F490934
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1156 | 445 | 1152 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300003760|Ga0055527_1005009|Ga0055527_10050092 |
| Length | 186 |
| Sequence | MTIVEKYWDDAREGDTCTSPTYLVTKXRILAXADLTGDHTPVHVDEEYANASHFGCLVAHGLFGLSIADGLKTQSDYRFLPGMSLGWTWDFLLPIKVGDVLHVTFRVGSMRASKSRPDWGIVVLPSXLINQDGQVVQRGEHRLMVPRRPEALXCRHVPSKAFASSTTAISSPARMSXAVSRRSAPK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 2 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 3 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 4 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 5 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 11 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 12 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 13 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 14 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 15 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 19 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 20 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 21 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 22 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 23 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 24 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 36 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 37 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 39 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 40 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 43 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 44 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 45 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 47 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 51 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 53 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 87 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 93 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 94 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 95 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 96 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 97 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 98 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 99 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 100 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 101 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 102 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 104 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 105 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 106 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 110 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 111 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 126 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 142 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 143 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 146 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 147 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 158 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 159 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 162 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 228 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 232 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 233 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 234 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 235 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 236 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 237 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 238 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 239 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 240 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 241 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 243 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 244 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 245 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 246 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 247 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 248 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 249 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 250 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 251 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 252 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 253 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 254 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 255 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 256 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 257 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 258 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 259 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 260 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 261 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 262 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 263 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 264 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 265 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 266 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 267 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 268 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 269 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 270 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 271 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 272 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 273 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 274 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 275 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 276 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 277 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 278 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 279 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 280 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 281 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 282 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 283 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 284 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 285 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 286 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 287 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 288 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 289 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 290 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 291 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 292 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 293 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 294 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 295 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 296 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 297 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 298 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 299 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 373 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 374 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 375 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 376 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 377 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 378 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 379 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 380 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 381 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 382 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 383 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 384 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 385 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 386 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 387 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 388 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 389 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 390 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 391 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 392 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 393 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 394 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 398 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 399 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 404 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 405 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 406 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 407 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 408 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 409 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 410 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 411 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 412 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 413 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 414 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 415 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 418 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 419 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 420 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 421 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 422 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 423 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 424 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 425 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 426 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 427 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 428 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 429 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 430 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 431 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 432 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 433 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 434 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.75 |
| Metatranscriptomes | 1.9 |
| Isolates | 0.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.28 |
| Nodule | 0.09 |
| Rhizoplane | 3.29 |
| Rhizosphere | 68.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000084 | 3300001915 | Bacteria | 23727 |
| 2 | JGI24740J21852_10000038 | 3300001979 | Bacteria | 44180 |
| 3 | JGI24740J21852_10000091 | 3300001979 | Bacteria | 31370 |
| 4 | JGI24740J21852_10019260 | 3300001979 | Bacteria | 2407 |
| 5 | JGI24740J21852_10065968 | 3300001979 | Bacteria | 983 |
| 6 | JGI24739J22299_10078299 | 3300001989 | Bacteria | 1018 |
| 7 | JGI24739J22299_10163337 | 3300001989 | Bacteria | 657 |
| 8 | JGI24737J22298_10010200 | 3300001990 | Bacteria | 3106 |
| 9 | JGI24735J21928_10000589 | 3300002067 | Bacteria | 12773 |
| 10 | JGI25156J39149_1000006 | 3300002705 | Bacteria | 261778 |
| 11 | JGI25156J39149_1000135 | 3300002705 | Bacteria | 53930 |
| 12 | JGI25156J39149_1006100 | 3300002705 | Bacteria | 3344 |
| 13 | JGI25156J39149_1006124 | 3300002705 | Bacteria | 3334 |
| 14 | JGI25156J39149_1006256 | 3300002705 | Bacteria | 3278 |
| 15 | JGI25156J39149_1016753 | 3300002705 | Bacteria | 1414 |
| 16 | JGI25156J39149_1026051 | 3300002705 | Bacteria | 931 |
| 17 | JGI25154J39366_1000389 | 3300002738 | Bacteria | 23912 |
| 18 | JGI25158J39367_1009898 | 3300002739 | Bacteria | 1297 |
| 19 | JGI25157J39369_1000016 | 3300002741 | Bacteria | 192349 |
| 20 | JGI25150J39212_1002582 | 3300002774 | Bacteria | 4455 |
| 21 | JGI25151J46595_10014151 | 3300003187 | Bacteria | 3567 |
| 22 | JGI25151J46595_10068449 | 3300003187 | Bacteria | 1089 |
| 23 | JGI25151J46595_10086425 | 3300003187 | Bacteria | 888 |
| 24 | JGI25165J46597_1000661 | 3300003214 | Bacteria | 28133 |
| 25 | JGI25153J46596_10033361 | 3300003215 | Bacteria | 1700 |
| 26 | rootH1_10027942 | 3300003316 | Bacteria | 1821 |
| 27 | rootH1_10048720 | 3300003316 | Bacteria | 2940 |
| 28 | rootH1_10054218 | 3300003316 | Bacteria | 6135 |
| 29 | rootH1_10101357 | 3300003316 | Bacteria | 1067 |
| 30 | rootH2_10050565 | 3300003320 | Bacteria | 1325 |
| 31 | rootL2_10009476 | 3300003322 | Bacteria | 12918 |
| 32 | rootL2_10012388 | 3300003322 | Bacteria | 5838 |
| 33 | rootL2_10137787 | 3300003322 | Bacteria | 12087 |
| 34 | rootH1_10120212 | 3300003323 | Bacteria | 3646 |
| 35 | rootH1_10201936 | 3300003323 | Bacteria | 1646 |
| 36 | JGI25160J50197_1000098 | 3300003354 | Bacteria | 87307 |
| 37 | JGI25161J50226_1000037 | 3300003374 | Bacteria | 133331 |
| 38 | Ga0055539_1000075 | 3300003752 | Bacteria | 130079 |
| 39 | Ga0055533_1000140 | 3300003756 | Bacteria | 76502 |
| 40 | Ga0055533_1000933 | 3300003756 | Bacteria | 8687 |
| 41 | Ga0055532_1000003 | 3300003758 | Bacteria | 494004 |
| 42 | Ga0055532_1000056 | 3300003758 | Bacteria | 158878 |
| 43 | Ga0055532_1000265 | 3300003758 | Bacteria | 34085 |
| 44 | Ga0055532_1005641 | 3300003758 | Bacteria | 1739 |
| 45 | Ga0055525_1000492 | 3300003759 | Bacteria | 20296 |
| 46 | Ga0055525_1011031 | 3300003759 | Bacteria | 762 |
| 47 | Ga0055527_1000006 | 3300003760 | Bacteria | 494004 |
| 48 | Ga0055527_1000323 | 3300003760 | Bacteria | 25846 |
| 49 | Ga0055527_1002493 | 3300003760 | Bacteria | 3100 |
| 50 | Ga0055527_1005009 | 3300003760 | Bacteria | 1763 |
| 51 | Ga0055527_1006523 | 3300003760 | Bacteria | 1458 |
| 52 | Ga0055535_1000003 | 3300003761 | Bacteria | 494004 |
| 53 | Ga0055535_1000013 | 3300003761 | Bacteria | 299614 |
| 54 | Ga0055535_1000115 | 3300003761 | Bacteria | 86313 |
| 55 | Ga0055535_1000134 | 3300003761 | Bacteria | 78815 |
| 56 | Ga0055535_1000701 | 3300003761 | Bacteria | 25846 |
| 57 | Ga0055542_1000007 | 3300003762 | Bacteria | 494004 |
| 58 | Ga0055542_1000028 | 3300003762 | Bacteria | 251458 |
| 59 | Ga0055542_1000178 | 3300003762 | Bacteria | 78815 |
| 60 | Ga0055542_1000861 | 3300003762 | Bacteria | 21268 |
| 61 | Ga0055542_1002118 | 3300003762 | Bacteria | 7288 |
| 62 | Ga0055529_1000003 | 3300003763 | Bacteria | 494004 |
| 63 | Ga0055529_1000074 | 3300003763 | Bacteria | 158872 |
| 64 | Ga0055529_1000203 | 3300003763 | Bacteria | 78815 |
| 65 | Ga0055526_1000184 | 3300003771 | Bacteria | 54504 |
| 66 | Ga0055537_1000006 | 3300003773 | Bacteria | 147020 |
| 67 | Ga0055537_1007555 | 3300003773 | Bacteria | 2609 |
| 68 | Ga0055524_1000032 | 3300003775 | Bacteria | 182182 |
| 69 | Ga0055536_1005877 | 3300003781 | Bacteria | 5884 |
| 70 | Ga0055536_1007682 | 3300003781 | Bacteria | 4777 |
| 71 | Ga0055534_1004608 | 3300003784 | Bacteria | 3931 |
| 72 | Ga0055534_1007435 | 3300003784 | Bacteria | 2609 |
| 73 | Ga0055528_1002844 | 3300003790 | Bacteria | 9038 |
| 74 | Ga0055528_1003256 | 3300003790 | Bacteria | 8273 |
| 75 | Ga0055528_1016487 | 3300003790 | Bacteria | 2609 |
| 76 | Ga0055530_10000380 | 3300003791 | Bacteria | 40324 |
| 77 | Ga0055530_10000731 | 3300003791 | Bacteria | 27463 |
