629_0434593 | |||
| 1925 | Ga0495641_0037152 | |||
| 1926 | Ga0495641_0217535 | |||
| 1927 | Ga0495651_0361833 | |||
| 1928 | Ga0495582_0007730 | |||
| 1929 | Ga0495582_0146238 | |||
| 1930 | Ga0495582_0372461 | |||
| 1931 | Ga0495605_0048655 | |||
| 1932 | Ga0495605_0176868 | |||
| 1933 | Ga0495639_0555036 | |||
| 1934 | Ga0495664_0289607 | |||
| 1935 | Ga0495584_0013077 | |||
| 1936 | Ga0495584_0058376 | |||
| 1937 | Ga0495585_0115353 | |||
| 1938 | Ga0495585_0133648 | |||
| 1939 | Ga0495585_0146195 | |||
| 1940 | Ga0495594_0215415 | |||
| 1941 | Ga0495594_0224413 | |||
| 1942 | Ga0495594_0846387 | |||
| 1943 | Ga0495596_0058627 | |||
| 1944 | Ga0495596_0069157 | |||
| 1945 | Ga0495596_0337005 | |||
| 1946 | Ga0495607_0272606 | |||
| 1947 | Ga0495608_0269329 | |||
| 1948 | Ga0495620_0175061 | |||
| 1949 | Ga0495628_0225283 | |||
| 1950 | Ga0495630_0003626 | |||
| 1951 | Ga0495630_0116291 | |||
| 1952 | Ga0495630_0857783 | |||
| 1953 | Ga0495631_0261248 | |||
| 1954 | Ga0495644_0003843 | |||
| 1955 | Ga0495644_0304787 | |||
| 1956 | Ga0495644_0409050 | |||
| 1957 | Ga0495663_0134614 | |||
| 1958 | Ga0495663_0149674 | |||
| 1959 | Ga0495666_0093922 | |||
| 1960 | Ga0495642_0031845 | |||
| 1961 | Ga0495642_0159635 | |||
| 1962 | Ga0495642_0162161 | |||
| 1963 | Ga0495652_0211691 | |||
| 1964 | Ga0495654_0354238 | |||
| 1965 | Ga0495586_0108998 | |||
| 1966 | Ga0495587_0215066 | |||
| 1967 | Ga0495598_0297659 | |||
| 1968 | Ga0495621_0106189 | |||
| 1969 | Ga0495633_0161779 | |||
| 1970 | Ga0495656_0028510 | |||
| 1971 | Ga0495656_0138524 | |||
| 1972 | Ga0495656_0479338 | |||
| 1973 | Ga0495656_0536243 | |||
| 1974 | Ga0495668_0616900 | |||
| 1975 | Ga0495634_0026588 | |||
| 1976 | Ga0495611_0064335 | |||
| 1977 | Ga0495611_0512869 | |||
| 1978 | Ga0495661_0047956 | |||
| 1979 | Ga0495588_0388380 | |||
| 1980 | Ga0495657_0169828 | |||
| 1981 | Ga0495658_0053902 | |||
| 1982 | Ga0495658_0292846 | |||
| 1983 | Ga0495658_0428246 | |||
| 1984 | Ga0495613_0055639 | |||
| 1985 | Ga0495613_0207777 | |||
| 1986 | Ga0495624_0390257 | |||
| 1987 | Ga0495624_0768111 | |||
| 1988 | Ga0495670_0301540 | |||
| 1989 | Ga0495589_0043218 | |||
| 1990 | Ga0495589_0167809 | |||
| 1991 | Ga0495589_0199509 | |||
| 1992 | Ga0495589_0218610 | |||
| 1993 | Ga0495589_0275050 | |||
| 1994 | Ga0495589_0552659 | |||
| 1995 | Ga0495581_0054475 | |||
| 1996 | Ga0495581_0204912 | |||
| 1997 | Ga0495636_0118995 | |||
| 1998 | Ga0495636_0556835 | |||
| 1999 | Ga0495676_0045078 | |||