| 78 | Ga0055530_10000890 | 3300003791 | Bacteria | 24579 |
| 79 | Ga0055530_10003806 | 3300003791 | Bacteria | 8300 |
| 80 | Ga0055540_1000046 | 3300003792 | Bacteria | 148762 |
| 81 | Ga0055540_1001790 | 3300003792 | Bacteria | 12221 |
| 82 | Ga0055540_1002356 | 3300003792 | Bacteria | 10109 |
| 83 | Ga0055540_1019493 | 3300003792 | Bacteria | 1824 |
| 84 | Ga0055531_10000084 | 3300003794 | Bacteria | 102550 |
| 85 | Ga0055531_10003007 | 3300003794 | Bacteria | 10942 |
| 86 | Ga0055541_1000425 | 3300003841 | Bacteria | 12425 |
| 87 | Ga0055541_1002842 | 3300003841 | Bacteria | 3353 |
| 88 | Ga0058692_1008655 | 3300003856 | Bacteria | 2617 |
| 89 | Ga0055543_1000645 | 3300004625 | Bacteria | 18613 |
| 90 | Ga0065165_1000821 | 3300005262 | Bacteria | 41157 |
| 91 | Ga0065165_1022462 | 3300005262 | Bacteria | 2161 |
| 92 | Ga0065165_1022630 | 3300005262 | Bacteria | 2149 |
| 93 | Ga0065714_10077745 | 3300005288 | Bacteria | 2662 |
| 94 | Ga0065704_10147436 | 3300005289 | Bacteria | 1459 |
| 95 | Ga0070658_10027600 | 3300005327 | Bacteria | 4554 |
| 96 | Ga0070658_10092842 | 3300005327 | Bacteria | 2489 |
| 97 | Ga0070658_10247226 | 3300005327 | Bacteria | 1513 |
| 98 | Ga0070658_10483300 | 3300005327 | Bacteria | 1069 |
| 99 | Ga0070676_10018812 | 3300005328 | Bacteria | 3834 |
| 100 | Ga0070676_10139974 | 3300005328 | Bacteria | 1539 |
| 101 | Ga0070676_10149055 | 3300005328 | Bacteria | 1496 |
| 102 | Ga0070670_100000540 | 3300005331 | Bacteria | 30079 |
| 103 | Ga0070670_100022297 | 3300005331 | Bacteria | 5451 |
| 104 | Ga0070670_100068177 | 3300005331 | Bacteria | 3054 |
| 105 | Ga0068869_100002271 | 3300005334 | Bacteria | 11571 |
| 106 | Ga0068869_101121546 | 3300005334 | Bacteria | 689 |
| 107 | Ga0070666_10074877 | 3300005335 | Bacteria | 2308 |
| 108 | Ga0068868_100032080 | 3300005338 | Bacteria | 4039 |
| 109 | Ga0070660_100000029 | 3300005339 | Bacteria | 88220 |
| 110 | Ga0070660_100015930 | 3300005339 | Bacteria | 5444 |
| 111 | Ga0070660_100108727 | 3300005339 | Bacteria | 2204 |
| 112 | Ga0070661_100001417 | 3300005344 | Bacteria | 16689 |
| 113 | Ga0070661_100052691 | 3300005344 | Bacteria | 2978 |
| 114 | Ga0070661_100400221 | 3300005344 | Bacteria | 1085 |
| 115 | Ga0070668_100110348 | 3300005347 | Bacteria | 2189 |
| 116 | Ga0070669_100020431 | 3300005353 | Bacteria | 4730 |
| 117 | Ga0070671_100020456 | 3300005355 | Bacteria | 5398 |
| 118 | Ga0070671_100048591 | 3300005355 | Bacteria | 3529 |
| 119 | Ga0070674_101228322 | 3300005356 | Bacteria | 666 |
| 120 | Ga0070673_100266969 | 3300005364 | Bacteria | 1497 |
| 121 | Ga0070659_100000006 | 3300005366 | Bacteria | 229954 |
| 122 | Ga0070659_100000307 | 3300005366 | Bacteria | 38077 |
| 123 | Ga0070659_100025930 | 3300005366 | Bacteria | 4509 |
| 124 | Ga0070659_100057651 | 3300005366 | Bacteria | 3063 |
| 125 | Ga0070667_100005867 | 3300005367 | Bacteria | 10238 |
| 126 | Ga0070667_100216118 | 3300005367 | Bacteria | 1705 |
| 127 | Ga0070667_100909936 | 3300005367 | Bacteria | 819 |
| 128 | Ga0070705_100168650 | 3300005440 | Bacteria | 1471 |
| 129 | Ga0070700_100352045 | 3300005441 | Bacteria | 1092 |
| 130 | Ga0070708_100027484 | 3300005445 | Bacteria | 4883 |
| 131 | Ga0070663_100000002 | 3300005455 | Bacteria | 298075 |
| 132 | Ga0070663_100018810 | 3300005455 | Bacteria | 4539 |
| 133 | Ga0070663_100288472 | 3300005455 | Bacteria | 1310 |
| 134 | Ga0070663_100293494 | 3300005455 | Bacteria | 1299 |
| 135 | Ga0070663_100365164 | 3300005455 | Bacteria | 1172 |
| 136 | Ga0070663_100380086 | 3300005455 | Bacteria | 1150 |
| 137 | Ga0070663_100398795 | 3300005455 | Bacteria | 1124 |
| 138 | Ga0070663_100588954 | 3300005455 | Bacteria | 934 |
| 139 | Ga0070663_100800769 | 3300005455 | Bacteria | 808 |
| 140 | Ga0070678_100359437 | 3300005456 | Bacteria | 1254 |
| 141 | Ga0070678_100675304 | 3300005456 | Bacteria | 929 |
| 142 | Ga0070662_100179746 | 3300005457 | Bacteria | 1667 |
| 143 | Ga0070662_100205147 | 3300005457 | Bacteria | 1566 |
| 144 | Ga0070662_100521362 | 3300005457 | Bacteria | 993 |
| 145 | Ga0070662_100867174 | 3300005457 | Bacteria | 769 |
| 146 | Ga0068867_100058308 | 3300005459 | Bacteria | 2861 |
| 147 | Ga0068867_100546421 | 3300005459 | Bacteria | 1003 |
| 148 | Ga0070706_100008574 | 3300005467 | Bacteria | 9529 |
| 149 | Ga0070706_100765192 | 3300005467 | Bacteria | 895 |
| 150 | Ga0070707_101217524 | 3300005468 | Bacteria | 719 |
| 151 | Ga0070684_100203830 | 3300005535 | Bacteria | 1802 |
| 152 | Ga0068853_100024762 | 3300005539 | Bacteria | 5035 |
| 153 | Ga0068853_100115482 | 3300005539 | Bacteria | 2389 |
| 154 | Ga0068853_100170844 | 3300005539 | Bacteria | 1967 |
| 155 | Ga0068853_100603924 | 3300005539 | Bacteria | 1042 |
| 156 | Ga0068853_101622124 | 3300005539 | Bacteria | 627 |
| 157 | Ga0070672_100013787 | 3300005543 | Bacteria | 5715 |
| 158 | Ga0070672_101234742 | 3300005543 | Bacteria | 666 |
| 159 | Ga0070695_100150446 | 3300005545 | Bacteria | 1624 |
| 160 | Ga0070696_100527259 | 3300005546 | Bacteria | 943 |
| 161 | Ga0070693_100101426 | 3300005547 | Bacteria | 1754 |
| 162 | Ga0068855_100445628 | 3300005563 | Bacteria | 1413 |
| 163 | Ga0068855_100540458 | 3300005563 | Bacteria | 1262 |
| 164 | Ga0068855_100830538 | 3300005563 | Bacteria | 980 |
| 165 | Ga0070664_100000004 | 3300005564 | Bacteria | 298075 |
| 166 | Ga0070664_100005230 | 3300005564 | Bacteria | 10411 |
| 167 | Ga0070664_100076910 | 3300005564 | Bacteria | 2869 |
| 168 | Ga0068857_100057826 | 3300005577 | Bacteria | 3442 |
| 169 | Ga0068857_100317346 | 3300005577 | Bacteria | 1439 |
| 170 | Ga0068857_100334396 | 3300005577 | Bacteria | 1400 |
| 171 | Ga0068857_100389899 | 3300005577 | Bacteria | 1295 |
| 172 | Ga0068857_101590763 | 3300005577 | Bacteria | 638 |
| 173 | Ga0068854_100000007 | 3300005578 | Bacteria | 182830 |
| 174 | Ga0068854_100376402 | 3300005578 | Bacteria | 1169 |
| 175 | Ga0068854_101469546 | 3300005578 | Bacteria | 618 |
| 176 | Ga0068856_100000105 | 3300005614 | Bacteria | 81780 |
| 177 | Ga0068856_100305768 | 3300005614 | Bacteria | 1608 |
| 178 | Ga0068856_100414966 | 3300005614 | Bacteria | 1366 |
| 179 | Ga0068856_100712190 | 3300005614 | Bacteria | 1024 |
| 180 | Ga0068856_101023881 | 3300005614 | Bacteria | 844 |
| 181 | Ga0068852_100013481 | 3300005616 | Bacteria | 6258 |
| 182 | Ga0068852_100017829 | 3300005616 | Bacteria | 5580 |
| 183 | Ga0068852_100018858 | 3300005616 | Bacteria | 5445 |
| 184 | Ga0068852_100068820 | 3300005616 | Bacteria | 3100 |
| 185 | Ga0068852_100142243 | 3300005616 | Bacteria | 2222 |
| 186 | Ga0068852_100168530 | 3300005616 | Bacteria | 2051 |
| 187 | Ga0068852_101425210 | 3300005616 | Bacteria | 715 |
| 188 | Ga0068859_100057856 | 3300005617 | Bacteria | 3905 |
| 189 | Ga0068859_100116942 | 3300005617 | Bacteria | 2731 |
| 190 | Ga0068859_100491199 | 3300005617 | Bacteria | 1323 |
| 191 | Ga0068859_100632211 | 3300005617 | Bacteria | 1163 |
| 192 | Ga0068864_100003727 | 3300005618 | Bacteria | 12581 |
| 193 | Ga0068864_100025373 | 3300005618 | Bacteria | 4990 |
| 194 | Ga0068861_100006842 | 3300005719 | Bacteria | 7785 |
| 195 | Ga0068861_101879197 | 3300005719 | Bacteria | 595 |
| 196 | Ga0068851_10080322 | 3300005834 | Bacteria | 1702 |
| 197 | Ga0068851_10121300 | 3300005834 | Bacteria | 1405 |
| 198 | Ga0068870_10001893 | 3300005840 | Bacteria | 8628 |
| 199 | Ga0068863_100048750 | 3300005841 | Bacteria | 4016 |
| 200 | Ga0068863_100085322 | 3300005841 | Bacteria | 2992 |
| 201 | Ga0068863_100086430 | 3300005841 | Bacteria | 2971 |
| 202 | Ga0068858_100011316 | 3300005842 | Bacteria | 8430 |
| 203 | Ga0068858_101576166 | 3300005842 | Bacteria | 648 |
| 204 | Ga0068860_100013006 | 3300005843 | Bacteria | 8172 |
| 205 | Ga0068860_100520270 | 3300005843 | Bacteria | 1190 |
| 206 | Ga0068862_100028341 | 3300005844 | Bacteria | 4715 |
| 207 | Ga0068862_100135585 | 3300005844 | Bacteria | 2181 |
| 208 | Ga0081539_10266234 | 3300005985 | Bacteria | 753 |
| 209 | Ga0075365_10001937 | 3300006038 | Bacteria | 9772 |
| 210 | Ga0075365_10149154 | 3300006038 | Bacteria | 1626 |
| 211 | Ga0075368_10001130 | 3300006042 | Bacteria | 8413 |
| 212 | Ga0075368_10204252 | 3300006042 | Bacteria | 836 |
| 213 | Ga0075368_10206456 | 3300006042 | Bacteria | 832 |
| 214 | Ga0075363_100020439 | 3300006048 | Bacteria | 3320 |
| 215 | Ga0075363_100185993 | 3300006048 | Bacteria | 1183 |
| 216 | Ga0075363_100209451 | 3300006048 | Bacteria | 1115 |
| 217 | Ga0075363_100615349 | 3300006048 | Bacteria | 651 |
| 218 | Ga0075364_10005448 | 3300006051 | Bacteria | 7393 |
| 219 | Ga0075364_10012743 | 3300006051 | Bacteria | 5156 |
| 220 | Ga0075432_10004475 | 3300006058 | Bacteria | 4765 |
| 221 | Ga0075362_10001157 | 3300006177 | Bacteria | 8246 |
| 222 | Ga0075362_10029335 | 3300006177 | Bacteria | 2370 |
| 223 | Ga0075367_10000488 | 3300006178 | Bacteria | 14852 |
| 224 | Ga0075367_10094701 | 3300006178 | Bacteria | 1820 |
| 225 | Ga0075367_10418751 | 3300006178 | Bacteria | 848 |
| 226 | Ga0075367_10572047 | 3300006178 | Bacteria | 718 |
| 227 | Ga0075369_10001709 | 3300006186 | Bacteria | 7598 |
| 228 | Ga0075366_10024831 | 3300006195 | Bacteria | 3496 |
| 229 | Ga0075366_10073998 | 3300006195 | Bacteria | 2031 |
| 230 | Ga0075366_10088640 | 3300006195 | Bacteria | 1853 |
| 231 | Ga0075366_10104313 | 3300006195 | Bacteria | 1703 |
| 232 | Ga0075366_10221684 | 3300006195 | Bacteria | 1152 |
| 233 | Ga0075366_10308888 | 3300006195 | Bacteria | 968 |
| 234 | Ga0097621_100363184 | 3300006237 | Bacteria | 1290 |
| 235 | Ga0075370_10000375 | 3300006353 | Bacteria | 16453 |
| 236 | Ga0075370_10000575 | 3300006353 | Bacteria | 14121 |
| 237 | Ga0075370_10023715 | 3300006353 | Bacteria | 3382 |
| 238 | Ga0075370_10039542 | 3300006353 | Bacteria | 2658 |
| 239 | Ga0075370_10060742 | 3300006353 | Bacteria | 2153 |
| 240 | Ga0068871_101061949 | 3300006358 | Bacteria | 756 |
| 241 | Ga0075428_100027331 | 3300006844 | Bacteria | 6314 |
| 242 | Ga0075431_101080908 | 3300006847 | Bacteria | 767 |
| 243 | Ga0075434_100283591 | 3300006871 | Bacteria | 1676 |
| 244 | Ga0097620_100057853 | 3300006931 | Bacteria | 3905 |
| 245 | Ga0097620_100116928 | 3300006931 | Bacteria | 2731 |
| 246 | Ga0097620_100491111 | 3300006931 | Bacteria | 1323 |
| 247 | Ga0097620_100632069 | 3300006931 | Bacteria | 1163 |
| 248 | Ga0079104_1038669 | 3300006946 | Bacteria | 1129 |
| 249 | Ga0075435_100833826 | 3300007076 | Bacteria | 803 |
| 250 | Ga0105251_10000005 | 3300009011 | Bacteria | 259226 |
| 251 | Ga0105251_10000427 | 3300009011 | Bacteria | 40852 |
| 252 | Ga0105251_10003188 | 3300009011 | Bacteria | 12129 |
| 253 | Ga0105244_10012387 | 3300009036 | Bacteria | 5040 |
| 254 | Ga0105244_10023604 | 3300009036 | Bacteria | 3369 |
| 255 | Ga0105244_10060514 | 3300009036 | Bacteria | 1907 |
| 256 | Ga0105244_10282175 | 3300009036 | Bacteria | 770 |
| 257 | Ga0105250_10030058 | 3300009092 | Bacteria | 2185 |
| 258 | Ga0105250_10192633 | 3300009092 | Bacteria | 858 |
| 259 | Ga0105240_10004916 | 3300009093 | Bacteria | 20092 |
| 260 | Ga0105240_10006257 | 3300009093 | Bacteria | 17511 |
| 261 | Ga0105240_10060318 | 3300009093 | Bacteria | 4729 |
| 262 | Ga0105240_10088421 | 3300009093 | Bacteria | 3790 |
| 263 | Ga0105240_10101797 | 3300009093 | Bacteria | 3492 |
| 264 | Ga0105240_10203394 | 3300009093 | Bacteria | 2319 |
| 265 | Ga0105240_10284603 | 3300009093 | Bacteria | 1898 |
| 266 | Ga0105240_11165314 | 3300009093 | Bacteria | 817 |
| 267 | Ga0105240_11214318 | 3300009093 | Bacteria | 798 |
| 268 | Ga0105240_11650691 | 3300009093 | Bacteria | 670 |
| 269 | Ga0105245_10014386 | 3300009098 | Bacteria | 6892 |
| 270 | Ga0105245_10374711 | 3300009098 | Bacteria | 1416 |
| 271 | Ga0105245_11123170 | 3300009098 | Bacteria | 833 |
| 272 | Ga0105247_10034404 | 3300009101 | Bacteria | 3085 |
| 273 | Ga0105243_10004528 | 3300009148 | Bacteria | 10982 |
| 274 | Ga0105243_10032819 | 3300009148 | Bacteria | 4013 |
| 275 | Ga0105243_10165120 | 3300009148 | Bacteria | 1913 |
| 276 | Ga0105241_10169198 | 3300009174 | Bacteria | 1803 |
| 277 | Ga0105242_10340120 | 3300009176 | Bacteria | 1383 |
| 278 | Ga0105242_10567469 | 3300009176 | Bacteria | 1091 |
| 279 | Ga0105248_10005602 | 3300009177 | Bacteria | 13799 |
| 280 | Ga0105248_10006219 | 3300009177 | Bacteria | 13091 |
| 281 | Ga0105248_10011634 | 3300009177 | Bacteria | 9694 |
| 282 | Ga0105248_10236846 | 3300009177 | Bacteria | 2055 |
| 283 | Ga0105248_10639287 | 3300009177 | Bacteria | 1200 |
| 284 | Ga0105248_11017885 | 3300009177 | Bacteria | 936 |
| 285 | Ga0105237_10015527 | 3300009545 | Bacteria | 7923 |
| 286 | Ga0105237_10017774 | 3300009545 | Bacteria | 7372 |
| 287 | Ga0105237_10141187 | 3300009545 | Bacteria | 2403 |
| 288 | Ga0105237_10159765 | 3300009545 | Bacteria | 2252 |
| 289 | Ga0105237_10377768 | 3300009545 | Bacteria | 1422 |
| 290 | Ga0105238_10014547 | 3300009551 | Bacteria | 7958 |
| 291 | Ga0105238_10051201 | 3300009551 | Bacteria | 4154 |
| 292 | Ga0105238_10056077 | 3300009551 | Bacteria | 3953 |
| 293 | Ga0105238_10671102 | 3300009551 | Bacteria | 1047 |
| 294 | Ga0105238_11101693 | 3300009551 | Bacteria | 817 |
| 295 | Ga0105238_11375308 | 3300009551 | Bacteria | 733 |
| 296 | Ga0105238_12195069 | 3300009551 | Bacteria | 587 |
| 297 | Ga0105249_10276877 | 3300009553 | Bacteria | 1674 |
| 298 | Ga0105239_10014021 | 3300010375 | Bacteria | 8898 |
| 299 | Ga0105239_10103451 | 3300010375 | Bacteria | 3152 |
| 300 | Ga0105239_10158456 | 3300010375 | Bacteria | 2528 |
| 301 | Ga0157347_1011112 | 3300012502 | Bacteria | 953 |
| 302 | Ga0157373_10004956 | 3300013100 | Bacteria | 10008 |
| 303 | Ga0157373_10015931 | 3300013100 | Bacteria | 5489 |
| 304 | Ga0157373_10025435 | 3300013100 | Bacteria | 4282 |
| 305 | Ga0157373_10261531 | 3300013100 | Bacteria | 1225 |
| 306 | Ga0157373_10711698 | 3300013100 | Bacteria | 736 |
| 307 | Ga0157371_10000086 | 3300013102 | Bacteria | 146397 |
| 308 | Ga0157371_10000223 | 3300013102 | Bacteria | 82671 |
| 309 | Ga0157371_10000986 | 3300013102 | Bacteria | 31519 |
| 310 | Ga0157371_10025877 | 3300013102 | Bacteria | 4270 |
| 311 | Ga0157371_10082692 | 3300013102 | Bacteria | 2273 |
| 312 | Ga0157371_10123211 | 3300013102 | Bacteria | 1843 |
| 313 | Ga0157371_10893380 | 3300013102 | Bacteria | 673 |
| 314 | Ga0157370_10000074 | 3300013104 | Bacteria | 108622 |
| 315 | Ga0157370_10042603 | 3300013104 | Bacteria | 4373 |
| 316 | Ga0157370_10059009 | 3300013104 | Bacteria | 3647 |
| 317 | Ga0157370_10113281 | 3300013104 | Bacteria | 2535 |
| 318 | Ga0157370_11509944 | 3300013104 | Bacteria | 604 |
| 319 | Ga0157369_10000383 | 3300013105 | Bacteria | 58625 |
| 320 | Ga0157369_10001241 | 3300013105 | Bacteria | 31779 |
| 321 | Ga0157369_10001440 | 3300013105 | Bacteria | 29208 |
| 322 | Ga0157369_10001863 | 3300013105 | Bacteria | 25417 |
| 323 | Ga0157369_10039961 | 3300013105 | Bacteria | 5124 |
| 324 | Ga0157369_10138605 | 3300013105 | Bacteria | 2574 |
| 325 | Ga0157369_10147744 | 3300013105 | Bacteria | 2485 |
| 326 | Ga0157369_10165598 | 3300013105 | Bacteria | 2332 |
| 327 | Ga0157369_10546899 | 3300013105 | Bacteria | 1197 |
| 328 | Ga0157374_10000116 | 3300013296 | Bacteria | 73468 |
| 329 | Ga0157374_10009373 | 3300013296 | Bacteria | 8399 |
| 330 | Ga0157374_10043751 | 3300013296 | Bacteria | 4138 |
| 331 | Ga0157374_10223274 | 3300013296 | Bacteria | 1849 |
| 332 | Ga0157378_10010746 | 3300013297 | Bacteria | 8001 |
| 333 | Ga0157378_10465018 | 3300013297 | Bacteria | 1258 |
| 334 | Ga0163162_10005148 | 3300013306 | Bacteria | 12599 |
| 335 | Ga0163162_10043604 | 3300013306 | Bacteria | 4492 |
| 336 | Ga0163162_10160493 | 3300013306 | Bacteria | 2370 |
| 337 | Ga0163162_10476825 | 3300013306 | Bacteria | 1379 |
| 338 | Ga0163162_11008243 | 3300013306 | Bacteria | 942 |
| 339 | Ga0157372_10000085 | 3300013307 | Bacteria | 96915 |
| 340 | Ga0157372_10012524 | 3300013307 | Bacteria | 9032 |
| 341 | Ga0157372_10166010 | 3300013307 | Bacteria | 2553 |
| 342 | Ga0157372_10312934 | 3300013307 | Bacteria | 1828 |
| 343 | Ga0157372_10516180 | 3300013307 | Bacteria | 1393 |
| 344 | Ga0157375_10007536 | 3300013308 | Bacteria | 9515 |
| 345 | Ga0157375_10194238 | 3300013308 | Bacteria | 2185 |
| 346 | Ga0163163_10128554 | 3300014325 | Bacteria | 2572 |
| 347 | Ga0163163_10574087 | 3300014325 | Bacteria | 1191 |
| 348 | Ga0157380_12314693 | 3300014326 | Bacteria | 602 |
| 349 | Ga0182008_10002465 | 3300014497 | Bacteria | 11584 |
| 350 | Ga0182008_10002632 | 3300014497 | Bacteria | 11135 |
| 351 | Ga0182008_10021729 | 3300014497 | Bacteria | 3295 |
| 352 | Ga0182008_10294901 | 3300014497 | Bacteria | 847 |
| 353 | Ga0157379_10021652 | 3300014968 | Bacteria | 5693 |
| 354 | Ga0157379_10074906 | 3300014968 | Bacteria | 3030 |
| 355 | Ga0182006_1000317 | 3300015261 | Bacteria | 42256 |
| 356 | Ga0182006_1002482 | 3300015261 | Bacteria | 10055 |
| 357 | Ga0182006_1004530 | 3300015261 | Bacteria | 6840 |
| 358 | Ga0182006_1006004 | 3300015261 | Bacteria | 5691 |
| 359 | Ga0182006_1007384 | 3300015261 | Bacteria | 5034 |
| 360 | Ga0182006_1018543 | 3300015261 | Bacteria | 2939 |
| 361 | Ga0182006_1020371 | 3300015261 | Bacteria | 2780 |
| 362 | Ga0182006_1091634 | 3300015261 | Bacteria | 1093 |
| 363 | Ga0182006_1204321 | 3300015261 | Bacteria | 654 |
| 364 | Ga0182007_10001059 | 3300015262 | Bacteria | 14995 |
| 365 | Ga0182007_10012055 | 3300015262 | Bacteria | 3338 |
| 366 | Ga0182007_10038048 | 3300015262 | Bacteria | 1614 |
| 367 | Ga0182005_1103388 | 3300015265 | Bacteria | 800 |
| 368 | Ga0182005_1118525 | 3300015265 | Bacteria | 752 |
| 369 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 370 | Ga0163161_10000657 | 3300017792 | Bacteria | 27646 |
| 371 | Ga0163161_11784556 | 3300017792 | Bacteria | 547 |
| 372 | Ga0154015_1180002 | 3300020610 | Bacteria | 31491 |
| 373 | Ga0213872_10003058 | 3300021361 | Bacteria | 9432 |
| 374 | Ga0209435_100010 | 3300025206 | Bacteria | 475373 |
| 375 | Ga0209435_101521 | 3300025206 | Bacteria | 2899 |
| 376 | Ga0209436_104404 | 3300025208 | Bacteria | 3489 |
| 377 | Ga0209784_100008 | 3300025224 | Bacteria | 740293 |
| 378 | Ga0209784_100829 | 3300025224 | Bacteria | 6984 |
| 379 | Ga0209784_101133 | 3300025224 | Bacteria | 4310 |
| 380 | Ga0209566_100006 | 3300025225 | Bacteria | 789272 |
| 381 | Ga0209566_100354 | 3300025225 | Bacteria | 39082 |
| 382 | Ga0209566_100567 | 3300025225 | Bacteria | 24190 |
| 383 | Ga0209566_104658 | 3300025225 | Bacteria | 1838 |
| 384 | Ga0209674_100025 | 3300025226 | Bacteria | 515942 |
| 385 | Ga0209674_100070 | 3300025226 | Bacteria | 242214 |
| 386 | Ga0209674_100093 | 3300025226 | Bacteria | 170423 |
| 387 | Ga0209674_100120 | 3300025226 | Bacteria | 134811 |
| 388 | Ga0209674_101148 | 3300025226 | Bacteria | 7661 |
| 389 | Ga0209672_100002 | 3300025228 | Bacteria | 1733325 |
| 390 | Ga0209672_100044 | 3300025228 | Bacteria | 270292 |
| 391 | Ga0209672_100075 | 3300025228 | Bacteria | 159275 |
| 392 | Ga0209672_100413 | 3300025228 | Bacteria | 25187 |
| 393 | Ga0209672_100982 | 3300025228 | Bacteria | 12586 |
| 394 | Ga0209672_101155 | 3300025228 | Bacteria | 10845 |
| 395 | Ga0209147_100003 | 3300025229 | Bacteria | 1733325 |
| 396 | Ga0209147_100005 | 3300025229 | Bacteria | 1036530 |
| 397 | Ga0209147_100039 | 3300025229 | Bacteria | 311101 |
| 398 | Ga0209147_100119 | 3300025229 | Bacteria | 142860 |
| 399 | Ga0209147_100176 | 3300025229 | Bacteria | 80329 |
| 400 | Ga0209147_101077 | 3300025229 | Bacteria | 11501 |
| 401 | Ga0209563_100016 | 3300025230 | Bacteria | 802091 |
| 402 | Ga0209563_101301 | 3300025230 | Bacteria | 6813 |
| 403 | Ga0209563_102708 | 3300025230 | Bacteria | 3895 |
| 404 | Ga0207427_100777 | 3300025231 | Bacteria | 14536 |
| 405 | Ga0209258_100005 | 3300025242 | Bacteria | 1087938 |
| 406 | Ga0209258_100007 | 3300025242 | Bacteria | 1036530 |
| 407 | Ga0209258_100062 | 3300025242 | Bacteria | 311101 |
| 408 | Ga0209258_100067 | 3300025242 | Bacteria | 287603 |
| 409 | Ga0209258_100153 | 3300025242 | Bacteria | 159275 |
| 410 | Ga0207425_1000434 | 3300025245 | Bacteria | 27651 |
| 411 | Ga0207425_1000908 | 3300025245 | Bacteria | 14229 |
| 412 | Ga0207425_1001023 | 3300025245 | Bacteria | 13062 |
| 413 | Ga0207425_1010792 | 3300025245 | Bacteria | 2208 |
| 414 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 415 | Ga0209646_1000016 | 3300025246 | Bacteria | 501688 |
| 416 | Ga0209646_1002708 | 3300025246 | Bacteria | 3782 |
| 417 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 418 | Ga0209026_1001651 | 3300025250 | Bacteria | 9453 |
| 419 | Ga0209677_100008 | 3300025253 | Bacteria | 802091 |
| 420 | Ga0209148_1000006 | 3300025254 | Bacteria | 1733325 |
| 421 | Ga0209148_1000051 | 3300025254 | Bacteria | 401000 |
| 422 | Ga0209148_1000067 | 3300025254 | Bacteria | 338678 |
| 423 | Ga0209148_1000075 | 3300025254 | Bacteria | 311101 |
| 424 | Ga0209148_1000728 | 3300025254 | Bacteria | 25777 |
| 425 | Ga0209148_1003409 | 3300025254 | Bacteria | 4417 |
| 426 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 427 | Ga0209759_1000002 | 3300025256 | Bacteria | 1027596 |
| 428 | Ga0209759_1000014 | 3300025256 | Bacteria | 396291 |
| 429 | Ga0209759_1000039 | 3300025256 | Bacteria | 256444 |
| 430 | Ga0209759_1001110 | 3300025256 | Bacteria | 17366 |
| 431 | Ga0209759_1002345 | 3300025256 | Bacteria | 8458 |
| 432 | Ga0209759_1006058 | 3300025256 | Bacteria | 4121 |
| 433 | Ga0209759_1019604 | 3300025256 | Bacteria | 1598 |
| 434 | Ga0209129_1000030 | 3300025258 | Bacteria | 391958 |
| 435 | Ga0209129_1019612 | 3300025258 | Bacteria | 1274 |
| 436 | Ga0209129_1031627 | 3300025258 | Bacteria | 880 |
| 437 | Ga0209233_1000018 | 3300025261 | Bacteria | 886857 |
| 438 | Ga0209233_1051508 | 3300025261 | Bacteria | 834 |
| 439 | Ga0209565_1000016 | 3300025263 | Bacteria | 477707 |
| 440 | Ga0209565_1000019 | 3300025263 | Bacteria | 438920 |
| 441 | Ga0209565_1001223 | 3300025263 | Bacteria | 12115 |
| 442 | Ga0209455_1000003 | 3300025272 | Bacteria | 1471893 |
| 443 | Ga0209455_1000011 | 3300025272 | Bacteria | 947242 |
| 444 | Ga0209455_1000067 | 3300025272 | Bacteria | 311101 |
| 445 | Ga0209455_1000221 | 3300025272 | Bacteria | 78847 |
| 446 | Ga0209673_1000066 | 3300025273 | Bacteria | 250037 |
| 447 | Ga0209673_1000073 | 3300025273 | Bacteria | 233645 |
| 448 | Ga0209673_1000095 | 3300025273 | Bacteria | 197466 |
| 449 | Ga0209673_1001044 | 3300025273 | Bacteria | 32181 |
| 450 | Ga0209130_1000011 | 3300025284 | Bacteria | 431723 |
| 451 | Ga0209130_1000141 | 3300025284 | Bacteria | 115378 |
| 452 | Ga0209130_1000210 | 3300025284 | Bacteria | 77155 |
| 453 | Ga0209130_1004492 | 3300025284 | Bacteria | 5270 |
| 454 | Ga0209130_1012453 | 3300025284 | Bacteria | 2224 |
| 455 | Ga0209675_1000031 | 3300025291 | Bacteria | 273599 |
| 456 | Ga0209675_1000356 | 3300025291 | Bacteria | 39400 |
| 457 | Ga0209675_1004844 | 3300025291 | Bacteria | 5831 |
| 458 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 459 | Ga0209676_1000123 | 3300025292 | Bacteria | 195351 |
| 460 | Ga0209676_1000165 | 3300025292 | Bacteria | 156709 |
| 461 | Ga0209676_1002917 | 3300025292 | Bacteria | 11181 |
| 462 | Ga0209676_1020438 | 3300025292 | Bacteria | 2249 |
| 463 | Ga0209025_1000078 | 3300025294 | Bacteria | 271683 |
| 464 | Ga0209025_1000319 | 3300025294 | Bacteria | 107011 |
| 465 | Ga0209025_1001554 | 3300025294 | Bacteria | 29174 |
| 466 | Ga0209025_1009510 | 3300025294 | Bacteria | 6754 |
| 467 | Ga0209564_1000056 | 3300025295 | Bacteria | 340873 |
| 468 | Ga0209564_1000099 | 3300025295 | Bacteria | 225256 |
| 469 | Ga0209564_1000165 | 3300025295 | Bacteria | 160244 |
| 470 | Ga0209564_1005057 | 3300025295 | Bacteria | 7704 |
| 471 | Ga0209564_1010599 | 3300025295 | Bacteria | 4223 |
| 472 | Ga0209758_1000037 | 3300025297 | Bacteria | 439101 |
| 473 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 474 | Ga0209050_1000084 | 3300025298 | Bacteria | 263245 |
| 475 | Ga0209050_1000188 | 3300025298 | Bacteria | 138865 |
| 476 | Ga0209050_1014814 | 3300025298 | Bacteria | 3327 |
| 477 | Ga0209256_1000022 | 3300025299 | Bacteria | 481843 |
| 478 | Ga0209256_1000043 | 3300025299 | Bacteria | 340873 |
| 479 | Ga0209256_1000110 | 3300025299 | Bacteria | 182312 |
| 480 | Ga0207426_1000029 | 3300025302 | Bacteria | 473835 |
| 481 | Ga0207426_1000103 | 3300025302 | Bacteria | 250320 |
| 482 | Ga0207426_1000145 | 3300025302 | Bacteria | 191065 |
| 483 | Ga0207426_1000260 | 3300025302 | Bacteria | 114246 |
| 484 | Ga0207426_1002451 | 3300025302 | Bacteria | 11822 |
| 485 | Ga0207426_1003898 | 3300025302 | Bacteria | 7678 |
| 486 | Ga0209051_1000036 | 3300025303 | Bacteria | 339863 |
| 487 | Ga0209051_1000058 | 3300025303 | Bacteria | 263137 |
| 488 | Ga0209051_1000091 | 3300025303 | Bacteria | 173683 |
| 489 | Ga0209051_1000494 | 3300025303 | Bacteria | 50941 |
| 490 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 491 | Ga0209257_1000057 | 3300025304 | Bacteria | 396985 |
| 492 | Ga0209257_1000092 | 3300025304 | Bacteria | 263137 |
| 493 | Ga0207697_10041147 | 3300025315 | Bacteria | 1898 |
| 494 | Ga0207656_10008463 | 3300025321 | Bacteria | 3790 |
| 495 | Ga0207656_10046457 | 3300025321 | Bacteria | 1863 |
| 496 | Ga0207696_1054182 | 3300025711 | Bacteria | 1140 |
| 497 | Ga0207655_1001871 | 3300025728 | Bacteria | 18120 |
| 498 | Ga0207655_1023574 | 3300025728 | Bacteria | 3047 |
| 499 | Ga0207655_1030654 | 3300025728 | Bacteria | 2497 |
| 500 | Ga0207713_1000036 | 3300025735 | Bacteria | 259717 |
| 501 | Ga0207713_1002789 | 3300025735 | Bacteria | 12345 |
| 502 | Ga0207713_1007353 | 3300025735 | Bacteria | 6515 |
| 503 | Ga0207713_1052813 | 3300025735 | Bacteria | 1606 |
| 504 | Ga0207680_10060019 | 3300025903 | Bacteria | 2313 |
| 505 | Ga0207680_10061690 | 3300025903 | Bacteria | 2287 |
| 506 | Ga0207680_10164462 | 3300025903 | Bacteria | 1490 |
| 507 | Ga0207647_10009559 | 3300025904 | Bacteria | 6883 |
| 508 | Ga0207647_10011061 | 3300025904 | Bacteria | 6345 |
| 509 | Ga0207647_10014440 | 3300025904 | Bacteria | 5444 |
| 510 | Ga0207647_10042812 | 3300025904 | Bacteria | 2837 |
| 511 | Ga0207647_10200988 | 3300025904 | Bacteria | 1153 |
| 512 | Ga0207647_10501517 | 3300025904 | Bacteria | 677 |
| 513 | Ga0207645_10031101 | 3300025907 | Bacteria | 3436 |
| 514 | Ga0207645_10143331 | 3300025907 | Bacteria | 1557 |
| 515 | Ga0207643_10195687 | 3300025908 | Bacteria | 1229 |
| 516 | Ga0207705_10084916 | 3300025909 | Bacteria | 2312 |
| 517 | Ga0207705_10107081 | 3300025909 | Bacteria | 2062 |
| 518 | Ga0207705_10202607 | 3300025909 | Bacteria | 1504 |
| 519 | Ga0207684_10609822 | 3300025910 | Bacteria | 932 |
| 520 | Ga0207654_10454470 | 3300025911 | Bacteria | 898 |
| 521 | Ga0207695_10003008 | 3300025913 | Bacteria | 24230 |
| 522 | Ga0207695_10003114 | 3300025913 | Bacteria | 23727 |
| 523 | Ga0207695_10014899 | 3300025913 | Bacteria | 9177 |
| 524 | Ga0207695_10032225 | 3300025913 | Bacteria | 5738 |
| 525 | Ga0207695_10159983 | 3300025913 | Bacteria | 2184 |
| 526 | Ga0207695_10333238 | 3300025913 | Bacteria | 1406 |
| 527 | Ga0207695_10400404 | 3300025913 | Bacteria | 1257 |
| 528 | Ga0207695_10595466 | 3300025913 | Bacteria | 987 |
| 529 | Ga0207695_10614241 | 3300025913 | Bacteria | 968 |
| 530 | Ga0207695_10892025 | 3300025913 | Bacteria | 769 |
| 531 | Ga0207671_10043088 | 3300025914 | Bacteria | 3337 |
| 532 | Ga0207671_10065133 | 3300025914 | Bacteria | 2710 |
| 533 | Ga0207671_10068770 | 3300025914 | Bacteria | 2639 |
| 534 | Ga0207671_10343119 | 3300025914 | Bacteria | 1183 |
| 535 | Ga0207657_10000072 | 3300025919 | Bacteria | 93655 |
| 536 | Ga0207657_10000389 | 3300025919 | Bacteria | 46345 |
| 537 | Ga0207657_10319697 | 3300025919 | Bacteria | 1227 |
| 538 | Ga0207657_10985322 | 3300025919 | Bacteria | 647 |
| 539 | Ga0207649_10001426 | 3300025920 | Bacteria | 14134 |
| 540 | Ga0207646_10715054 | 3300025922 | Bacteria | 895 |
| 541 | Ga0207646_11175496 | 3300025922 | Bacteria | 673 |
| 542 | Ga0207681_10033213 | 3300025923 | Bacteria | 3381 |
| 543 | Ga0207681_10139559 | 3300025923 | Bacteria | 1803 |
| 544 | Ga0207694_10047952 | 3300025924 | Bacteria | 3304 |
| 545 | Ga0207694_10152653 | 3300025924 | Bacteria | 1861 |
| 546 | Ga0207694_10677670 | 3300025924 | Bacteria | 869 |
| 547 | Ga0207694_10795689 | 3300025924 | Bacteria | 799 |
| 548 | Ga0207694_10797322 | 3300025924 | Bacteria | 798 |
| 549 | Ga0207694_10951144 | 3300025924 | Bacteria | 727 |
| 550 | Ga0207650_10005387 | 3300025925 | Bacteria | 8727 |
| 551 | Ga0207650_10007014 | 3300025925 | Bacteria | 7686 |
| 552 | Ga0207650_10088595 | 3300025925 | Bacteria | 2360 |
| 553 | Ga0207650_10201358 | 3300025925 | Bacteria | 1595 |
| 554 | Ga0207687_10012072 | 3300025927 | Bacteria | 5649 |
| 555 | Ga0207644_10007558 | 3300025931 | Bacteria | 7085 |
| 556 | Ga0207644_10351277 | 3300025931 | Bacteria | 1197 |
| 557 | Ga0207644_11125769 | 3300025931 | Bacteria | 660 |
| 558 | Ga0207690_10000019 | 3300025932 | Bacteria | 235380 |
| 559 | Ga0207690_10000722 | 3300025932 | Bacteria | 21290 |
| 560 | Ga0207690_10064824 | 3300025932 | Bacteria | 2496 |
| 561 | Ga0207690_10095002 | 3300025932 | Bacteria | 2117 |
| 562 | Ga0207706_10311127 | 3300025933 | Bacteria | 1371 |
| 563 | Ga0207706_10506764 | 3300025933 | Bacteria | 1041 |
| 564 | Ga0207706_10534820 | 3300025933 | Bacteria | 1010 |
| 565 | Ga0207686_10277216 | 3300025934 | Bacteria | 1236 |
| 566 | Ga0207709_10001089 | 3300025935 | Bacteria | 19893 |
| 567 | Ga0207709_10012585 | 3300025935 | Bacteria | 4662 |
| 568 | Ga0207669_10312672 | 3300025937 | Bacteria | 1199 |
| 569 | Ga0207704_11108880 | 3300025938 | Bacteria | 673 |
| 570 | Ga0207691_10071487 | 3300025940 | Bacteria | 3131 |
| 571 | Ga0207691_10423659 | 3300025940 | Bacteria | 1134 |
| 572 | Ga0207711_10012168 | 3300025941 | Bacteria | 7152 |
| 573 | Ga0207711_10015519 | 3300025941 | Bacteria | 6322 |
| 574 | Ga0207711_10397875 | 3300025941 | Bacteria | 1280 |
| 575 | Ga0207689_10000556 | 3300025942 | Bacteria | 35605 |
| 576 | Ga0207689_10091608 | 3300025942 | Bacteria | 2497 |
| 577 | Ga0207689_10271241 | 3300025942 | Bacteria | 1405 |
| 578 | Ga0207679_10000002 | 3300025945 | Bacteria | 634491 |
| 579 | Ga0207679_10026449 | 3300025945 | Bacteria | 4001 |