| 2000 | Ga0495676_0219605 | |||
| 2001 | Ga0495676_0234782 | |||
| 2002 | Ga0495676_0271738 | |||
| 2003 | Ga0495676_0360656 | |||
| 2004 | Ga0495676_0561934 | |||
| 2005 | Ga0495677_0192726 | |||
| 2006 | Ga0495677_0220200 | |||
| 2007 | Ga0495685_064728 | |||
| 2008 | Ga0495593_0223010 | |||
| 2009 | Ga0495614_0404076 | |||
| 2010 | Ga0495615_0149251 | |||
| 2011 | Ga0496100_0025949 | |||
| 2012 | Ga0496100_0071282 | |||
| 2013 | Ga0496100_0074115 | |||
| 2014 | Ga0496100_0099783 | |||
| 2015 | Ga0496100_0273295 | |||
| 2016 | Ga0496100_0492563 | |||
| 2017 | Ga0496100_0882239 | |||
| 2018 | Ga0496101_0049882 | |||
| 2019 | Ga0496101_0069442 | |||
| 2020 | Ga0496101_0114938 | |||
| 2021 | Ga0496101_0117177 | |||
| 2022 | Ga0496101_0123380 | |||
| 2023 | Ga0496101_0159002 | |||
| 2024 | Ga0496101_0537469 | |||
| 2025 | Ga0496101_0546331 | |||
| 2026 | Ga0496101_1380550 | |||
| 2027 | Ga0496102_0201032 | |||
| 2028 | Ga0496102_0218369 | |||
| 2029 | Ga0496102_1084586 | |||
| 2030 | Ga0496102_1100691 | |||
| 2031 | Ga0496102_1398780 | |||
| 2032 | Ga0496103_0029164 | |||
| 2033 | Ga0496103_0502982 | |||
| 2034 | Ga0496103_0716525 | |||
| 2035 | Ga0496104_0055919 | |||
| 2036 | Ga0496104_0056825 | |||
| 2037 | Ga0496104_0080874 | |||
| 2038 | Ga0496104_0088138 | |||
| 2039 | Ga0496104_0112843 | |||
| 2040 | Ga0496104_0142234 | |||
| 2041 | Ga0496104_0524276 | |||
| 2042 | Ga0496104_0656533 | |||
| 2043 | Ga0496105_0029673 | |||
| 2044 | Ga0496105_0053886 | |||
| 2045 | Ga0496105_0077219 | |||
| 2046 | Ga0496105_0113427 | |||
| 2047 | Ga0496105_0133102 | |||
| 2048 | Ga0496105_0719195 | |||
| 2049 | Ga0496105_0950618 | |||
| 2050 | Ga0496106_0066358 | |||
| 2051 | Ga0496106_0123448 | |||
| 2052 | Ga0496106_0152282 | |||
| 2053 | Ga0496106_0452398 | |||
| 2054 | Ga0496107_0014736 | |||
| 2055 | Ga0496107_0033365 | |||
| 2056 | Ga0496107_0230606 | |||
| 2057 | Ga0496107_0320596 | |||
| 2058 | Ga0496107_0366672 | |||
| 2059 | Ga0496107_0692775 | |||
| 2060 | Ga0496108_0003242 | |||
| 2061 | Ga0496108_0009627 | |||
| 2062 | Ga0496108_0012326 | |||
| 2063 | Ga0496108_0045169 | |||
| 2064 | Ga0496108_0070735 | |||
| 2065 | Ga0496108_0170194 | |||
| 2066 | Ga0496108_0505438 | |||
| 2067 | Ga0496108_0598600 | |||
| 2068 | Ga0496108_0688755 | |||
| 2069 | Ga0496109_0002074 | |||
| 2070 | Ga0496109_0003469 | |||
| 2071 | Ga0496109_0030617 | |||
| 2072 | Ga0496109_0083045 | |||
| 2073 | Ga0496109_0185294 | |||
| 2074 | Ga0496109_0187953 | |||