| 580 | Ga0207679_10073814 | 3300025945 | Bacteria | 2583 |
| 581 | Ga0207667_10038803 | 3300025949 | Bacteria | 5080 |
| 582 | Ga0207667_10066718 | 3300025949 | Bacteria | 3750 |
| 583 | Ga0207667_10866813 | 3300025949 | Bacteria | 896 |
| 584 | Ga0207668_10016062 | 3300025972 | Bacteria | 4664 |
| 585 | Ga0207668_10017548 | 3300025972 | Bacteria | 4486 |
| 586 | Ga0207640_10000101 | 3300025981 | Bacteria | 66091 |
| 587 | Ga0207640_10573321 | 3300025981 | Bacteria | 952 |
| 588 | Ga0207658_10006734 | 3300025986 | Bacteria | 7821 |
| 589 | Ga0207658_10112736 | 3300025986 | Bacteria | 2153 |
| 590 | Ga0207658_10661784 | 3300025986 | Bacteria | 942 |
| 591 | Ga0207677_10010768 | 3300026023 | Bacteria | 5185 |
| 592 | Ga0207677_11861798 | 3300026023 | Bacteria | 559 |
| 593 | Ga0207703_10005102 | 3300026035 | Bacteria | 10621 |
| 594 | Ga0207703_10876535 | 3300026035 | Bacteria | 859 |
| 595 | Ga0207639_10022579 | 3300026041 | Bacteria | 4533 |
| 596 | Ga0207639_10427501 | 3300026041 | Bacteria | 1199 |
| 597 | Ga0207678_10000003 | 3300026067 | Bacteria | 282716 |
| 598 | Ga0207678_10030675 | 3300026067 | Bacteria | 4694 |
| 599 | Ga0207678_10095757 | 3300026067 | Bacteria | 2537 |
| 600 | Ga0207678_10358986 | 3300026067 | Bacteria | 1257 |
| 601 | Ga0207678_10370686 | 3300026067 | Bacteria | 1237 |
| 602 | Ga0207678_10420443 | 3300026067 | Bacteria | 1159 |
| 603 | Ga0207702_10000010 | 3300026078 | Bacteria | 292789 |
| 604 | Ga0207702_10458938 | 3300026078 | Bacteria | 1237 |
| 605 | Ga0207702_10581841 | 3300026078 | Bacteria | 1097 |
| 606 | Ga0207702_10957693 | 3300026078 | Bacteria | 849 |
| 607 | Ga0207641_10050978 | 3300026088 | Bacteria | 3504 |
| 608 | Ga0207641_10067199 | 3300026088 | Bacteria | 3070 |
| 609 | Ga0207641_10420959 | 3300026088 | Bacteria | 1286 |
| 610 | Ga0207648_10100100 | 3300026089 | Bacteria | 2539 |
| 611 | Ga0207648_10194167 | 3300026089 | Bacteria | 1800 |
| 612 | Ga0207648_10232950 | 3300026089 | Bacteria | 1638 |
| 613 | Ga0207648_10673350 | 3300026089 | Bacteria | 957 |
| 614 | Ga0207676_10004509 | 3300026095 | Bacteria | 9848 |
| 615 | Ga0207676_10237638 | 3300026095 | Bacteria | 1632 |
| 616 | Ga0207676_10495173 | 3300026095 | Bacteria | 1160 |
| 617 | Ga0207674_10029272 | 3300026116 | Bacteria | 5799 |
| 618 | Ga0207674_10245152 | 3300026116 | Bacteria | 1739 |
| 619 | Ga0207674_10409664 | 3300026116 | Bacteria | 1310 |
| 620 | Ga0207674_10616490 | 3300026116 | Bacteria | 1048 |
| 621 | Ga0207675_100000530 | 3300026118 | Bacteria | 37109 |
| 622 | Ga0207675_100282899 | 3300026118 | Bacteria | 1612 |
| 623 | Ga0207698_10048515 | 3300026142 | Bacteria | 3225 |
| 624 | Ga0207698_10057456 | 3300026142 | Bacteria | 3011 |
| 625 | Ga0207698_10144329 | 3300026142 | Bacteria | 2056 |
| 626 | Ga0207698_10185212 | 3300026142 | Bacteria | 1848 |
| 627 | Ga0207698_10313260 | 3300026142 | Bacteria | 1466 |
| 628 | Ga0207698_10323557 | 3300026142 | Bacteria | 1445 |
| 629 | Ga0209371_1000095 | 3300027312 | Bacteria | 166175 |
| 630 | Ga0209371_1000211 | 3300027312 | Bacteria | 81758 |
| 631 | Ga0209371_1011309 | 3300027312 | Bacteria | 2660 |
| 632 | Ga0209813_10003543 | 3300027866 | Bacteria | 3661 |
| 633 | Ga0209813_10089423 | 3300027866 | Bacteria | 1031 |
| 634 | Ga0209813_10147751 | 3300027866 | Bacteria | 839 |
| 635 | Ga0207428_10093489 | 3300027907 | Bacteria | 2332 |
| 636 | Ga0268266_11486230 | 3300028379 | Bacteria | 653 |
| 637 | Ga0268265_10003468 | 3300028380 | Bacteria | 11334 |
| 638 | Ga0268265_10024384 | 3300028380 | Bacteria | 4278 |
| 639 | Ga0268265_11730424 | 3300028380 | Bacteria | 631 |
| 640 | Ga0268264_10001980 | 3300028381 | Bacteria | 18431 |
| 641 | Ga0307515_10610861 | 3300028794 | Bacteria | 701 |
| 642 | Ga0268256_1000116 | 3300030500 | Bacteria | 115451 |
| 643 | Ga0268256_1000319 | 3300030500 | Bacteria | 47885 |
| 644 | Ga0268256_1012649 | 3300030500 | Bacteria | 2597 |
| 645 | Ga0307408_100000926 | 3300031548 | Bacteria | 22869 |
| 646 | Ga0307408_100010117 | 3300031548 | Bacteria | 6218 |
| 647 | Ga0307408_100010914 | 3300031548 | Bacteria | 5996 |
| 648 | Ga0307408_100017628 | 3300031548 | Bacteria | 4781 |
| 649 | Ga0307408_100072377 | 3300031548 | Bacteria | 2551 |
| 650 | Ga0307408_100884878 | 3300031548 | Bacteria | 816 |
| 651 | Ga0307514_10017303 | 3300031649 | Bacteria | 5933 |
| 652 | Ga0307516_10923911 | 3300031730 | Bacteria | 540 |
| 653 | Ga0307405_10001796 | 3300031731 | Bacteria | 9182 |
| 654 | Ga0307405_10180755 | 3300031731 | Bacteria | 1514 |
| 655 | Ga0307413_10193441 | 3300031824 | Bacteria | 1462 |
| 656 | Ga0307413_10867135 | 3300031824 | Bacteria | 764 |
| 657 | Ga0307410_10033029 | 3300031852 | Bacteria | 3337 |
| 658 | Ga0307406_10000530 | 3300031901 | Bacteria | 21943 |
| 659 | Ga0307406_10001271 | 3300031901 | Bacteria | 14130 |
| 660 | Ga0307406_10004428 | 3300031901 | Bacteria | 7643 |
| 661 | Ga0307407_10050490 | 3300031903 | Bacteria | 2380 |
| 662 | Ga0307407_10090915 | 3300031903 | Bacteria | 1870 |
| 663 | Ga0307412_10019028 | 3300031911 | Bacteria | 4147 |
| 664 | Ga0307412_10047156 | 3300031911 | Bacteria | 2828 |
| 665 | Ga0307412_10135786 | 3300031911 | Bacteria | 1794 |
| 666 | Ga0307412_10460129 | 3300031911 | Bacteria | 1050 |
| 667 | Ga0307409_100016120 | 3300031995 | Bacteria | 4933 |
| 668 | Ga0307416_100010204 | 3300032002 | Bacteria | 6193 |
| 669 | Ga0307416_100010649 | 3300032002 | Bacteria | 6089 |
| 670 | Ga0307416_100351229 | 3300032002 | Bacteria | 1492 |
| 671 | Ga0307414_10043576 | 3300032004 | Bacteria | 3058 |
| 672 | Ga0307414_10102929 | 3300032004 | Bacteria | 2153 |
| 673 | Ga0307414_10293112 | 3300032004 | Bacteria | 1372 |
| 674 | Ga0307411_10001196 | 3300032005 | Bacteria | 10269 |
| 675 | Ga0307415_100008780 | 3300032126 | Bacteria | 5624 |
| 676 | Ga0373948_0053336 | 3300034817 | Bacteria | 873 |
| 677 | Ga0395899_0000035 | 3300037312 | Bacteria | 295584 |
| 678 | Ga0395899_0097458 | 3300037312 | Bacteria | 2126 |
| 679 | Ga0395899_0309102 | 3300037312 | Bacteria | 1068 |
| 680 | Ga0395900_0000113 | 3300037418 | Bacteria | 139979 |
| 681 | Ga0395900_0003027 | 3300037418 | Bacteria | 18294 |
| 682 | Ga0395900_0017077 | 3300037418 | Bacteria | 7408 |
| 683 | Ga0395900_0039514 | 3300037418 | Bacteria | 4862 |
| 684 | Ga0395900_0078296 | 3300037418 | Bacteria | 3397 |
| 685 | Ga0395900_0087484 | 3300037418 | Bacteria | 3202 |
| 686 | Ga0395900_0402185 | 3300037418 | Bacteria | 1333 |
| 687 | Ga0395898_0000254 | 3300037466 | Bacteria | 131247 |
| 688 | Ga0395898_0000444 | 3300037466 | Bacteria | 85520 |
| 689 | Ga0395898_0002993 | 3300037466 | Bacteria | 19184 |
| 690 | Ga0395898_0188758 | 3300037466 | Bacteria | 1969 |
| 691 | Ga0395898_0377900 | 3300037466 | Bacteria | 1351 |
| 692 | Ga0395905_0197938 | 3300037471 | Bacteria | 1884 |
| 693 | Ga0395905_0198135 | 3300037471 | Bacteria | 1883 |
| 694 | Ga0395905_1115185 | 3300037471 | Bacteria | 692 |
| 695 | Ga0395901_0000009 | 3300038443 | Bacteria | 479396 |
| 696 | Ga0395901_0000302 | 3300038443 | Bacteria | 61152 |
| 697 | Ga0395901_0026100 | 3300038443 | Bacteria | 5998 |
| 698 | Ga0395901_0032650 | 3300038443 | Bacteria | 5369 |
| 699 | Ga0395901_0144831 | 3300038443 | Bacteria | 2498 |
| 700 | Ga0395901_0308651 | 3300038443 | Bacteria | 1639 |
| 701 | Ga0436361_0834992 | 3300039447 | Bacteria | 23798 |
| 702 | Ga0439436_0002289 | 3300041404 | Bacteria | 5737 |
| 703 | Ga0439438_043902 | 3300041405 | Bacteria | 1153 |
| 704 | Ga0439439_0008993 | 3300041406 | Bacteria | 2368 |
| 705 | Ga0439439_0049299 | 3300041406 | Bacteria | 1102 |
| 706 | Ga0439466_0081898 | 3300041411 | Bacteria | 1017 |
| 707 | Ga0439466_0107144 | 3300041411 | Bacteria | 868 |
| 708 | Ga0439431_0016108 | 3300041997 | Bacteria | 1746 |
| 709 | Ga0439448_0170772 | 3300042005 | Bacteria | 758 |
| 710 | Ga0439432_020286 | 3300042006 | Bacteria | 2211 |
| 711 | Ga0439449_0000091 | 3300042007 | Bacteria | 29348 |
| 712 | Ga0439449_0001822 | 3300042007 | Bacteria | 8383 |
| 713 | Ga0439452_043402 | 3300042010 | Bacteria | 1052 |
| 714 | Ga0439462_0001751 | 3300042015 | Bacteria | 4909 |
| 715 | Ga0439462_0002942 | 3300042015 | Bacteria | 4035 |
| 716 | Ga0439462_0063207 | 3300042015 | Bacteria | 1002 |
| 717 | Ga0439462_0136483 | 3300042015 | Bacteria | 686 |
| 718 | Ga0450911_000225 | 3300042115 | Bacteria | 21810 |
| 719 | Ga0450911_014977 | 3300042115 | Bacteria | 1028 |
| 720 | Ga0450920_006489 | 3300042122 | Bacteria | 2106 |
| 721 | Ga0450923_007891 | 3300042125 | Bacteria | 1816 |
| 722 | Ga0450923_026559 | 3300042125 | Bacteria | 1160 |
| 723 | Ga0450897_019183 | 3300042128 | Bacteria | 722 |
| 724 | Ga0450891_009863 | 3300042129 | Bacteria | 880 |
| 725 | Ga0450894_006910 | 3300042131 | Bacteria | 1462 |
| 726 | Ga0450898_049360 | 3300042134 | Bacteria | 811 |
| 727 | Ga0450902_051631 | 3300042137 | Bacteria | 706 |
| 728 | Ga0450903_011050 | 3300042138 | Bacteria | 1457 |
| 729 | Ga0450906_035608 | 3300042145 | Bacteria | 878 |
| 730 | Ga0439446_0004975 | 3300042156 | Bacteria | 3398 |
| 731 | Ga0439446_0020533 | 3300042156 | Bacteria | 1862 |
| 732 | Ga0439446_0074031 | 3300042156 | Bacteria | 1046 |
| 733 | Ga0439458_0089039 | 3300042157 | Bacteria | 793 |
| 734 | Ga0439458_0172519 | 3300042157 | Bacteria | 585 |
| 735 | Ga0450909_005967 | 3300042185 | Bacteria | 1759 |
| 736 | Ga0439434_0015977 | 3300042435 | Bacteria | 2241 |
| 737 | Ga0439434_0074192 | 3300042435 | Bacteria | 1074 |
| 738 | Ga0439435_0033244 | 3300042436 | Bacteria | 1411 |
| 739 | Ga0439435_0121905 | 3300042436 | Bacteria | 817 |
| 740 | Ga0439459_0021413 | 3300042438 | Bacteria | 1241 |
| 741 | Ga0439459_0174293 | 3300042438 | Bacteria | 575 |
| 742 | Ga0439464_0007334 | 3300042439 | Bacteria | 2882 |
| 743 | Ga0439464_0161633 | 3300042439 | Bacteria | 704 |
| 744 | Ga0439464_0251902 | 3300042439 | Bacteria | 570 |
| 745 | Ga0450893_0032267 | 3300042532 | Bacteria | 937 |
| 746 | Ga0451577_0984295 | 3300042876 | Bacteria | 758 |
| 747 | Ga0466986_0231794 | 3300044650 | Bacteria | 1192 |
| 748 | Ga0466969_0001266 | 3300044656 | Bacteria | 13617 |
| 749 | Ga0466969_0058166 | 3300044656 | Bacteria | 1882 |
| 750 | Ga0466969_0257838 | 3300044656 | Bacteria | 790 |
| 751 | Ga0466972_0001179 | 3300044658 | Bacteria | 12540 |
| 752 | Ga0466982_0564883 | 3300044672 | Bacteria | 572 |
| 753 | Ga0466965_0047726 | 3300044683 | Bacteria | 2120 |
| 754 | Ga0466966_0000043 | 3300044684 | Bacteria | 93998 |
| 755 | Ga0466966_0000309 | 3300044684 | Bacteria | 31554 |
| 756 | Ga0466966_0029640 | 3300044684 | Bacteria | 3558 |
| 757 | Ga0466966_0069877 | 3300044684 | Bacteria | 2202 |
| 758 | Ga0466966_0209084 | 3300044684 | Bacteria | 1179 |
| 759 | Ga0466961_0000026 | 3300044693 | Bacteria | 92667 |
| 760 | Ga0466961_0000383 | 3300044693 | Bacteria | 28540 |
| 761 | Ga0466961_0001377 | 3300044693 | Bacteria | 15025 |
| 762 | Ga0466961_0014187 | 3300044693 | Bacteria | 5113 |
| 763 | Ga0466961_0126232 | 3300044693 | Bacteria | 1605 |
| 764 | Ga0466963_0000484 | 3300044694 | Bacteria | 18542 |
| 765 | Ga0466963_0031544 | 3300044694 | Bacteria | 3427 |
| 766 | Ga0466964_0233160 | 3300044706 | Bacteria | 899 |
| 767 | Ga0466971_0005125 | 3300044719 | Bacteria | 5675 |
| 768 | Ga0466971_0008279 | 3300044719 | Bacteria | 4536 |
| 769 | Ga0466971_0020938 | 3300044719 | Bacteria | 2907 |
| 770 | Ga0466971_0023300 | 3300044719 | Bacteria | 2759 |
| 771 | Ga0466970_0000060 | 3300044765 | Bacteria | 42753 |
| 772 | Ga0466970_0006300 | 3300044765 | Bacteria | 5926 |
| 773 | Ga0466970_0156797 | 3300044765 | Bacteria | 1258 |
| 774 | Ga0466957_0003198 | 3300044842 | Bacteria | 8950 |
| 775 | Ga0466957_0006531 | 3300044842 | Bacteria | 6586 |
| 776 | Ga0466957_0044637 | 3300044842 | Bacteria | 2686 |
| 777 | Ga0466957_0458910 | 3300044842 | Bacteria | 879 |
| 778 | Ga0466959_0000129 | 3300045049 | Bacteria | 48753 |
| 779 | Ga0466959_0013198 | 3300045049 | Bacteria | 5985 |
| 780 | Ga0466959_0013429 | 3300045049 | Bacteria | 5935 |
| 781 | Ga0466959_0114717 | 3300045049 | Bacteria | 1919 |
| 782 | Ga0466959_0551113 | 3300045049 | Bacteria | 778 |
| 783 | Ga0451576_0086095 | 3300045051 | Bacteria | 3268 |
| 784 | Ga0466958_0003437 | 3300045836 | Bacteria | 8217 |
| 785 | Ga0466958_0030082 | 3300045836 | Bacteria | 3222 |
| 786 | Ga0466958_0228778 | 3300045836 | Bacteria | 1187 |
| 787 | Ga0466967_0002547 | 3300045976 | Bacteria | 11424 |
| 788 | Ga0466967_0103605 | 3300045976 | Bacteria | 2604 |
| 789 | Ga0466967_0730741 | 3300045976 | Bacteria | 981 |
| 790 | Ga0495592_0087784 | 3300046454 | Bacteria | 2236 |
| 791 | Ga0495603_0006343 | 3300046455 | Bacteria | 7074 |
| 792 | Ga0495603_0041414 | 3300046455 | Bacteria | 2754 |
| 793 | Ga0495603_0313690 | 3300046455 | Bacteria | 900 |
| 794 | Ga0495590_0001136 | 3300046457 | Bacteria | 11652 |
| 795 | Ga0495590_0001242 | 3300046457 | Bacteria | 11107 |
| 796 | Ga0495591_121300 | 3300046458 | Bacteria | 638 |
| 797 | Ga0495629_0000517 | 3300046459 | Bacteria | 32307 |
| 798 | Ga0495629_0000586 | 3300046459 | Bacteria | 29559 |
| 799 | Ga0495629_0001679 | 3300046459 | Bacteria | 17381 |
| 800 | Ga0495629_0060857 | 3300046459 | Bacteria | 2638 |
| 801 | Ga0495629_0429509 | 3300046459 | Bacteria | 896 |
| 802 | Ga0495629_0552036 | 3300046459 | Bacteria | 773 |
| 803 | Ga0495638_0006568 | 3300046460 | Bacteria | 8458 |
| 804 | Ga0495641_0012345 | 3300046461 | Bacteria | 4787 |
| 805 | Ga0495651_0013214 | 3300046462 | Bacteria | 6383 |
| 806 | Ga0495653_0032148 | 3300046463 | Bacteria | 4169 |
| 807 | Ga0495653_0064837 | 3300046463 | Bacteria | 2751 |
| 808 | Ga0495653_0110614 | 3300046463 | Bacteria | 1974 |
| 809 | Ga0495653_0145368 | 3300046463 | Bacteria | 1662 |
| 810 | Ga0495653_0154177 | 3300046463 | Bacteria | 1602 |
| 811 | Ga0495650_0011835 | 3300046471 | Bacteria | 4739 |
| 812 | Ga0495650_0060376 | 3300046471 | Bacteria | 1523 |
| 813 | Ga0495580_0000142 | 3300046472 | Bacteria | 51382 |
| 814 | Ga0495580_0000495 | 3300046472 | Bacteria | 32967 |
| 815 | Ga0495580_0007425 | 3300046472 | Bacteria | 8811 |
| 816 | Ga0495580_0034264 | 3300046472 | Bacteria | 3656 |
| 817 | Ga0495580_0099569 | 3300046472 | Bacteria | 2022 |
| 818 | Ga0495580_0141534 | 3300046472 | Bacteria | 1667 |
| 819 | Ga0495580_0201356 | 3300046472 | Bacteria | 1371 |
| 820 | Ga0495580_0245885 | 3300046472 | Bacteria | 1225 |
| 821 | Ga0495580_0290474 | 3300046472 | Bacteria | 1114 |
| 822 | Ga0495582_0015769 | 3300046473 | Bacteria | 4144 |
| 823 | Ga0495582_0019877 | 3300046473 | Bacteria | 3673 |
| 824 | Ga0495582_0114894 | 3300046473 | Bacteria | 1513 |
| 825 | Ga0495605_0085722 | 3300046474 | Bacteria | 1466 |
| 826 | Ga0495662_0048379 | 3300046476 | Bacteria | 2053 |
| 827 | Ga0495664_0000149 | 3300046477 | Bacteria | 35104 |
| 828 | Ga0495664_0006570 | 3300046477 | Bacteria | 6426 |
| 829 | Ga0495664_0013453 | 3300046477 | Bacteria | 4640 |
| 830 | Ga0495664_0624366 | 3300046477 | Bacteria | 639 |
| 831 | Ga0495596_0030259 | 3300046500 | Bacteria | 2168 |
| 832 | Ga0495596_0180299 | 3300046500 | Bacteria | 821 |
| 833 | Ga0495607_0325571 | 3300046501 | Bacteria | 716 |
| 834 | Ga0495583_0002966 | 3300046506 | Bacteria | 13618 |
| 835 | Ga0495583_0040051 | 3300046506 | Bacteria | 2203 |
| 836 | Ga0495606_0008201 | 3300046507 | Bacteria | 9138 |
| 837 | Ga0495606_0055462 | 3300046507 | Bacteria | 2563 |
| 838 | Ga0495606_0062041 | 3300046507 | Bacteria | 2388 |
| 839 | Ga0495610_0014119 | 3300046512 | Bacteria | 4711 |
| 840 | Ga0495616_0002706 | 3300046513 | Bacteria | 11619 |
| 841 | Ga0495616_0083202 | 3300046513 | Bacteria | 1527 |
| 842 | Ga0495618_0012638 | 3300046514 | Bacteria | 5128 |
| 843 | Ga0495618_0075319 | 3300046514 | Bacteria | 2149 |
| 844 | Ga0495620_0007723 | 3300046515 | Bacteria | 5812 |
| 845 | Ga0495628_0019740 | 3300046516 | Bacteria | 5568 |
| 846 | Ga0495628_0032491 | 3300046516 | Bacteria | 4213 |
| 847 | Ga0495628_0047551 | 3300046516 | Bacteria | 3403 |
| 848 | Ga0495628_0122346 | 3300046516 | Bacteria | 1995 |
| 849 | Ga0495628_0162264 | 3300046516 | Bacteria | 1698 |
| 850 | Ga0495628_0288253 | 3300046516 | Bacteria | 1217 |
| 851 | Ga0495628_0535227 | 3300046516 | Bacteria | 842 |
| 852 | Ga0495630_0020639 | 3300046517 | Bacteria | 4858 |
| 853 | Ga0495630_0028929 | 3300046517 | Bacteria | 4118 |
| 854 | Ga0495630_0083495 | 3300046517 | Bacteria | 2411 |
| 855 | Ga0495630_0733761 | 3300046517 | Bacteria | 755 |
| 856 | Ga0495631_0000007 | 3300046518 | Bacteria | 130158 |
| 857 | Ga0495637_0155607 | 3300046520 | Bacteria | 860 |
| 858 | Ga0495643_0000261 | 3300046522 | Bacteria | 77011 |
| 859 | Ga0495648_0003737 | 3300046524 | Bacteria | 13267 |
| 860 | Ga0495648_0007144 | 3300046524 | Bacteria | 8978 |
| 861 | Ga0495648_0007593 | 3300046524 | Bacteria | 8660 |
| 862 | Ga0495648_0024057 | 3300046524 | Bacteria | 4157 |
| 863 | Ga0495648_0094444 | 3300046524 | Bacteria | 1665 |
| 864 | Ga0495648_0389674 | 3300046524 | Bacteria | 626 |
| 865 | Ga0495666_0001598 | 3300046526 | Bacteria | 11153 |
| 866 | Ga0495666_0075413 | 3300046526 | Bacteria | 1599 |
| 867 | Ga0495642_0007805 | 3300046528 | Bacteria | 4101 |
| 868 | Ga0495652_0008580 | 3300046529 | Bacteria | 9319 |
| 869 | Ga0495652_0010563 | 3300046529 | Bacteria | 8366 |
| 870 | Ga0495652_0039526 | 3300046529 | Bacteria | 4079 |
| 871 | Ga0495652_0072702 | 3300046529 | Bacteria | 2865 |
| 872 | Ga0495652_0513060 | 3300046529 | Bacteria | 829 |
| 873 | Ga0495665_0006558 | 3300046531 | Bacteria | 6285 |
| 874 | Ga0495665_0096230 | 3300046531 | Bacteria | 1555 |
| 875 | Ga0495665_0225943 | 3300046531 | Bacteria | 967 |
| 876 | Ga0495665_0440500 | 3300046531 | Bacteria | 659 |
| 877 | Ga0495665_0524614 | 3300046531 | Bacteria | 595 |
| 878 | Ga0495640_0009773 | 3300046533 | Bacteria | 7453 |
| 879 | Ga0495640_0031297 | 3300046533 | Bacteria | 3799 |
| 880 | Ga0495586_0034012 | 3300046535 | Bacteria | 2736 |
| 881 | Ga0495586_0196004 | 3300046535 | Bacteria | 1144 |
| 882 | Ga0495587_0001137 | 3300046536 | Bacteria | 17418 |
| 883 | Ga0495597_0100199 | 3300046542 | Bacteria | 1222 |
| 884 | Ga0495645_0005083 | 3300046543 | Bacteria | 9014 |
| 885 | Ga0495645_0023662 | 3300046543 | Bacteria | 4450 |
| 886 | Ga0495645_0307709 | 3300046543 | Bacteria | 1033 |
| 887 | Ga0495645_0510483 | 3300046543 | Bacteria | 750 |
| 888 | Ga0495668_0032056 | 3300046616 | Bacteria | 2959 |
| 889 | Ga0495634_0002825 | 3300046642 | Bacteria | 14255 |
| 890 | Ga0495634_0076659 | 3300046642 | Bacteria | 2194 |
| 891 | Ga0495625_0000056 | 3300046660 | Bacteria | 186024 |
| 892 | Ga0495625_0156761 | 3300046660 | Bacteria | 1527 |
| 893 | Ga0495635_0000635 | 3300046663 | Bacteria | 22541 |
| 894 | Ga0495635_0814476 | 3300046663 | Bacteria | 601 |
| 895 | Ga0495635_0992851 | 3300046663 | Bacteria | 534 |
| 896 | Ga0495588_0015467 | 3300046674 | Bacteria | 3673 |
| 897 | Ga0495588_0218424 | 3300046674 | Bacteria | 1006 |
| 898 | Ga0495599_0010543 | 3300046678 | Bacteria | 5655 |
| 899 | Ga0495599_0092709 | 3300046678 | Bacteria | 1884 |
| 900 | Ga0495623_0043618 | 3300046679 | Bacteria | 2853 |
| 901 | Ga0495623_0095104 | 3300046679 | Bacteria | 1821 |
| 902 | Ga0495623_0132150 | 3300046679 | Bacteria | 1493 |
| 903 | Ga0495623_0599511 | 3300046679 | Bacteria | 572 |
| 904 | Ga0495646_0002054 | 3300046680 | Bacteria | 12208 |
| 905 | Ga0495646_0087347 | 3300046680 | Bacteria | 1807 |
| 906 | Ga0495646_0167769 | 3300046680 | Bacteria | 1211 |
| 907 | Ga0495646_0223546 | 3300046680 | Bacteria | 1017 |
| 908 | Ga0495646_0563475 | 3300046680 | Bacteria | 581 |
| 909 | Ga0495613_0006353 | 3300046689 | Bacteria | 8838 |
| 910 | Ga0495624_0000416 | 3300046690 | Bacteria | 33753 |
| 911 | Ga0495624_0011083 | 3300046690 | Bacteria | 6204 |
| 912 | Ga0495624_0031482 | 3300046690 | Bacteria | 3447 |
| 913 | Ga0495624_0216162 | 3300046690 | Bacteria | 1162 |
| 914 | Ga0495624_0485495 | 3300046690 | Bacteria | 739 |
| 915 | Ga0495670_0084782 | 3300046691 | Bacteria | 1617 |
| 916 | Ga0495671_0011589 | 3300046692 | Bacteria | 4845 |
| 917 | Ga0495649_0006208 | 3300046694 | Bacteria | 7459 |
| 918 | Ga0495649_0008319 | 3300046694 | Bacteria | 6246 |
| 919 | Ga0495649_0038208 | 3300046694 | Bacteria | 2635 |
| 920 | Ga0495649_0178661 | 3300046694 | Bacteria | 1108 |
| 921 | Ga0495649_0264115 | 3300046694 | Bacteria | 882 |
| 922 | Ga0495589_0519939 | 3300046794 | Bacteria | 543 |
| 923 | Ga0495600_0227112 | 3300046809 | Bacteria | 1193 |
| 924 | Ga0495660_0090964 | 3300046810 | Bacteria | 1586 |
| 925 | Ga0495660_0135472 | 3300046810 | Bacteria | 1231 |
| 926 | Ga0495581_0002468 | 3300047315 | Bacteria | 10463 |
| 927 | Ga0495581_0024077 | 3300047315 | Bacteria | 3527 |
| 928 | Ga0495604_0003914 | 3300047317 | Bacteria | 11856 |
| 929 | Ga0495604_0011020 | 3300047317 | Bacteria | 7175 |
| 930 | Ga0495604_0014111 | 3300047317 | Bacteria | 6370 |
| 931 | Ga0495604_0056243 | 3300047317 | Bacteria | 3029 |
| 932 | Ga0495604_0332872 | 3300047317 | Bacteria | 1012 |
| 933 | Ga0495674_0007725 | 3300047319 | Bacteria | 10271 |
| 934 | Ga0495674_0010470 | 3300047319 | Bacteria | 8779 |
| 935 | Ga0495674_0014141 | 3300047319 | Bacteria | 7476 |
| 936 | Ga0495674_0017052 | 3300047319 | Bacteria | 6766 |
| 937 | Ga0495674_0116308 | 3300047319 | Bacteria | 2262 |
| 938 | Ga0495674_0126356 | 3300047319 | Bacteria | 2157 |
| 939 | Ga0495674_0818369 | 3300047319 | Bacteria | 723 |
| 940 | Ga0495672_0006413 | 3300047320 | Bacteria | 9126 |
| 941 | Ga0495672_0016206 | 3300047320 | Bacteria | 5034 |
| 942 | Ga0495672_0025309 | 3300047320 | Bacteria | 3802 |
| 943 | Ga0495672_0167347 | 3300047320 | Bacteria | 1124 |
| 944 | Ga0495676_0009149 | 3300047321 | Bacteria | 9030 |
| 945 | Ga0495676_0059065 | 3300047321 | Bacteria | 3014 |
| 946 | Ga0495676_0212051 | 3300047321 | Bacteria | 1339 |
| 947 | Ga0495676_0257393 | 3300047321 | Bacteria | 1188 |
| 948 | Ga0495680_0009118 | 3300047322 | Bacteria | 8955 |
| 949 | Ga0495680_0098131 | 3300047322 | Bacteria | 2186 |
| 950 | Ga0495680_0146979 | 3300047322 | Bacteria | 1721 |
| 951 | Ga0495680_0317619 | 3300047322 | Bacteria | 1090 |
| 952 | Ga0495680_0400765 | 3300047322 | Bacteria | 947 |
| 953 | Ga0495683_0000483 | 3300047323 | Bacteria | 30928 |
| 954 | Ga0495683_0003326 | 3300047323 | Bacteria | 9400 |
| 955 | Ga0495683_0018608 | 3300047323 | Bacteria | 3588 |
| 956 | Ga0495683_0040476 | 3300047323 | Bacteria | 2354 |
| 957 | Ga0495683_0152303 | 3300047323 | Bacteria | 1075 |
| 958 | Ga0495687_000207 | 3300047443 | Bacteria | 84210 |
| 959 | Ga0495687_010068 | 3300047443 | Bacteria | 5217 |
| 960 | Ga0495687_085518 | 3300047443 | Bacteria | 1222 |
| 961 | Ga0495687_163490 | 3300047443 | Bacteria | 745 |
| 962 | Ga0495675_0007904 | 3300047444 | Bacteria | 6571 |
| 963 | Ga0495675_0089483 | 3300047444 | Bacteria | 1932 |
| 964 | Ga0495675_0240245 | 3300047444 | Bacteria | 1090 |
| 965 | Ga0495677_0147119 | 3300047445 | Bacteria | 906 |
| 966 | Ga0495679_000103 | 3300047446 | Bacteria | 76165 |
| 967 | Ga0495679_003183 | 3300047446 | Bacteria | 8002 |
| 968 | Ga0495679_024465 | 3300047446 | Bacteria | 2034 |
| 969 | Ga0495673_0089393 | 3300047469 | Bacteria | 1261 |
| 970 | Ga0495673_0175641 | 3300047469 | Bacteria | 814 |
| 971 | Ga0495681_0019317 | 3300047470 | Bacteria | 3726 |
| 972 | Ga0495593_0007253 | 3300047673 | Bacteria | 6495 |
| 973 | Ga0495593_0012829 | 3300047673 | Bacteria | 4786 |
| 974 | Ga0495593_0016859 | 3300047673 | Bacteria | 4112 |
| 975 | Ga0495593_0031481 | 3300047673 | Bacteria | 2897 |
| 976 | Ga0495593_0040623 | 3300047673 | Bacteria | 2504 |
| 977 | Ga0495602_0011434 | 3300048088 | Bacteria | 9180 |
| 978 | Ga0495602_0017599 | 3300048088 | Bacteria | 7160 |
| 979 | Ga0495602_0038320 | 3300048088 | Bacteria | 4434 |
| 980 | Ga0495602_0245692 | 3300048088 | Bacteria | 1336 |
| 981 | Ga0495602_0436685 | 3300048088 | Bacteria | 926 |
| 982 | Ga0495602_0473077 | 3300048088 | Bacteria | 880 |
| 983 | Ga0495614_0015565 | 3300048089 | Bacteria | 3315 |
| 984 | Ga0495626_0005595 | 3300048091 | Bacteria | 7287 |
| 985 | Ga0495626_0009926 | 3300048091 | Bacteria | 5117 |
| 986 | Ga0496100_0002550 | 3300048903 | Bacteria | 9281 |
| 987 | Ga0496100_0101416 | 3300048903 | Bacteria | 1984 |
| 988 | Ga0496101_0002228 | 3300048904 | Bacteria | 11847 |
| 989 | Ga0496101_0019182 | 3300048904 | Bacteria | 4664 |
| 990 | Ga0496101_0269745 | 3300048904 | Bacteria | 1328 |
| 991 | Ga0496102_0000247 | 3300048905 | Bacteria | 70783 |
| 992 | Ga0496102_0011536 | 3300048905 | Bacteria | 7623 |
| 993 | Ga0496102_0357330 | 3300048905 | Bacteria | 1375 |
| 994 | Ga0496102_0765825 | 3300048905 | Bacteria | 888 |
| 995 | Ga0496103_0000278 | 3300048906 | Bacteria | 48336 |
| 996 | Ga0496103_0004113 | 3300048906 | Bacteria | 8833 |
| 997 | Ga0496103_0674933 | 3300048906 | Bacteria | 656 |
| 998 | Ga0496104_0012686 | 3300048907 | Bacteria | 7589 |
| 999 | Ga0496104_0442682 | 3300048907 | Bacteria | 1211 |
| 1000 | Ga0496104_0841253 | 3300048907 | Bacteria | 823 |
| 1001 | Ga0496105_0193414 | 3300048908 | Bacteria | 1663 |
| 1002 | Ga0496105_0333670 | 3300048908 | Bacteria | 1213 |
| 1003 | Ga0496106_0034656 | 3300048909 | Bacteria | 3771 |
| 1004 | Ga0496106_0339206 | 3300048909 | Bacteria | 1207 |
| 1005 | Ga0496107_0007427 | 3300048910 | Bacteria | 7557 |
| 1006 | Ga0496107_0129345 | 3300048910 | Bacteria | 1864 |
| 1007 | Ga0496108_0220724 | 3300048911 | Bacteria | 1647 |
| 1008 | Ga0496108_0726060 | 3300048911 | Bacteria | 860 |
| 1009 | Ga0496108_0767753 | 3300048911 | Bacteria | 833 |
| 1010 | Ga0496109_0156865 | 3300048912 | Bacteria | 2132 |
| 1011 | Ga0496109_0253568 | 3300048912 | Bacteria | 1657 |
| 1012 | Ga0496109_1580520 | 3300048912 | Bacteria | 590 |
| 1013 | Ga0496110_0033465 | 3300048913 | Bacteria | 4446 |
| 1014 | Ga0496110_0855295 | 3300048913 | Bacteria | 815 |
| 1015 | Ga0496111_0097044 | 3300048914 | Bacteria | 2163 |
| 1016 | Ga0496112_0049701 | 3300048915 | Bacteria | 4110 |
| 1017 | Ga0496112_0969349 | 3300048915 | Bacteria | 771 |
| 1018 | Ga0496112_1626283 | 3300048915 | Bacteria | 559 |
| 1019 | Ga0496113_0004854 | 3300048916 | Bacteria | 8324 |
| 1020 | Ga0496113_0247667 | 3300048916 | Bacteria | 1422 |
| 1021 | Ga0496113_0877810 | 3300048916 | Bacteria | 710 |
| 1022 | Ga0496114_0049041 | 3300048917 | Bacteria | 3513 |
| 1023 | Ga0496114_0921698 | 3300048917 | Bacteria | 755 |
| 1024 | Ga0496116_0067882 | 3300048919 | Bacteria | 2275 |
| 1025 | Ga0496116_0077471 | 3300048919 | Bacteria | 2077 |
| 1026 | Ga0496116_0210565 | 3300048919 | Bacteria | 1008 |
| 1027 | Ga0496116_0261687 | 3300048919 | Bacteria | 852 |
| 1028 | Ga0496117_0000445 | 3300048920 | Bacteria | 68610 |
| 1029 | Ga0496117_0018250 | 3300048920 | Bacteria | 5822 |
| 1030 | Ga0496117_0028196 | 3300048920 | Bacteria | 4352 |
| 1031 | Ga0496117_0077015 | 3300048920 | Bacteria | 2208 |
| 1032 | Ga0496117_0142136 | 3300048920 | Bacteria | 1435 |
| 1033 | Ga0496118_0000138 | 3300048921 | Bacteria | 128826 |
| 1034 | Ga0496118_0038446 | 3300048921 | Bacteria | 3835 |
| 1035 | Ga0496118_0064386 | 3300048921 | Bacteria | 2690 |
| 1036 | Ga0496118_0088277 | 3300048921 | Bacteria | 2145 |
| 1037 | Ga0496118_0201297 | 3300048921 | Bacteria | 1179 |
| 1038 | Ga0496118_0283728 | 3300048921 | Bacteria | 920 |
| 1039 | Ga0496118_0319804 | 3300048921 | Bacteria | 842 |
| 1040 | Ga0496121_0001530 | 3300048924 | Bacteria | 38696 |
| 1041 | Ga0496121_0007122 | 3300048924 | Bacteria | 13575 |
| 1042 | Ga0496121_0009428 | 3300048924 | Bacteria | 11220 |
| 1043 | Ga0496121_0019431 | 3300048924 | Bacteria | 6793 |
| 1044 | Ga0496121_0200367 | 3300048924 | Bacteria | 1423 |
| 1045 | Ga0496122_0037608 | 3300048925 | Bacteria | 3893 |
| 1046 | Ga0496122_0096052 | 3300048925 | Bacteria | 2000 |
| 1047 | Ga0496122_0097709 | 3300048925 | Bacteria | 1975 |
| 1048 | Ga0496122_0107920 | 3300048925 | Bacteria | 1838 |
| 1049 | Ga0496122_0125380 | 3300048925 | Bacteria | 1645 |
| 1050 | Ga0496123_0061360 | 3300048926 | Bacteria | 2416 |
| 1051 | Ga0496123_0085045 | 3300048926 | Bacteria | 1905 |
| 1052 | Ga0496123_0167325 | 3300048926 | Bacteria | 1164 |
| 1053 | Ga0496123_0489792 | 3300048926 | Bacteria | 539 |
| 1054 | Ga0496124_0019236 | 3300048927 | Bacteria | 6365 |
| 1055 | Ga0496124_0109845 | 3300048927 | Bacteria | 2221 |
| 1056 | Ga0496124_0135768 | 3300048927 | Bacteria | 1948 |
| 1057 | Ga0496124_0199425 | 3300048927 | Bacteria | 1523 |
| 1058 | Ga0496124_0397733 | 3300048927 | Bacteria | 957 |
| 1059 | Ga0496125_0010667 | 3300048928 | Bacteria | 9276 |
| 1060 | Ga0496125_0018669 | 3300048928 | Bacteria | 6578 |
| 1061 | Ga0496125_0152093 | 3300048928 | Bacteria | 1587 |
| 1062 | Ga0496126_0001647 | 3300048929 | Bacteria | 33697 |
| 1063 | Ga0496126_0116341 | 3300048929 | Bacteria | 2324 |
| 1064 | Ga0496126_0198850 | 3300048929 | Bacteria | 1694 |
| 1065 | Ga0501309_017261 | 3300049129 | Bacteria | 990 |
| 1066 | Ga0495678_043424 | 3300049459 | Bacteria | 1785 |
| 1067 | Ga0495682_0000254 | 3300049460 | Bacteria | 42240 |
| 1068 | Ga0495682_0003881 | 3300049460 | Bacteria | 6538 |
| 1069 | Ga0495682_0030071 | 3300049460 | Bacteria | 2010 |
| 1070 | Ga0495682_0049284 | 3300049460 | Bacteria | 1534 |
| 1071 | Ga0501292_060251 | 3300049515 | Bacteria | 687 |
| 1072 | Ga0501294_024554 | 3300049517 | Bacteria | 672 |
| 1073 | Ga0501034_0000003 | 3300049571 | Bacteria | 471748 |
| 1074 | Ga0501046_1138357 | 3300049580 | Bacteria | 538 |
| 1075 | Ga0501048_0582599 | 3300049582 | Bacteria | 803 |
| 1076 | Ga0501072_0224223 | 3300049588 | Bacteria | 1498 |
| 1077 | Ga0501206_000487 | 3300049653 | Bacteria | 4790 |
| 1078 | Ga0501207_075224 | 3300049654 | Bacteria | 641 |
| 1079 | Ga0501262_010025 | 3300049759 | Bacteria | 1180 |
| 1080 | Ga0501265_003053 | 3300049762 | Bacteria | 1903 |
| 1081 | nmdc:mga03683_26699_c1 | 3300050489 | Bacteria | 2280 |
| 1082 | nmdc:mga03683_545_c1 | 3300050489 | Bacteria | 10807 |
| 1083 | nmdc:mga03683_6134_c1 | 3300050489 | Bacteria | 4101 |
| 1084 | nmdc:mga03n38_29907_c1 | 3300050490 | Bacteria | 2285 |
| 1085 | nmdc:mga03n38_4827_c1 | 3300050490 | Bacteria | 4516 |
| 1086 | nmdc:mga03n38_9667_c1 | 3300050490 | Bacteria | 3516 |
| 1087 | nmdc:mga00v17_14264_c1 | 3300050491 | Bacteria | 4431 |