| 2075 | Ga0496109_0203567 | |||
| 2076 | Ga0496109_0463027 | |||
| 2077 | Ga0496109_1245012 | |||
| 2078 | Ga0496109_1273136 | |||
| 2079 | Ga0496109_1320648 | |||
| 2080 | Ga0496109_1490362 | |||
| 2081 | Ga0496109_1595417 | |||
| 2082 | Ga0496110_0004092 | |||
| 2083 | Ga0496110_0024616 | |||
| 2084 | Ga0496110_0071796 | |||
| 2085 | Ga0496110_0308903 | |||
| 2086 | Ga0496110_0535971 | |||
| 2087 | Ga0496110_0567454 | |||
| 2088 | Ga0496110_0902190 | |||
| 2089 | Ga0496111_0001796 | |||
| 2090 | Ga0496111_0010431 | |||
| 2091 | Ga0496111_0037840 | |||
| 2092 | Ga0496111_0041933 | |||
| 2093 | Ga0496111_0057593 | |||
| 2094 | Ga0496111_0065084 | |||
| 2095 | Ga0496111_0084613 | |||
| 2096 | Ga0496111_0559248 | |||
| 2097 | Ga0496112_0032546 | |||
| 2098 | Ga0496112_0175055 | |||
| 2099 | Ga0496112_0255248 | |||
| 2100 | Ga0496112_0429510 | |||
| 2101 | Ga0496112_1549024 | |||
| 2102 | Ga0496113_0007449 | |||
| 2103 | Ga0496113_0071030 | |||
| 2104 | Ga0496113_0284184 | |||
| 2105 | Ga0496114_0013425 | |||
| 2106 | Ga0496114_0016448 | |||
| 2107 | Ga0496114_0157776 | |||
| 2108 | Ga0496114_0185582 | |||
| 2109 | Ga0496114_0272537 | |||
| 2110 | Ga0496114_0320453 | |||
| 2111 | Ga0496114_0609961 | |||
| 2112 | Ga0496115_0045173 | |||
| 2113 | Ga0496115_0082106 | |||
| 2114 | Ga0501031_0014359 | |||
| 2115 | Ga0501031_0020193 | |||
| 2116 | Ga0501031_0031268 | |||
| 2117 | Ga0501031_0366826 | |||
| 2118 | Ga0501031_0462683 | |||
| 2119 | Ga0501032_0014903 | |||
| 2120 | Ga0501032_0037929 | |||
| 2121 | Ga0501032_0130410 | |||
| 2122 | Ga0501032_0224216 | |||
| 2123 | Ga0501033_0032289 | |||
| 2124 | Ga0501033_0032405 | |||
| 2125 | Ga0501034_0382252 | |||
| 2126 | Ga0501034_0452376 | |||
| 2127 | Ga0501036_0024247 | |||
| 2128 | Ga0501036_0079455 | |||
| 2129 | Ga0501036_0093417 | |||
| 2130 | Ga0501036_0135909 | |||
| 2131 | Ga0501037_0054259 | |||
| 2132 | Ga0501037_0055569 | |||
| 2133 | Ga0501037_0731316 | |||
| 2134 | Ga0501038_0003877 | |||
| 2135 | Ga0501038_0083953 | |||
| 2136 | Ga0501038_0187419 | |||
| 2137 | Ga0501038_1001588 | |||
| 2138 | Ga0501039_0018570 | |||
| 2139 | Ga0501039_0031033 | |||
| 2140 | Ga0501039_0109839 | |||
| 2141 | Ga0501039_0145097 | |||
| 2142 | Ga0501039_0166625 | |||
| 2143 | Ga0501039_0294584 | |||
| 2144 | Ga0501040_0004530 | |||
| 2145 | Ga0501040_0005859 | |||
| 2146 | Ga0501040_0010738 | |||
| 2147 | Ga0501040_0186667 | |||
| 2148 | Ga0501041_0011667 | |||
| 2149 | Ga0501041_0013767 | |||