| 1088 | nmdc:mga00v17_1957_c1 | 3300050491 | Bacteria | 10639 |
| 1089 | nmdc:mga00v17_620390_c1 | 3300050491 | Bacteria | 696 |
| 1090 | nmdc:mga0yw44_5595_c1 | 3300050492 | Bacteria | 5969 |
| 1091 | nmdc:mga0yw44_822_c1 | 3300050492 | Bacteria | 11590 |
| 1092 | nmdc:mga0k408_11610_c1 | 3300050493 | Bacteria | 4801 |
| 1093 | nmdc:mga0k408_1313_c1 | 3300050493 | Bacteria | 13430 |
| 1094 | nmdc:mga0k408_18508_c1 | 3300050493 | Bacteria | 3888 |
| 1095 | nmdc:mga0k408_36108_c1 | 3300050493 | Bacteria | 2836 |
| 1096 | nmdc:mga0k408_40895_c1 | 3300050493 | Bacteria | 2669 |
| 1097 | nmdc:mga0k408_637108_c1 | 3300050493 | Bacteria | 627 |
| 1098 | nmdc:mga06z11_1020_c1 | 3300050494 | Bacteria | 10220 |
| 1099 | nmdc:mga06z11_267741_c1 | 3300050494 | Bacteria | 1010 |
| 1100 | nmdc:mga06z11_80647_c1 | 3300050494 | Bacteria | 1745 |
| 1101 | nmdc:mga04h51_135699_c1 | 3300050495 | Bacteria | 929 |
| 1102 | nmdc:mga04h51_173348_c1 | 3300050495 | Bacteria | 836 |
| 1103 | nmdc:mga04h51_1956_c1 | 3300050495 | Bacteria | 4802 |
| 1104 | nmdc:mga07m45_1263_c1 | 3300050496 | Bacteria | 11509 |
| 1105 | nmdc:mga07m45_26187_c1 | 3300050496 | Bacteria | 3204 |
| 1106 | nmdc:mga07m45_570823_c1 | 3300050496 | Bacteria | 654 |
| 1107 | nmdc:mga07m45_82856_c1 | 3300050496 | Bacteria | 1832 |
| 1108 | nmdc:mga07m45_9583_c1 | 3300050496 | Bacteria | 5031 |
| 1109 | nmdc:mga07m45_98435_c1 | 3300050496 | Bacteria | 1679 |
| 1110 | nmdc:mga06r32_1022248_c1 | 3300050510 | Bacteria | 778 |
| 1111 | nmdc:mga0n895_445597_c1 | 3300050512 | Bacteria | 1307 |
| 1112 | nmdc:mga0sz30_7217_c1 | 3300050516 | Bacteria | 4162 |
| 1113 | Ga0500643_013144 | 3300053087 | Bacteria | 2936 |
| 1114 | Ga0500651_0000957 | 3300053093 | Bacteria | 14201 |
| 1115 | Ga0500566_0142346 | 3300053094 | Bacteria | 1271 |
| 1116 | Ga0500660_054333 | 3300053100 | Bacteria | 1964 |
| 1117 | Ga0500571_000024 | 3300053110 | Bacteria | 52195 |
| 1118 | Ga0500592_008481 | 3300053116 | Bacteria | 1630 |
| 1119 | Ga0500608_001647 | 3300053122 | Bacteria | 8021 |
| 1120 | Ga0500618_031463 | 3300053125 | Bacteria | 1244 |
| 1121 | Ga0500559_0027986 | 3300053136 | Bacteria | 2406 |
| 1122 | Ga0500559_0096536 | 3300053136 | Bacteria | 1358 |
| 1123 | Ga0500564_068558 | 3300053138 | Bacteria | 1602 |
| 1124 | Ga0500568_0003259 | 3300053139 | Bacteria | 9165 |
| 1125 | Ga0500574_007237 | 3300053141 | Bacteria | 2288 |
| 1126 | Ga0500619_193608 | 3300053154 | Bacteria | 684 |
| 1127 | Ga0500638_004803 | 3300053162 | Bacteria | 5284 |
| 1128 | Ga0500636_0153160 | 3300053177 | Bacteria | 1264 |
| 1129 | Ga0500565_022799 | 3300053734 | Bacteria | 768 |
| 1130 | Ga0587084_001920 | 3300059477 | Bacteria | 2067 |
| 1131 | Ga0587084_003128 | 3300059477 | Bacteria | 1792 |
| 1132 | Ga0587084_040228 | 3300059477 | Bacteria | 791 |
| 1133 | Ga0587083_0016341 | 3300059505 | Bacteria | 1312 |
| 1134 | Ga0587090_001520 | 3300059510 | Bacteria | 2371 |
| 1135 | Ga0587090_002110 | 3300059510 | Bacteria | 2138 |
| 1136 | Ga0587090_007688 | 3300059510 | Bacteria | 1423 |
| 1137 | Ga0587090_017945 | 3300059510 | Bacteria | 1076 |
| 1138 | Ga0587094_019363 | 3300059513 | Bacteria | 976 |
| 1139 | Ga0587101_018139 | 3300059623 | Bacteria | 983 |
| 1140 | Ga0587067_008178 | 3300059640 | Bacteria | 1520 |
| 1141 | Ga0587068_008866 | 3300059641 | Bacteria | 1469 |
| 1142 | Ga0587068_024858 | 3300059641 | Bacteria | 1006 |
| 1143 | Ga0587072_011558 | 3300059643 | Bacteria | 1446 |
| 1144 | Ga0587076_012201 | 3300059645 | Bacteria | 1279 |
| 1145 | Ga0587076_023408 | 3300059645 | Bacteria | 1040 |
| 1146 | Ga0587105_001077 | 3300059651 | Bacteria | 1337 |
| 1147 | Ga0587111_0012970 | 3300060346 | Bacteria | 1482 |
| 1148 | Ga0587111_0020665 | 3300060346 | Bacteria | 1262 |
| 1149 | Ga0587111_0024244 | 3300060346 | Bacteria | 1193 |
| 1150 | Ga0466962_0001661 | 3300061719 | Bacteria | 10431 |
| 1151 | Ga0466962_0004649 | 3300061719 | Bacteria | 6594 |
| 1152 | Ga0466962_0011849 | 3300061719 | Bacteria | 4196 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046472 | Ga0495580_0007425 | Ga0495580_0007425_7151_7612 | 129 |
| 2 | 3300046474 | Ga0495605_0085722 | Ga0495605_0085722_598_1059 | 129 |
| 3 | 3300046513 | Ga0495616_0083202 | Ga0495616_0083202_340_801 | 129 |
| 4 | 3300046524 | Ga0495648_0024057 | Ga0495648_0024057_643_1104 | 129 |
| 5 | 3300046694 | Ga0495649_0178661 | Ga0495649_0178661_629_1090 | 129 |
| 6 | 3300047323 | Ga0495683_0018608 | Ga0495683_0018608_2993_3454 | 129 |
| 7 | 3300047443 | Ga0495687_085518 | Ga0495687_085518_539_1000 | 129 |
| 8 | 3300049460 | Ga0495682_0030071 | Ga0495682_0030071_37_498 | 129 |
| 9 | 3300042115 | Ga0450911_000225 | Ga0450911_000225_4477_4935 | 146 |
| 10 | 3300042137 | Ga0450902_051631 | Ga0450902_051631_231_689 | 146 |
| 11 | 3300048927 | Ga0496124_0135768 | Ga0496124_0135768_142_600 | 146 |
| 12 | 3300048928 | Ga0496125_0010667 | Ga0496125_0010667_5824_6282 | 146 |
| 13 | 3300048929 | Ga0496126_0116341 | Ga0496126_0116341_1745_2203 | 146 |
| 14 | iso_pu_bacteria | 2928115317 | 2928116997 | 148 |
| 15 | 3300001989 | JGI24739J22299_10163337 | JGI24739J22299_101633371 | 149 |
| 16 | 3300003316 | rootH1_10101357 | rootH1_101013572 | 149 |
| 17 | 3300003322 | rootL2_10012388 | rootL2_100123882 | 149 |
| 18 | 3300003792 | Ga0055540_1002356 | Ga0055540_100235610 | 149 |
| 19 | 3300005289 | Ga0065704_10147436 | Ga0065704_101474362 | 149 |
| 20 | 3300005457 | Ga0070662_100205147 | Ga0070662_1002051473 | 149 |
| 21 | 3300006038 | Ga0075365_10001937 | Ga0075365_1000193713 | 149 |
| 22 | 3300006042 | Ga0075368_10001130 | Ga0075368_100011308 | 149 |
| 23 | 3300006048 | Ga0075363_100020439 | Ga0075363_1000204394 | 149 |
| 24 | 3300006051 | Ga0075364_10012743 | Ga0075364_100127434 | 149 |
| 25 | 3300006178 | Ga0075367_10000488 | Ga0075367_1000048813 | 149 |
| 26 | 3300006186 | Ga0075369_10001709 | Ga0075369_100017098 | 149 |
| 27 | 3300006195 | Ga0075366_10024831 | Ga0075366_100248314 | 149 |
| 28 | 3300006353 | Ga0075370_10000375 | Ga0075370_1000037514 | 149 |
| 29 | 3300009176 | Ga0105242_10567469 | Ga0105242_105674692 | 149 |
| 30 | 3300014497 | Ga0182008_10021729 | Ga0182008_100217295 | 149 |
| 31 | 3300014497 | Ga0182008_10294901 | Ga0182008_102949012 | 149 |
| 32 | 3300015261 | Ga0182006_1020371 | Ga0182006_10203712 | 149 |
| 33 | 3300025292 | Ga0209676_1020438 | Ga0209676_10204382 | 149 |
| 34 | 3300025303 | Ga0209051_1000494 | Ga0209051_100049436 | 149 |
| 35 | 3300025903 | Ga0207680_10164462 | Ga0207680_101644623 | 149 |
| 36 | 3300025981 | Ga0207640_10573321 | Ga0207640_105733212 | 149 |
| 37 | 3300027866 | Ga0209813_10003543 | Ga0209813_100035432 | 149 |
| 38 | 3300028379 | Ga0268266_11486230 | Ga0268266_114862302 | 149 |
| 39 | 3300028380 | Ga0268265_11730424 | Ga0268265_117304241 | 149 |
| 40 | 3300031649 | Ga0307514_10017303 | Ga0307514_100173035 | 149 |
| 41 | 3300031901 | Ga0307406_10001271 | Ga0307406_1000127114 | 149 |
| 42 | 3300031911 | Ga0307412_10135786 | Ga0307412_101357862 | 149 |
| 43 | 3300032004 | Ga0307414_10102929 | Ga0307414_101029292 | 149 |
| 44 | 3300046524 | Ga0495648_0389674 | Ga0495648_0389674_99_569 | 149 |
| 45 | 3300048909 | Ga0496106_0339206 | Ga0496106_0339206_536_1006 | 149 |
| 46 | 3300048910 | Ga0496107_0129345 | Ga0496107_0129345_646_1116 | 149 |
| 47 | 3300050489 | nmdc:mga03683_26699_c1 | nmdc:mga03683_26699_c1_697_1167 | 149 |
| 48 | 3300050489 | nmdc:mga03683_6134_c1 | nmdc:mga03683_6134_c1_1684_2139 | 149 |
| 49 | 3300050490 | nmdc:mga03n38_4827_c1 | nmdc:mga03n38_4827_c1_1596_2066 | 149 |
| 50 | 3300050491 | nmdc:mga00v17_14264_c1 | nmdc:mga00v17_14264_c1_2360_2830 | 149 |
| 51 | 3300050492 | nmdc:mga0yw44_5595_c1 | nmdc:mga0yw44_5595_c1_1347_1817 | 149 |
| 52 | 3300050493 | nmdc:mga0k408_1313_c1 | nmdc:mga0k408_1313_c1_7495_7965 | 149 |
| 53 | 3300050494 | nmdc:mga06z11_1020_c1 | nmdc:mga06z11_1020_c1_4078_4548 | 149 |
| 54 | 3300050495 | nmdc:mga04h51_1956_c1 | nmdc:mga04h51_1956_c1_1303_1773 | 149 |
| 55 | 3300050496 | nmdc:mga07m45_9583_c1 | nmdc:mga07m45_9583_c1_1420_1890 | 149 |
| 56 | 3300050516 | nmdc:mga0sz30_7217_c1 | nmdc:mga0sz30_7217_c1_983_1453 | 149 |
| 57 | 3300053122 | Ga0500608_001647 | Ga0500608_001647_2934_3389 | 149 |
| 58 | 3300001979 | JGI24740J21852_10019260 | JGI24740J21852_100192604 | 150 |
| 59 | 3300001979 | JGI24740J21852_10065968 | JGI24740J21852_100659681 | 150 |
| 60 | 3300001989 | JGI24739J22299_10078299 | JGI24739J22299_100782992 | 150 |
| 61 | 3300001990 | JGI24737J22298_10010200 | JGI24737J22298_100102003 | 150 |
| 62 | 3300002067 | JGI24735J21928_10000589 | JGI24735J21928_1000058912 | 150 |
| 63 | 3300002739 | JGI25158J39367_1009898 | JGI25158J39367_10098983 | 150 |
| 64 | 3300002774 | JGI25150J39212_1002582 | JGI25150J39212_10025823 | 150 |
| 65 | 3300003187 | JGI25151J46595_10014151 | JGI25151J46595_100141513 | 150 |
| 66 | 3300003187 | JGI25151J46595_10068449 | JGI25151J46595_100684493 | 150 |
| 67 | 3300003215 | JGI25153J46596_10033361 | JGI25153J46596_100333613 | 150 |
| 68 | 3300003316 | rootH1_10027942 | rootH1_100279424 | 150 |
| 69 | 3300003323 | rootH1_10120212 | rootH1_101202125 | 150 |
| 70 | 3300003760 | Ga0055527_1006523 | Ga0055527_10065232 | 150 |
| 71 | 3300003761 | Ga0055535_1000115 | Ga0055535_100011578 | 150 |
| 72 | 3300003762 | Ga0055542_1000028 | Ga0055542_100002885 | 150 |
| 73 | 3300003773 | Ga0055537_1007555 | Ga0055537_10075553 | 150 |
| 74 | 3300003781 | Ga0055536_1007682 | Ga0055536_10076823 | 150 |
| 75 | 3300003784 | Ga0055534_1007435 | Ga0055534_10074353 | 150 |
| 76 | 3300003790 | Ga0055528_1016487 | Ga0055528_10164873 | 150 |
| 77 | 3300003791 | Ga0055530_10000380 | Ga0055530_1000038023 | 150 |
| 78 | 3300003791 | Ga0055530_10003806 | Ga0055530_100038063 | 150 |
| 79 | 3300003792 | Ga0055540_1001790 | Ga0055540_100179010 | 150 |
| 80 | 3300003792 | Ga0055540_1019493 | Ga0055540_10194933 | 150 |
| 81 | 3300003794 | Ga0055531_10000084 | Ga0055531_1000008474 | 150 |
| 82 | 3300005288 | Ga0065714_10077745 | Ga0065714_100777452 | 150 |
| 83 | 3300005327 | Ga0070658_10483300 | Ga0070658_104833002 | 150 |
| 84 | 3300005334 | Ga0068869_101121546 | Ga0068869_1011215462 | 150 |
| 85 | 3300005335 | Ga0070666_10074877 | Ga0070666_100748773 | 150 |
| 86 | 3300005366 | Ga0070659_100025930 | Ga0070659_1000259302 | 150 |
| 87 | 3300005455 | Ga0070663_100800769 | Ga0070663_1008007691 | 150 |
| 88 | 3300005456 | Ga0070678_100675304 | Ga0070678_1006753042 | 150 |
| 89 | 3300005539 | Ga0068853_100024762 | Ga0068853_1000247625 | 150 |
| 90 | 3300005539 | Ga0068853_100170844 | Ga0068853_1001708443 | 150 |
| 91 | 3300005539 | Ga0068853_100603924 | Ga0068853_1006039242 | 150 |
| 92 | 3300005564 | Ga0070664_100076910 | Ga0070664_1000769104 | 150 |
| 93 | 3300005577 | Ga0068857_100317346 | Ga0068857_1003173463 | 150 |
| 94 | 3300005577 | Ga0068857_101590763 | Ga0068857_1015907632 | 150 |
| 95 | 3300005578 | Ga0068854_100376402 | Ga0068854_1003764022 | 150 |
| 96 | 3300005614 | Ga0068856_100305768 | Ga0068856_1003057682 | 150 |
| 97 | 3300005614 | Ga0068856_100712190 | Ga0068856_1007121902 | 150 |
| 98 | 3300005616 | Ga0068852_100017829 | Ga0068852_1000178293 | 150 |
| 99 | 3300005616 | Ga0068852_100142243 | Ga0068852_1001422432 | 150 |
| 100 | 3300005616 | Ga0068852_101425210 | Ga0068852_1014252102 | 150 |
| 101 | 3300005834 | Ga0068851_10080322 | Ga0068851_100803222 | 150 |
| 102 | 3300006042 | Ga0075368_10206456 | Ga0075368_102064561 | 150 |
| 103 | 3300006048 | Ga0075363_100209451 | Ga0075363_1002094513 | 150 |
| 104 | 3300006048 | Ga0075363_100615349 | Ga0075363_1006153491 | 150 |
| 105 | 3300006051 | Ga0075364_10005448 | Ga0075364_100054483 | 150 |
| 106 | 3300006058 | Ga0075432_10004475 | Ga0075432_100044753 | 150 |
| 107 | 3300006177 | Ga0075362_10001157 | Ga0075362_100011575 | 150 |
| 108 | 3300006177 | Ga0075362_10029335 | Ga0075362_100293353 | 150 |
| 109 | 3300006178 | Ga0075367_10094701 | Ga0075367_100947013 | 150 |
| 110 | 3300006178 | Ga0075367_10572047 | Ga0075367_105720471 | 150 |
| 111 | 3300006195 | Ga0075366_10073998 | Ga0075366_100739982 | 150 |
| 112 | 3300006195 | Ga0075366_10104313 | Ga0075366_101043132 | 150 |
| 113 | 3300006195 | Ga0075366_10221684 | Ga0075366_102216842 | 150 |
| 114 | 3300006353 | Ga0075370_10000575 | Ga0075370_100005755 | 150 |
| 115 | 3300006353 | Ga0075370_10023715 | Ga0075370_100237153 | 150 |
| 116 | 3300006353 | Ga0075370_10060742 | Ga0075370_100607422 | 150 |
| 117 | 3300006946 | Ga0079104_1038669 | Ga0079104_10386691 | 150 |
| 118 | 3300009011 | Ga0105251_10000427 | Ga0105251_100004275 | 150 |
| 119 | 3300009036 | Ga0105244_10012387 | Ga0105244_100123873 | 150 |
| 120 | 3300009036 | Ga0105244_10282175 | Ga0105244_102821752 | 150 |
| 121 | 3300009092 | Ga0105250_10192633 | Ga0105250_101926332 | 150 |
| 122 | 3300009093 | Ga0105240_10203394 | Ga0105240_102033943 | 150 |
| 123 | 3300009093 | Ga0105240_11650691 | Ga0105240_116506911 | 150 |
| 124 | 3300009098 | Ga0105245_11123170 | Ga0105245_111231701 | 150 |
| 125 | 3300009148 | Ga0105243_10004528 | Ga0105243_100045288 | 150 |
| 126 | 3300009148 | Ga0105243_10032819 | Ga0105243_100328193 | 150 |
| 127 | 3300009176 | Ga0105242_10340120 | Ga0105242_103401202 | 150 |
| 128 | 3300009545 | Ga0105237_10159765 | Ga0105237_101597653 | 150 |
| 129 | 3300009551 | Ga0105238_10051201 | Ga0105238_100512014 | 150 |
| 130 | 3300009551 | Ga0105238_10056077 | Ga0105238_100560772 | 150 |
| 131 | 3300009551 | Ga0105238_12195069 | Ga0105238_121950692 | 150 |
| 132 | 3300010375 | Ga0105239_10158456 | Ga0105239_101584563 | 150 |
| 133 | 3300012502 | Ga0157347_1011112 | Ga0157347_10111122 | 150 |
| 134 | 3300013100 | Ga0157373_10025435 | Ga0157373_100254352 | 150 |
| 135 | 3300013100 | Ga0157373_10261531 | Ga0157373_102615312 | 150 |
| 136 | 3300013102 | Ga0157371_10082692 | Ga0157371_100826923 | 150 |
| 137 | 3300013102 | Ga0157371_10123211 | Ga0157371_101232113 | 150 |
| 138 | 3300013104 | Ga0157370_10042603 | Ga0157370_100426032 | 150 |
| 139 | 3300013105 | Ga0157369_10001241 | Ga0157369_100012419 | 150 |
| 140 | 3300013296 | Ga0157374_10009373 | Ga0157374_100093737 | 150 |
| 141 | 3300013306 | Ga0163162_10476825 | Ga0163162_104768252 | 150 |
| 142 | 3300013307 | Ga0157372_10312934 | Ga0157372_103129342 | 150 |
| 143 | 3300014326 | Ga0157380_12314693 | Ga0157380_123146931 | 150 |
| 144 | 3300014497 | Ga0182008_10002465 | Ga0182008_100024659 | 150 |
| 145 | 3300014497 | Ga0182008_10002632 | Ga0182008_100026329 | 150 |
| 146 | 3300015261 | Ga0182006_1002482 | Ga0182006_100248210 | 150 |
| 147 | 3300015261 | Ga0182006_1091634 | Ga0182006_10916342 | 150 |
| 148 | 3300015262 | Ga0182007_10001059 | Ga0182007_100010595 | 150 |
| 149 | 3300015265 | Ga0182005_1118525 | Ga0182005_11185252 | 150 |
| 150 | 3300017792 | Ga0163161_10000657 | Ga0163161_100006576 | 150 |
| 151 | 3300025228 | Ga0209672_100982 | Ga0209672_1009826 | 150 |
| 152 | 3300025228 | Ga0209672_101155 | Ga0209672_1011554 | 150 |
| 153 | 3300025229 | Ga0209147_101077 | Ga0209147_1010772 | 150 |
| 154 | 3300025242 | Ga0209258_100067 | Ga0209258_100067168 | 150 |
| 155 | 3300025245 | Ga0207425_1000434 | Ga0207425_100043415 | 150 |
| 156 | 3300025245 | Ga0207425_1001023 | Ga0207425_10010238 | 150 |
| 157 | 3300025254 | Ga0209148_1000067 | Ga0209148_1000067211 | 150 |
| 158 | 3300025258 | Ga0209129_1000030 | Ga0209129_100003094 | 150 |
| 159 | 3300025258 | Ga0209129_1031627 | Ga0209129_10316271 | 150 |
| 160 | 3300025263 | Ga0209565_1000019 | Ga0209565_1000019166 | 150 |
| 161 | 3300025263 | Ga0209565_1001223 | Ga0209565_100122311 | 150 |
| 162 | 3300025273 | Ga0209673_1000066 | Ga0209673_10000669 | 150 |
| 163 | 3300025273 | Ga0209673_1000095 | Ga0209673_100009585 | 150 |
| 164 | 3300025284 | Ga0209130_1000011 | Ga0209130_1000011158 | 150 |
| 165 | 3300025284 | Ga0209130_1004492 | Ga0209130_10044924 | 150 |
| 166 | 3300025291 | Ga0209675_1000031 | Ga0209675_100003116 | 150 |
| 167 | 3300025291 | Ga0209675_1004844 | Ga0209675_10048445 | 150 |
| 168 | 3300025292 | Ga0209676_1000005 | Ga0209676_1000005960 | 150 |
| 169 | 3300025292 | Ga0209676_1000123 | Ga0209676_1000123140 | 150 |
| 170 | 3300025292 | Ga0209676_1002917 | Ga0209676_100291712 | 150 |
| 171 | 3300025294 | Ga0209025_1000078 | Ga0209025_100007814 | 150 |
| 172 | 3300025294 | Ga0209025_1000319 | Ga0209025_100031947 | 150 |
| 173 | 3300025294 | Ga0209025_1001554 | Ga0209025_10015545 | 150 |
| 174 | 3300025294 | Ga0209025_1009510 | Ga0209025_10095104 | 150 |
| 175 | 3300025295 | Ga0209564_1000056 | Ga0209564_100005681 | 150 |
| 176 | 3300025295 | Ga0209564_1000099 | Ga0209564_100009910 | 150 |
| 177 | 3300025297 | Ga0209758_1000037 | Ga0209758_1000037245 | 150 |
| 178 | 3300025298 | Ga0209050_1000007 | Ga0209050_1000007137 | 150 |
| 179 | 3300025298 | Ga0209050_1000188 | Ga0209050_1000188103 | 150 |
| 180 | 3300025299 | Ga0209256_1000022 | Ga0209256_1000022300 | 150 |
| 181 | 3300025299 | Ga0209256_1000043 | Ga0209256_100004381 | 150 |
| 182 | 3300025302 | Ga0207426_1000029 | Ga0207426_1000029245 | 150 |
| 183 | 3300025302 | Ga0207426_1000260 | Ga0207426_100026073 | 150 |
| 184 | 3300025302 | Ga0207426_1003898 | Ga0207426_100389811 | 150 |
| 185 | 3300025303 | Ga0209051_1000036 | Ga0209051_1000036311 | 150 |
| 186 | 3300025303 | Ga0209051_1000091 | Ga0209051_1000091140 | 150 |
| 187 | 3300025304 | Ga0209257_1000011 | Ga0209257_1000011934 | 150 |
| 188 | 3300025304 | Ga0209257_1000057 | Ga0209257_100005798 | 150 |
| 189 | 3300025321 | Ga0207656_10046457 | Ga0207656_100464573 | 150 |
| 190 | 3300025728 | Ga0207655_1001871 | Ga0207655_10018714 | 150 |
| 191 | 3300025735 | Ga0207713_1007353 | Ga0207713_10073533 | 150 |
| 192 | 3300025903 | Ga0207680_10061690 | Ga0207680_100616903 | 150 |
| 193 | 3300025904 | Ga0207647_10014440 | Ga0207647_100144405 | 150 |
| 194 | 3300025904 | Ga0207647_10200988 | Ga0207647_102009883 | 150 |
| 195 | 3300025908 | Ga0207643_10195687 | Ga0207643_101956872 | 150 |
| 196 | 3300025911 | Ga0207654_10454470 | Ga0207654_104544702 | 150 |
| 197 | 3300025913 | Ga0207695_10400404 | Ga0207695_104004042 | 150 |
| 198 | 3300025914 | Ga0207671_10068770 | Ga0207671_100687702 | 150 |
| 199 | 3300025924 | Ga0207694_10152653 | Ga0207694_101526533 | 150 |
| 200 | 3300025931 | Ga0207644_11125769 | Ga0207644_111257691 | 150 |
| 201 | 3300025932 | Ga0207690_10064824 | Ga0207690_100648243 | 150 |
| 202 | 3300025932 | Ga0207690_10095002 | Ga0207690_100950022 | 150 |
| 203 | 3300025933 | Ga0207706_10506764 | Ga0207706_105067642 | 150 |
| 204 | 3300025934 | Ga0207686_10277216 | Ga0207686_102772162 | 150 |
| 205 | 3300025935 | Ga0207709_10001089 | Ga0207709_1000108916 | 150 |
| 206 | 3300025935 | Ga0207709_10012585 | Ga0207709_100125855 | 150 |
| 207 | 3300025938 | Ga0207704_11108880 | Ga0207704_111088801 | 150 |
| 208 | 3300025942 | Ga0207689_10091608 | Ga0207689_100916082 | 150 |
| 209 | 3300025942 | Ga0207689_10271241 | Ga0207689_102712412 | 150 |
| 210 | 3300025945 | Ga0207679_10073814 | Ga0207679_100738142 | 150 |
| 211 | 3300025949 | Ga0207667_10066718 | Ga0207667_100667184 | 150 |
| 212 | 3300026041 | Ga0207639_10022579 | Ga0207639_100225793 | 150 |
| 213 | 3300026067 | Ga0207678_10358986 | Ga0207678_103589861 | 150 |
| 214 | 3300026067 | Ga0207678_10370686 | Ga0207678_103706861 | 150 |
| 215 | 3300026078 | Ga0207702_10458938 | Ga0207702_104589382 | 150 |
| 216 | 3300026089 | Ga0207648_10100100 | Ga0207648_101001002 | 150 |
| 217 | 3300026116 | Ga0207674_10245152 | Ga0207674_102451522 | 150 |
| 218 | 3300026116 | Ga0207674_10409664 | Ga0207674_104096643 | 150 |
| 219 | 3300026142 | Ga0207698_10048515 | Ga0207698_100485151 | 150 |
| 220 | 3300026142 | Ga0207698_10185212 | Ga0207698_101852122 | 150 |
| 221 | 3300027866 | Ga0209813_10089423 | Ga0209813_100894232 | 150 |
| 222 | 3300027907 | Ga0207428_10093489 | Ga0207428_100934893 | 150 |
| 223 | 3300028380 | Ga0268265_10003468 | Ga0268265_100034683 | 150 |
| 224 | 3300031548 | Ga0307408_100000926 | Ga0307408_10000092612 | 150 |
| 225 | 3300031548 | Ga0307408_100017628 | Ga0307408_1000176286 | 150 |
| 226 | 3300031548 | Ga0307408_100072377 | Ga0307408_1000723773 | 150 |
| 227 | 3300031730 | Ga0307516_10923911 | Ga0307516_109239111 | 150 |
| 228 | 3300031901 | Ga0307406_10000530 | Ga0307406_1000053013 | 150 |
| 229 | 3300031903 | Ga0307407_10050490 | Ga0307407_100504902 | 150 |
| 230 | 3300031911 | Ga0307412_10019028 | Ga0307412_100190286 | 150 |
| 231 | 3300032002 | Ga0307416_100010649 | Ga0307416_1000106494 | 150 |
| 232 | 3300032004 | Ga0307414_10293112 | Ga0307414_102931122 | 150 |
| 233 | 3300034817 | Ga0373948_0053336 | Ga0373948_0053336_48_503 | 150 |
| 234 | 3300037471 | Ga0395905_0198135 | Ga0395905_0198135_753_1217 | 150 |
| 235 | 3300041404 | Ga0439436_0002289 | Ga0439436_0002289_4795_5256 | 150 |
| 236 | 3300041405 | Ga0439438_043902 | Ga0439438_043902_142_603 | 150 |
| 237 | 3300041406 | Ga0439439_0049299 | Ga0439439_0049299_600_1061 | 150 |
| 238 | 3300041411 | Ga0439466_0081898 | Ga0439466_0081898_22_483 | 150 |
| 239 | 3300042006 | Ga0439432_020286 | Ga0439432_020286_1365_1826 | 150 |
| 240 | 3300042007 | Ga0439449_0001822 | Ga0439449_0001822_4801_5262 | 150 |
| 241 | 3300042015 | Ga0439462_0002942 | Ga0439462_0002942_1474_1935 | 150 |
| 242 | 3300042015 | Ga0439462_0136483 | Ga0439462_0136483_168_629 | 150 |
| 243 | 3300042115 | Ga0450911_014977 | Ga0450911_014977_214_675 | 150 |
| 244 | 3300042122 | Ga0450920_006489 | Ga0450920_006489_1482_1943 | 150 |
| 245 | 3300042125 | Ga0450923_007891 | Ga0450923_007891_734_1195 | 150 |
| 246 | 3300042125 | Ga0450923_026559 | Ga0450923_026559_424_885 | 150 |
| 247 | 3300042128 | Ga0450897_019183 | Ga0450897_019183_58_519 | 150 |
| 248 | 3300042131 | Ga0450894_006910 | Ga0450894_006910_605_1066 | 150 |
| 249 | 3300042145 | Ga0450906_035608 | Ga0450906_035608_71_532 | 150 |
| 250 | 3300042156 | Ga0439446_0020533 | Ga0439446_0020533_143_604 | 150 |
| 251 | 3300042156 | Ga0439446_0074031 | Ga0439446_0074031_396_857 | 150 |
| 252 | 3300042185 | Ga0450909_005967 | Ga0450909_005967_863_1324 | 150 |
| 253 | 3300042435 | Ga0439434_0015977 | Ga0439434_0015977_492_953 | 150 |
| 254 | 3300042436 | Ga0439435_0121905 | Ga0439435_0121905_121_582 | 150 |
| 255 | 3300042438 | Ga0439459_0021413 | Ga0439459_0021413_77_538 | 150 |
| 256 | 3300042439 | Ga0439464_0161633 | Ga0439464_0161633_82_543 | 150 |
| 257 | 3300042532 | Ga0450893_0032267 | Ga0450893_0032267_243_704 | 150 |
| 258 | 3300044842 | Ga0466957_0458910 | Ga0466957_0458910_77_538 | 150 |
| 259 | 3300045051 | Ga0451576_0086095 | Ga0451576_0086095_2417_2869 | 150 |
| 260 | 3300046457 | Ga0495590_0001242 | Ga0495590_0001242_7716_8177 | 150 |
| 261 | 3300046459 | Ga0495629_0429509 | Ga0495629_0429509_112_573 | 150 |
| 262 | 3300046500 | Ga0495596_0180299 | Ga0495596_0180299_342_803 | 150 |
| 263 | 3300046507 | Ga0495606_0055462 | Ga0495606_0055462_215_676 | 150 |
| 264 | 3300046512 | Ga0495610_0014119 | Ga0495610_0014119_453_914 | 150 |
| 265 | 3300046513 | Ga0495616_0002706 | Ga0495616_0002706_2215_2676 | 150 |
| 266 | 3300046515 | Ga0495620_0007723 | Ga0495620_0007723_4882_5343 | 150 |
| 267 | 3300046517 | Ga0495630_0733761 | Ga0495630_0733761_214_675 | 150 |
| 268 | 3300046518 | Ga0495631_0000007 | Ga0495631_0000007_80824_81285 | 150 |
| 269 | 3300046520 | Ga0495637_0155607 | Ga0495637_0155607_162_623 | 150 |
| 270 | 3300046542 | Ga0495597_0100199 | Ga0495597_0100199_351_812 | 150 |
| 271 | 3300046660 | Ga0495625_0000056 | Ga0495625_0000056_61034_61495 | 150 |
| 272 | 3300046660 | Ga0495625_0156761 | Ga0495625_0156761_302_763 | 150 |
| 273 | 3300046674 | Ga0495588_0218424 | Ga0495588_0218424_519_980 | 150 |
| 274 | 3300046690 | Ga0495624_0485495 | Ga0495624_0485495_33_494 | 150 |
| 275 | 3300046691 | Ga0495670_0084782 | Ga0495670_0084782_420_881 | 150 |
| 276 | 3300046794 | Ga0495589_0519939 | Ga0495589_0519939_53_514 | 150 |
| 277 | 3300046809 | Ga0495600_0227112 | Ga0495600_0227112_137_598 | 150 |
| 278 | 3300046810 | Ga0495660_0090964 | Ga0495660_0090964_355_816 | 150 |
| 279 | 3300046810 | Ga0495660_0135472 | Ga0495660_0135472_717_1178 | 150 |
| 280 | 3300047317 | Ga0495604_0003914 | Ga0495604_0003914_258_719 | 150 |
| 281 | 3300047321 | Ga0495676_0059065 | Ga0495676_0059065_1401_1862 | 150 |
| 282 | 3300047323 | Ga0495683_0000483 | Ga0495683_0000483_27763_28224 | 150 |
| 283 | 3300047323 | Ga0495683_0040476 | Ga0495683_0040476_31_492 | 150 |
| 284 | 3300047443 | Ga0495687_010068 | Ga0495687_010068_1875_2336 | 150 |
| 285 | 3300047445 | Ga0495677_0147119 | Ga0495677_0147119_184_636 | 150 |
| 286 | 3300047469 | Ga0495673_0175641 | Ga0495673_0175641_255_716 | 150 |
| 287 | 3300047673 | Ga0495593_0031481 | Ga0495593_0031481_2348_2809 | 150 |
| 288 | 3300047673 | Ga0495593_0040623 | Ga0495593_0040623_1735_2196 | 150 |
| 289 | 3300048088 | Ga0495602_0017599 | Ga0495602_0017599_6672_7133 | 150 |
| 290 | 3300048088 | Ga0495602_0038320 | Ga0495602_0038320_3752_4213 | 150 |
| 291 | 3300048091 | Ga0495626_0009926 | Ga0495626_0009926_2800_3261 | 150 |
| 292 | 3300048903 | Ga0496100_0101416 | Ga0496100_0101416_580_1041 | 150 |
| 293 | 3300048904 | Ga0496101_0019182 | Ga0496101_0019182_161_622 | 150 |
| 294 | 3300048905 | Ga0496102_0011536 | Ga0496102_0011536_1734_2195 | 150 |
| 295 | 3300048906 | Ga0496103_0004113 | Ga0496103_0004113_5972_6433 | 150 |
| 296 | 3300048909 | Ga0496106_0034656 | Ga0496106_0034656_1335_1796 | 150 |
| 297 | 3300048910 | Ga0496107_0007427 | Ga0496107_0007427_6769_7230 | 150 |
| 298 | 3300048911 | Ga0496108_0767753 | Ga0496108_0767753_121_582 | 150 |
| 299 | 3300048913 | Ga0496110_0033465 | Ga0496110_0033465_1397_1858 | 150 |
| 300 | 3300048914 | Ga0496111_0097044 | Ga0496111_0097044_245_706 | 150 |
| 301 | 3300048915 | Ga0496112_0049701 | Ga0496112_0049701_2739_3200 | 150 |
| 302 | 3300048916 | Ga0496113_0004854 | Ga0496113_0004854_7167_7628 | 150 |
| 303 | 3300048919 | Ga0496116_0067882 | Ga0496116_0067882_667_1128 | 150 |
| 304 | 3300048919 | Ga0496116_0210565 | Ga0496116_0210565_58_519 | 150 |
| 305 | 3300048920 | Ga0496117_0018250 | Ga0496117_0018250_2888_3349 | 150 |
| 306 | 3300048920 | Ga0496117_0142136 | Ga0496117_0142136_561_1022 | 150 |
| 307 | 3300048921 | Ga0496118_0038446 | Ga0496118_0038446_1392_1853 | 150 |
| 308 | 3300048921 | Ga0496118_0064386 | Ga0496118_0064386_1242_1703 | 150 |
| 309 | 3300048924 | Ga0496121_0019431 | Ga0496121_0019431_563_1024 | 150 |
| 310 | 3300048924 | Ga0496121_0200367 | Ga0496121_0200367_420_881 | 150 |
| 311 | 3300048925 | Ga0496122_0097709 | Ga0496122_0097709_121_582 | 150 |
| 312 | 3300048925 | Ga0496122_0107920 | Ga0496122_0107920_1206_1667 | 150 |
| 313 | 3300048926 | Ga0496123_0061360 | Ga0496123_0061360_1505_1966 | 150 |
| 314 | 3300048926 | Ga0496123_0489792 | Ga0496123_0489792_66_527 | 150 |
| 315 | 3300048927 | Ga0496124_0019236 | Ga0496124_0019236_1073_1534 | 150 |
| 316 | 3300048927 | Ga0496124_0109845 | Ga0496124_0109845_629_1090 | 150 |
| 317 | 3300048927 | Ga0496124_0199425 | Ga0496124_0199425_879_1340 | 150 |
| 318 | 3300048928 | Ga0496125_0018669 | Ga0496125_0018669_501_962 | 150 |
| 319 | 3300048928 | Ga0496125_0152093 | Ga0496125_0152093_758_1219 | 150 |
| 320 | 3300049129 | Ga0501309_017261 | Ga0501309_017261_481_933 | 150 |
| 321 | 3300049459 | Ga0495678_043424 | Ga0495678_043424_794_1255 | 150 |
| 322 | 3300049515 | Ga0501292_060251 | Ga0501292_060251_81_533 | 150 |
| 323 | 3300049517 | Ga0501294_024554 | Ga0501294_024554_136_588 | 150 |
| 324 | 3300049653 | Ga0501206_000487 | Ga0501206_000487_575_1027 | 150 |
| 325 | 3300049654 | Ga0501207_075224 | Ga0501207_075224_85_537 | 150 |
| 326 | 3300049759 | Ga0501262_010025 | Ga0501262_010025_609_1061 | 150 |
| 327 | 3300049762 | Ga0501265_003053 | Ga0501265_003053_1060_1512 | 150 |
| 328 | 3300050489 | nmdc:mga03683_545_c1 | nmdc:mga03683_545_c1_5631_6092 | 150 |
| 329 | 3300050490 | nmdc:mga03n38_29907_c1 | nmdc:mga03n38_29907_c1_1200_1661 | 150 |
| 330 | 3300050490 | nmdc:mga03n38_9667_c1 | nmdc:mga03n38_9667_c1_557_1018 | 150 |
| 331 | 3300050491 | nmdc:mga00v17_1957_c1 | nmdc:mga00v17_1957_c1_5567_6028 | 150 |
| 332 | 3300050491 | nmdc:mga00v17_620390_c1 | nmdc:mga00v17_620390_c1_74_535 | 150 |
| 333 | 3300050492 | nmdc:mga0yw44_822_c1 | nmdc:mga0yw44_822_c1_10561_11022 | 150 |
| 334 | 3300050493 | nmdc:mga0k408_11610_c1 | nmdc:mga0k408_11610_c1_1654_2109 | 150 |
| 335 | 3300050493 | nmdc:mga0k408_40895_c1 | nmdc:mga0k408_40895_c1_792_1253 | 150 |
| 336 | 3300050494 | nmdc:mga06z11_267741_c1 | nmdc:mga06z11_267741_c1_349_810 | 150 |
| 337 | 3300050494 | nmdc:mga06z11_80647_c1 | nmdc:mga06z11_80647_c1_944_1405 | 150 |
| 338 | 3300050495 | nmdc:mga04h51_135699_c1 | nmdc:mga04h51_135699_c1_402_863 | 150 |
| 339 | 3300050496 | nmdc:mga07m45_1263_c1 | nmdc:mga07m45_1263_c1_238_699 | 150 |
| 340 | 3300050496 | nmdc:mga07m45_570823_c1 | nmdc:mga07m45_570823_c1_122_583 | 150 |
| 341 | 3300050496 | nmdc:mga07m45_82856_c1 | nmdc:mga07m45_82856_c1_1354_1815 | 150 |
| 342 | 3300050496 | nmdc:mga07m45_98435_c1 | nmdc:mga07m45_98435_c1_40_495 | 150 |
| 343 | 3300053087 | Ga0500643_013144 | Ga0500643_013144_1792_2253 | 150 |
| 344 | 3300053093 | Ga0500651_0000957 | Ga0500651_0000957_13322_13783 | 150 |
| 345 | 3300053110 | Ga0500571_000024 | Ga0500571_000024_38849_39310 | 150 |
| 346 | 3300053116 | Ga0500592_008481 | Ga0500592_008481_724_1185 | 150 |
| 347 | 3300053125 | Ga0500618_031463 | Ga0500618_031463_335_796 | 150 |
| 348 | 3300053136 | Ga0500559_0027986 | Ga0500559_0027986_111_572 | 150 |
| 349 | 3300053138 | Ga0500564_068558 | Ga0500564_068558_576_1037 | 150 |
| 350 | 3300053139 | Ga0500568_0003259 | Ga0500568_0003259_6156_6617 | 150 |
| 351 | 3300053141 | Ga0500574_007237 | Ga0500574_007237_1335_1796 | 150 |
| 352 | 3300053154 | Ga0500619_193608 | Ga0500619_193608_80_541 | 150 |
| 353 | 3300053162 | Ga0500638_004803 | Ga0500638_004803_1239_1700 | 150 |
| 354 | 3300053177 | Ga0500636_0153160 | Ga0500636_0153160_397_858 | 150 |
| 355 | 3300053734 | Ga0500565_022799 | Ga0500565_022799_192_653 | 150 |
| 356 | 3300059641 | Ga0587068_024858 | Ga0587068_024858_149_610 | 150 |
| 357 | 3300059645 | Ga0587076_023408 | Ga0587076_023408_192_653 | 150 |
| 358 | iso_pu_bacteria | 2863421361 | 2863422838 | 150 |
| 359 | 3300005327 | Ga0070658_10027600 | Ga0070658_100276003 | 151 |
| 360 | 3300005328 | Ga0070676_10018812 | Ga0070676_100188122 | 151 |