| 2150 | Ga0501041_0017186 | |||
| 2151 | Ga0501041_0020589 | |||
| 2152 | Ga0501041_0039623 | |||
| 2153 | Ga0501041_0224941 | |||
| 2154 | Ga0501041_0324022 | |||
| 2155 | Ga0501042_0001284 | |||
| 2156 | Ga0501042_0006125 | |||
| 2157 | Ga0501042_0019924 | |||
| 2158 | Ga0501042_0036108 | |||
| 2159 | Ga0501042_0404211 | |||
| 2160 | Ga0501042_0990942 | |||
| 2161 | Ga0501043_0046745 | |||
| 2162 | Ga0501043_0536931 | |||
| 2163 | Ga0501043_0766072 | |||
| 2164 | Ga0501046_0011716 | |||
| 2165 | Ga0501046_0072244 | |||
| 2166 | Ga0501046_0197401 | |||
| 2167 | Ga0501046_0488815 | |||
| 2168 | Ga0501048_0008728 | |||
| 2169 | Ga0501048_0012732 | |||
| 2170 | Ga0501048_0019366 | |||
| 2171 | Ga0501048_0089983 | |||
| 2172 | Ga0501048_0281092 | |||
| 2173 | Ga0501048_0696277 | |||
| 2174 | Ga0501048_0884932 | |||
| 2175 | Ga0501067_0373297 | |||
| 2176 | Ga0501068_0010561 | |||
| 2177 | Ga0501068_0031211 | |||
| 2178 | Ga0501068_0047173 | |||
| 2179 | Ga0501068_0121208 | |||
| 2180 | Ga0501068_0989559 | |||
| 2181 | Ga0501069_0136543 | |||
| 2182 | Ga0501069_0149501 | |||
| 2183 | Ga0501069_0178230 | |||
| 2184 | Ga0501069_0196326 | |||
| 2185 | Ga0501070_0067481 | |||
| 2186 | Ga0501070_0384898 | |||
| 2187 | Ga0501071_0005871 | |||
| 2188 | Ga0501071_0011907 | |||
| 2189 | Ga0501071_0012278 | |||
| 2190 | Ga0501071_0034955 | |||
| 2191 | Ga0501071_0071118 | |||
| 2192 | Ga0501071_0201649 | |||
| 2193 | Ga0501071_0699172 | |||
| 2194 | Ga0501072_0001680 | |||
| 2195 | Ga0501072_0044866 | |||
| 2196 | Ga0501072_0064369 | |||
| 2197 | Ga0501072_0116870 | |||
| 2198 | Ga0501072_0213518 | |||
| 2199 | Ga0501072_0213846 | |||
| 2200 | Ga0501072_0286216 | |||
| 2201 | Ga0501072_0346635 | |||
| 2202 | Ga0501073_0031616 | |||
| 2203 | Ga0501073_0049246 | |||
| 2204 | Ga0501073_0137575 | |||
| 2205 | Ga0501073_0341909 | |||
| 2206 | Ga0501073_0629360 | |||
| 2207 | Ga0501074_0008808 | |||
| 2208 | Ga0501074_0014764 | |||
| 2209 | Ga0501074_0020248 | |||
| 2210 | Ga0501074_0058319 | |||
| 2211 | Ga0501074_0072007 | |||
| 2212 | Ga0501074_0116833 | |||
| 2213 | Ga0501074_0304812 | |||
| 2214 | Ga0501074_0598783 | |||
| 2215 | Ga0501075_0002089 | |||
| 2216 | Ga0501075_0014557 | |||
| 2217 | Ga0501075_0017741 | |||
| 2218 | Ga0501075_0037673 | |||
| 2219 | Ga0501075_0055048 | |||
| 2220 | Ga0501075_0222869 | |||
| 2221 | Ga0501075_0226320 | |||
| 2222 | Ga0501076_0028703 | |||
| 2223 | Ga0501076_0044969 | |||
| 2224 | Ga0501076_0048690 | |||
| 2225 | Ga0501076_0321945 | |||
| 2226 | Ga0501076_0458005 | |||
| 2227 | Ga0501076_0550594 | |||
| 2228 | Ga0501076_0666698 | |||
| 2229 | Ga0501076_0748407 | |||
| 2230 | Ga0501077_0009698 | |||
| 2231 | Ga0501077_0010445 | |||
| 2232 | Ga0501077_0092772 | |||
| 2233 | Ga0501077_0099298 | |||
| 2234 | Ga0501077_0109115 | |||
| 2235 | Ga0501077_0135899 | |||
| 2236 | Ga0501077_0475644 | |||
| 2237 | Ga0501079_0005575 | |||
| 2238 | Ga0501079_0019555 | |||
| 2239 | Ga0501079_0030431 | |||
| 2240 | Ga0501079_0051205 | |||
| 2241 | Ga0501079_0272766 | |||
| 2242 | Ga0501079_0363713 | |||
| 2243 | Ga0501079_0410344 | |||
| 2244 | Ga0501079_0444923 | |||
| 2245 | Ga0501080_0018197 | |||
| 2246 | Ga0501080_0036126 | |||
| 2247 | Ga0501080_0238948 | |||
| 2248 | Ga0501080_0256724 | |||
| 2249 | Ga0501081_0004310 | |||
| 2250 | Ga0501081_0011332 | |||
| 2251 | Ga0501081_0012644 | |||
| 2252 | Ga0501081_0115418 | |||
| 2253 | Ga0501081_0124534 | |||
| 2254 | Ga0501081_0140668 | |||
| 2255 | Ga0501081_1264670 | |||
| 2256 | Ga0501083_0060316 | |||
| 2257 | Ga0501083_0155966 | |||
| 2258 | Ga0501035_0016684 | |||
| 2259 | Ga0501035_0028556 | |||
| 2260 | Ga0501035_0394374 | |||
| 2261 | Ga0501035_0512786 | |||
| 2262 | Ga0501044_0109521 | |||
| 2263 | Ga0501045_0012060 | |||
| 2264 | Ga0501045_0020928 | |||
| 2265 | Ga0501045_0025587 | |||
| 2266 | Ga0501045_0027954 | |||
| 2267 | Ga0501045_0040793 | |||
| 2268 | Ga0501045_0096801 | |||
| 2269 | Ga0501045_0266683 | |||
| 2270 | Ga0501045_0446514 | |||
| 2271 | nmdc:mga00v17_622294_c1 | |||
| 2272 | nmdc:mga00v17_69881_c1 | |||
| 2273 | nmdc:mga0yw44_48089_c1 | |||
| 2274 | nmdc:mga0yw44_737117_c1 | |||
| 2275 | nmdc:mga0k408_233719_c1 | |||
| 2276 | nmdc:mga06z11_367628_c1 | |||
| 2277 | nmdc:mga07m45_365020_c1 | |||
| 2278 | nmdc:mga05p37_1135628_c1 | |||
| 2279 | nmdc:mga05p37_15232_c1 | |||
| 2280 | nmdc:mga05p37_278379_c1 | |||
| 2281 | nmdc:mga06r32_591117_c1 | |||
| 2282 | nmdc:mga08y16_1197823_c1 | |||
| 2283 | nmdc:mga08y16_1294113_c1 | |||
| 2284 | nmdc:mga08y16_21827_c1 | |||
| 2285 | nmdc:mga08y16_226456_c1 | |||
| 2286 | nmdc:mga08y16_238598_c1 | |||
| 2287 | nmdc:mga0n895_1348624_c1 | |||
| 2288 | nmdc:mga0n895_172472_c1 | |||
| 2289 | nmdc:mga0n895_287362_c1 | |||
| 2290 | nmdc:mga0n895_556856_c1 | |||
| 2291 | nmdc:mga0a205_13272_c1 | |||
| 2292 | nmdc:mga0a205_237110_c1 | |||
| 2293 | nmdc:mga0a205_512820_c1 | |||
| 2294 | nmdc:mga0a205_856565_c1 | |||
| 2295 | Ga0495612_0062066 | |||
| 2296 | Ga0495655_0263330 | |||
| 2297 | Ga0495619_0133463 | |||
| 2298 | Ga0501084_0006164 | |||
| 2299 | Ga0501084_0013047 | |||
| 2300 | Ga0501084_0023920 | |||
| 2301 | Ga0501084_0028142 | |||
| 2302 | Ga0501084_0058863 | |||
| 2303 | Ga0501084_0232143 | |||
| 2304 | Ga0501084_0239235 | |||
| 2305 | Ga0501084_0411345 | |||
| 2306 | Ga0590071_075624 | |||
| 2307 | Ga0590074_073527 | |||
| 2308 | Ga0590075_038867 | |||
| 2309 | Ga0501082_0009620 | |||
| 2310 | Ga0501082_0019151 | |||
| 2311 | Ga0501082_0033797 | |||
| 2312 | Ga0501082_0089115 | |||
| 2313 | Ga0501082_0119301 | |||
| 2314 | Ga0501082_0122306 | |||
| 2315 | Ga0530510_0013639 | |||
| 2316 | Ga0530510_0112433 | |||
| 2317 | Ga0530510_0150467 | |||
| 2318 | Ga0530510_0173364 | |||
| 2319 | Ga0530510_0199807 | |||
| 2320 | Ga0530510_0679132 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ml4-assembly1.cif.gz_V | rna polymerase ii initially transcribing complex (itc) | 0.6689 | 35 | 86 |
| 7ml4-assembly1.cif.gz_V | rna polymerase ii initially transcribing complex (itc) | 0.6372 | 35 | 86 |
| 5gam-assembly1.cif.gz_h | foot region of the yeast spliceosomal u4/u6.u5 tri-snrnp | 0.628 | 28 | 97 |
| 3jcr-assembly1.cif.gz_P | 3d structure determination of the human*u4/u6.u5* tri-snrnp complex | 0.6114 | 26 | 90 |
| 3jb9-assembly1.cif.gz_o | cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution | 0.6095 | 28 | 95 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P31554_47_205_2.60.450.10 | Mainly Beta;Sandwich;lipopolysaccharide transport protein A fold;Lipopolysaccharide (LPS) transport protein A like domain | 0.6606 | 32 | 83 | 2.60.450.10 |
| af_A4ICT3_7_91_2.30.30.100 | Mainly Beta;Roll;SH3 type barrels.; | 0.6397 | 21 | 92 | 2.30.30.100 |
| af_Q8I1Q3_26_106_2.30.30.100 | Mainly Beta;Roll;SH3 type barrels.; | 0.6269 | 29 | 92 | 2.30.30.100 |
| af_Q8ILA7_22_101_2.30.30.100 | Mainly Beta;Roll;SH3 type barrels.; | 0.6253 | 17 | 92 | 2.30.30.100 |
| af_Q54YX5_1_82_2.30.30.100 | Mainly Beta;Roll;SH3 type barrels.; | 0.6236 | 28 | 97 | 2.30.30.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D4X2X8-F1-model_v4 | DUF2469 domain-containing protein | 0.8821 | 32 | 97 |
|
| AF-A0A538FQD3-F1-model_v4 | DUF2469 family protein | 0.8797 | 29 | 96 |
|
| AF-A0A810N2Z2-F1-model_v4 | DUF2469 family protein | 0.8738 | 33 | 97 |
|
| AF-A0A315RYF3-F1-model_v4 | deleted | 0.8714 | 28 | 97 |
|
| AF-A0A3B9JY60-F1-model_v4 | DUF2469 domain-containing protein | 0.8635 | 22 | 95 |
|