| 361 | 3300005328 | Ga0070676_10139974 | Ga0070676_101399743 | 151 |
| 362 | 3300005331 | Ga0070670_100000540 | Ga0070670_10000054017 | 151 |
| 363 | 3300005331 | Ga0070670_100022297 | Ga0070670_1000222974 | 151 |
| 364 | 3300005331 | Ga0070670_100068177 | Ga0070670_1000681773 | 151 |
| 365 | 3300005334 | Ga0068869_100002271 | Ga0068869_10000227111 | 151 |
| 366 | 3300005338 | Ga0068868_100032080 | Ga0068868_1000320802 | 151 |
| 367 | 3300005339 | Ga0070660_100108727 | Ga0070660_1001087273 | 151 |
| 368 | 3300005344 | Ga0070661_100052691 | Ga0070661_1000526912 | 151 |
| 369 | 3300005347 | Ga0070668_100110348 | Ga0070668_1001103482 | 151 |
| 370 | 3300005353 | Ga0070669_100020431 | Ga0070669_1000204313 | 151 |
| 371 | 3300005355 | Ga0070671_100020456 | Ga0070671_1000204567 | 151 |
| 372 | 3300005366 | Ga0070659_100057651 | Ga0070659_1000576514 | 151 |
| 373 | 3300005367 | Ga0070667_100005867 | Ga0070667_1000058678 | 151 |
| 374 | 3300005440 | Ga0070705_100168650 | Ga0070705_1001686502 | 151 |
| 375 | 3300005441 | Ga0070700_100352045 | Ga0070700_1003520451 | 151 |
| 376 | 3300005455 | Ga0070663_100365164 | Ga0070663_1003651642 | 151 |
| 377 | 3300005455 | Ga0070663_100380086 | Ga0070663_1003800862 | 151 |
| 378 | 3300005455 | Ga0070663_100588954 | Ga0070663_1005889542 | 151 |
| 379 | 3300005457 | Ga0070662_100521362 | Ga0070662_1005213621 | 151 |
| 380 | 3300005459 | Ga0068867_100058308 | Ga0068867_1000583082 | 151 |
| 381 | 3300005459 | Ga0068867_100546421 | Ga0068867_1005464212 | 151 |
| 382 | 3300005467 | Ga0070706_100765192 | Ga0070706_1007651921 | 151 |
| 383 | 3300005468 | Ga0070707_101217524 | Ga0070707_1012175241 | 151 |
| 384 | 3300005535 | Ga0070684_100203830 | Ga0070684_1002038302 | 151 |
| 385 | 3300005543 | Ga0070672_101234742 | Ga0070672_1012347422 | 151 |
| 386 | 3300005545 | Ga0070695_100150446 | Ga0070695_1001504463 | 151 |
| 387 | 3300005546 | Ga0070696_100527259 | Ga0070696_1005272592 | 151 |
| 388 | 3300005547 | Ga0070693_100101426 | Ga0070693_1001014262 | 151 |
| 389 | 3300005564 | Ga0070664_100005230 | Ga0070664_10000523012 | 151 |
| 390 | 3300005577 | Ga0068857_100334396 | Ga0068857_1003343963 | 151 |
| 391 | 3300005614 | Ga0068856_100414966 | Ga0068856_1004149663 | 151 |
| 392 | 3300005616 | Ga0068852_100018858 | Ga0068852_1000188584 | 151 |
| 393 | 3300005616 | Ga0068852_100168530 | Ga0068852_1001685302 | 151 |
| 394 | 3300005617 | Ga0068859_100057856 | Ga0068859_1000578563 | 151 |
| 395 | 3300005617 | Ga0068859_100116942 | Ga0068859_1001169422 | 151 |
| 396 | 3300005617 | Ga0068859_100632211 | Ga0068859_1006322112 | 151 |
| 397 | 3300005618 | Ga0068864_100003727 | Ga0068864_10000372712 | 151 |
| 398 | 3300005618 | Ga0068864_100025373 | Ga0068864_1000253732 | 151 |
| 399 | 3300005719 | Ga0068861_100006842 | Ga0068861_1000068428 | 151 |
| 400 | 3300005834 | Ga0068851_10121300 | Ga0068851_101213003 | 151 |
| 401 | 3300005840 | Ga0068870_10001893 | Ga0068870_100018939 | 151 |
| 402 | 3300005841 | Ga0068863_100085322 | Ga0068863_1000853223 | 151 |
| 403 | 3300005841 | Ga0068863_100086430 | Ga0068863_1000864303 | 151 |
| 404 | 3300005842 | Ga0068858_100011316 | Ga0068858_1000113168 | 151 |
| 405 | 3300005843 | Ga0068860_100013006 | Ga0068860_1000130068 | 151 |
| 406 | 3300005844 | Ga0068862_100028341 | Ga0068862_1000283412 | 151 |
| 407 | 3300005985 | Ga0081539_10266234 | Ga0081539_102662342 | 151 |
| 408 | 3300006358 | Ga0068871_101061949 | Ga0068871_1010619491 | 151 |
| 409 | 3300006931 | Ga0097620_100057853 | Ga0097620_1000578533 | 151 |
| 410 | 3300006931 | Ga0097620_100116928 | Ga0097620_1001169282 | 151 |
| 411 | 3300006931 | Ga0097620_100632069 | Ga0097620_1006320692 | 151 |
| 412 | 3300009011 | Ga0105251_10000005 | Ga0105251_1000000547 | 151 |
| 413 | 3300009011 | Ga0105251_10003188 | Ga0105251_100031885 | 151 |
| 414 | 3300009093 | Ga0105240_10004916 | Ga0105240_1000491611 | 151 |
| 415 | 3300009098 | Ga0105245_10014386 | Ga0105245_100143867 | 151 |
| 416 | 3300009098 | Ga0105245_10374711 | Ga0105245_103747112 | 151 |
| 417 | 3300009101 | Ga0105247_10034404 | Ga0105247_100344043 | 151 |
| 418 | 3300009148 | Ga0105243_10165120 | Ga0105243_101651202 | 151 |
| 419 | 3300009174 | Ga0105241_10169198 | Ga0105241_101691983 | 151 |
| 420 | 3300009177 | Ga0105248_10006219 | Ga0105248_1000621913 | 151 |
| 421 | 3300009177 | Ga0105248_10236846 | Ga0105248_102368462 | 151 |
| 422 | 3300009177 | Ga0105248_10639287 | Ga0105248_106392872 | 151 |
| 423 | 3300009177 | Ga0105248_11017885 | Ga0105248_110178852 | 151 |
| 424 | 3300009545 | Ga0105237_10141187 | Ga0105237_101411872 | 151 |
| 425 | 3300009545 | Ga0105237_10377768 | Ga0105237_103777682 | 151 |
| 426 | 3300009551 | Ga0105238_10671102 | Ga0105238_106711021 | 151 |
| 427 | 3300009553 | Ga0105249_10276877 | Ga0105249_102768772 | 151 |
| 428 | 3300013105 | Ga0157369_10546899 | Ga0157369_105468992 | 151 |
| 429 | 3300013296 | Ga0157374_10043751 | Ga0157374_100437515 | 151 |
| 430 | 3300013296 | Ga0157374_10223274 | Ga0157374_102232743 | 151 |
| 431 | 3300013297 | Ga0157378_10010746 | Ga0157378_100107468 | 151 |
| 432 | 3300013306 | Ga0163162_10160493 | Ga0163162_101604934 | 151 |
| 433 | 3300013306 | Ga0163162_11008243 | Ga0163162_110082432 | 151 |
| 434 | 3300013307 | Ga0157372_10166010 | Ga0157372_101660103 | 151 |
| 435 | 3300013308 | Ga0157375_10194238 | Ga0157375_101942382 | 151 |
| 436 | 3300014325 | Ga0163163_10128554 | Ga0163163_101285542 | 151 |
| 437 | 3300014325 | Ga0163163_10574087 | Ga0163163_105740872 | 151 |
| 438 | 3300014968 | Ga0157379_10021652 | Ga0157379_100216526 | 151 |
| 439 | 3300025315 | Ga0207697_10041147 | Ga0207697_100411472 | 151 |
| 440 | 3300025321 | Ga0207656_10008463 | Ga0207656_100084632 | 151 |
| 441 | 3300025735 | Ga0207713_1000036 | Ga0207713_1000036155 | 151 |
| 442 | 3300025735 | Ga0207713_1002789 | Ga0207713_10027895 | 151 |
| 443 | 3300025903 | Ga0207680_10060019 | Ga0207680_100600192 | 151 |
| 444 | 3300025907 | Ga0207645_10031101 | Ga0207645_100311014 | 151 |
| 445 | 3300025909 | Ga0207705_10084916 | Ga0207705_100849162 | 151 |
| 446 | 3300025913 | Ga0207695_10333238 | Ga0207695_103332382 | 151 |
| 447 | 3300025914 | Ga0207671_10343119 | Ga0207671_103431192 | 151 |
| 448 | 3300025919 | Ga0207657_10985322 | Ga0207657_109853222 | 151 |
| 449 | 3300025923 | Ga0207681_10033213 | Ga0207681_100332133 | 151 |
| 450 | 3300025924 | Ga0207694_10677670 | Ga0207694_106776701 | 151 |
| 451 | 3300025924 | Ga0207694_10797322 | Ga0207694_107973222 | 151 |
| 452 | 3300025925 | Ga0207650_10005387 | Ga0207650_100053872 | 151 |
| 453 | 3300025925 | Ga0207650_10007014 | Ga0207650_100070143 | 151 |
| 454 | 3300025925 | Ga0207650_10088595 | Ga0207650_100885953 | 151 |
| 455 | 3300025925 | Ga0207650_10201358 | Ga0207650_102013582 | 151 |
| 456 | 3300025927 | Ga0207687_10012072 | Ga0207687_100120725 | 151 |
| 457 | 3300025931 | Ga0207644_10007558 | Ga0207644_100075582 | 151 |
| 458 | 3300025933 | Ga0207706_10534820 | Ga0207706_105348202 | 151 |
| 459 | 3300025940 | Ga0207691_10423659 | Ga0207691_104236591 | 151 |
| 460 | 3300025941 | Ga0207711_10015519 | Ga0207711_100155197 | 151 |
| 461 | 3300025941 | Ga0207711_10397875 | Ga0207711_103978752 | 151 |
| 462 | 3300025942 | Ga0207689_10000556 | Ga0207689_1000055616 | 151 |
| 463 | 3300025945 | Ga0207679_10026449 | Ga0207679_100264495 | 151 |
| 464 | 3300025972 | Ga0207668_10017548 | Ga0207668_100175484 | 151 |
| 465 | 3300025986 | Ga0207658_10006734 | Ga0207658_100067342 | 151 |
| 466 | 3300026023 | Ga0207677_10010768 | Ga0207677_100107683 | 151 |
| 467 | 3300026023 | Ga0207677_11861798 | Ga0207677_118617981 | 151 |
| 468 | 3300026035 | Ga0207703_10005102 | Ga0207703_1000510210 | 151 |
| 469 | 3300026067 | Ga0207678_10420443 | Ga0207678_104204432 | 151 |
| 470 | 3300026088 | Ga0207641_10050978 | Ga0207641_100509783 | 151 |
| 471 | 3300026088 | Ga0207641_10067199 | Ga0207641_100671993 | 151 |
| 472 | 3300026089 | Ga0207648_10194167 | Ga0207648_101941672 | 151 |
| 473 | 3300026089 | Ga0207648_10232950 | Ga0207648_102329502 | 151 |
| 474 | 3300026089 | Ga0207648_10673350 | Ga0207648_106733502 | 151 |
| 475 | 3300026095 | Ga0207676_10004509 | Ga0207676_100045099 | 151 |
| 476 | 3300026095 | Ga0207676_10237638 | Ga0207676_102376382 | 151 |
| 477 | 3300026095 | Ga0207676_10495173 | Ga0207676_104951732 | 151 |
| 478 | 3300026118 | Ga0207675_100000530 | Ga0207675_10000053023 | 151 |
| 479 | 3300026142 | Ga0207698_10057456 | Ga0207698_100574563 | 151 |
| 480 | 3300026142 | Ga0207698_10323557 | Ga0207698_103235571 | 151 |
| 481 | 3300028380 | Ga0268265_10024384 | Ga0268265_100243845 | 151 |
| 482 | 3300028381 | Ga0268264_10001980 | Ga0268264_1000198014 | 151 |
| 483 | 3300028794 | Ga0307515_10610861 | Ga0307515_106108611 | 151 |
| 484 | 3300031548 | Ga0307408_100884878 | Ga0307408_1008848782 | 151 |
| 485 | 3300037471 | Ga0395905_1115185 | Ga0395905_1115185_22_480 | 151 |
| 486 | 3300041997 | Ga0439431_0016108 | Ga0439431_0016108_139_594 | 151 |
| 487 | 3300042876 | Ga0451577_0984295 | Ga0451577_0984295_27_488 | 151 |
| 488 | 3300044693 | Ga0466961_0000383 | Ga0466961_0000383_7642_8136 | 151 |
| 489 | 3300044706 | Ga0466964_0233160 | Ga0466964_0233160_215_709 | 151 |
| 490 | 3300045049 | Ga0466959_0551113 | Ga0466959_0551113_193_687 | 151 |
| 491 | 3300046522 | Ga0495643_0000261 | Ga0495643_0000261_41837_42292 | 151 |
| 492 | 3300046529 | Ga0495652_0072702 | Ga0495652_0072702_1302_1757 | 151 |
| 493 | 3300046616 | Ga0495668_0032056 | Ga0495668_0032056_811_1266 | 151 |
| 494 | 3300048911 | Ga0496108_0220724 | Ga0496108_0220724_433_891 | 151 |
| 495 | 3300048911 | Ga0496108_0726060 | Ga0496108_0726060_63_542 | 151 |
| 496 | 3300048912 | Ga0496109_0156865 | Ga0496109_0156865_588_1046 | 151 |
| 497 | 3300048915 | Ga0496112_1626283 | Ga0496112_1626283_19_498 | 151 |
| 498 | 3300048925 | Ga0496122_0037608 | Ga0496122_0037608_923_1378 | 151 |
| 499 | 3300048926 | Ga0496123_0085045 | Ga0496123_0085045_310_765 | 151 |
| 500 | 3300048927 | Ga0496124_0397733 | Ga0496124_0397733_81_536 | 151 |
| 501 | 3300049460 | Ga0495682_0000254 | Ga0495682_0000254_25125_25580 | 151 |
| 502 | 3300049571 | Ga0501034_0000003 | Ga0501034_0000003_154612_155067 | 151 |
| 503 | 3300049580 | Ga0501046_1138357 | Ga0501046_1138357_58_525 | 151 |
| 504 | 3300049582 | Ga0501048_0582599 | Ga0501048_0582599_76_543 | 151 |
| 505 | 3300049588 | Ga0501072_0224223 | Ga0501072_0224223_463_930 | 151 |
| 506 | iso_pu_bacteria | 2904483920 | 2904486920 | 151 |
| 507 | iso_pu_bacteria | 2919527303 | 2919528234 | 151 |
| 508 | 3300001915 | JGI24741J21665_1000084 | JGI24741J21665_100008417 | 152 |
| 509 | 3300001979 | JGI24740J21852_10000038 | JGI24740J21852_1000003823 | 152 |
| 510 | 3300001979 | JGI24740J21852_10000091 | JGI24740J21852_1000009118 | 152 |
| 511 | 3300002705 | JGI25156J39149_1000006 | JGI25156J39149_100000680 | 152 |
| 512 | 3300002705 | JGI25156J39149_1000135 | JGI25156J39149_100013546 | 152 |
| 513 | 3300002705 | JGI25156J39149_1006100 | JGI25156J39149_10061002 | 152 |
| 514 | 3300002705 | JGI25156J39149_1006124 | JGI25156J39149_10061243 | 152 |
| 515 | 3300002705 | JGI25156J39149_1006256 | JGI25156J39149_10062564 | 152 |
| 516 | 3300002705 | JGI25156J39149_1016753 | JGI25156J39149_10167532 | 152 |
| 517 | 3300002705 | JGI25156J39149_1026051 | JGI25156J39149_10260512 | 152 |
| 518 | 3300002738 | JGI25154J39366_1000389 | JGI25154J39366_100038918 | 152 |
| 519 | 3300002741 | JGI25157J39369_1000016 | JGI25157J39369_1000016102 | 152 |
| 520 | 3300003187 | JGI25151J46595_10086425 | JGI25151J46595_100864252 | 152 |
| 521 | 3300003214 | JGI25165J46597_1000661 | JGI25165J46597_100066113 | 152 |
| 522 | 3300003316 | rootH1_10048720 | rootH1_100487203 | 152 |
| 523 | 3300003316 | rootH1_10054218 | rootH1_100542186 | 152 |
| 524 | 3300003320 | rootH2_10050565 | rootH2_100505652 | 152 |
| 525 | 3300003322 | rootL2_10009476 | rootL2_1000947610 | 152 |
| 526 | 3300003322 | rootL2_10137787 | rootL2_101377878 | 152 |
| 527 | 3300003323 | rootH1_10201936 | rootH1_102019362 | 152 |
| 528 | 3300003354 | JGI25160J50197_1000098 | JGI25160J50197_100009873 | 152 |
| 529 | 3300003374 | JGI25161J50226_1000037 | JGI25161J50226_1000037111 | 152 |
| 530 | 3300003752 | Ga0055539_1000075 | Ga0055539_100007517 | 152 |
| 531 | 3300003756 | Ga0055533_1000140 | Ga0055533_100014011 | 152 |
| 532 | 3300003756 | Ga0055533_1000933 | Ga0055533_10009335 | 152 |
| 533 | 3300003758 | Ga0055532_1000003 | Ga0055532_1000003251 | 152 |
| 534 | 3300003758 | Ga0055532_1000056 | Ga0055532_1000056129 | 152 |
| 535 | 3300003758 | Ga0055532_1000265 | Ga0055532_100026520 | 152 |
| 536 | 3300003758 | Ga0055532_1005641 | Ga0055532_10056413 | 152 |
| 537 | 3300003759 | Ga0055525_1000492 | Ga0055525_10004926 | 152 |
| 538 | 3300003759 | Ga0055525_1011031 | Ga0055525_10110312 | 152 |
| 539 | 3300003760 | Ga0055527_1000006 | Ga0055527_1000006205 | 152 |
| 540 | 3300003760 | Ga0055527_1000323 | Ga0055527_100032320 | 152 |
| 541 | 3300003760 | Ga0055527_1002493 | Ga0055527_10024933 | 152 |
| 542 | 3300003760 | Ga0055527_1005009 | Ga0055527_10050092 | 152 |
| 543 | 3300003761 | Ga0055535_1000003 | Ga0055535_1000003251 | 152 |
| 544 | 3300003761 | Ga0055535_1000013 | Ga0055535_1000013245 | 152 |
| 545 | 3300003761 | Ga0055535_1000134 | Ga0055535_100013451 | 152 |
| 546 | 3300003761 | Ga0055535_1000701 | Ga0055535_100070120 | 152 |
| 547 | 3300003762 | Ga0055542_1000007 | Ga0055542_1000007251 | 152 |
| 548 | 3300003762 | Ga0055542_1000178 | Ga0055542_100017851 | 152 |
| 549 | 3300003762 | Ga0055542_1000861 | Ga0055542_100086117 | 152 |
| 550 | 3300003762 | Ga0055542_1002118 | Ga0055542_10021183 | 152 |
| 551 | 3300003763 | Ga0055529_1000003 | Ga0055529_1000003205 | 152 |
| 552 | 3300003763 | Ga0055529_1000074 | Ga0055529_100007426 | 152 |
| 553 | 3300003763 | Ga0055529_1000203 | Ga0055529_100020351 | 152 |
| 554 | 3300003771 | Ga0055526_1000184 | Ga0055526_100018414 | 152 |
| 555 | 3300003773 | Ga0055537_1000006 | Ga0055537_1000006115 | 152 |
| 556 | 3300003775 | Ga0055524_1000032 | Ga0055524_100003228 | 152 |
| 557 | 3300003781 | Ga0055536_1005877 | Ga0055536_10058776 | 152 |
| 558 | 3300003784 | Ga0055534_1004608 | Ga0055534_10046084 | 152 |
| 559 | 3300003790 | Ga0055528_1002844 | Ga0055528_10028443 | 152 |
| 560 | 3300003790 | Ga0055528_1003256 | Ga0055528_10032569 | 152 |
| 561 | 3300003791 | Ga0055530_10000731 | Ga0055530_1000073129 | 152 |
| 562 | 3300003791 | Ga0055530_10000890 | Ga0055530_100008902 | 152 |
| 563 | 3300003792 | Ga0055540_1000046 | Ga0055540_1000046142 | 152 |
| 564 | 3300003794 | Ga0055531_10003007 | Ga0055531_100030074 | 152 |
| 565 | 3300003841 | Ga0055541_1000425 | Ga0055541_10004253 | 152 |
| 566 | 3300003841 | Ga0055541_1002842 | Ga0055541_10028421 | 152 |
| 567 | 3300003856 | Ga0058692_1008655 | Ga0058692_10086552 | 152 |
| 568 | 3300004625 | Ga0055543_1000645 | Ga0055543_100064516 | 152 |
| 569 | 3300005262 | Ga0065165_1000821 | Ga0065165_100082118 | 152 |
| 570 | 3300005262 | Ga0065165_1022462 | Ga0065165_10224623 | 152 |
| 571 | 3300005262 | Ga0065165_1022630 | Ga0065165_10226302 | 152 |
| 572 | 3300005327 | Ga0070658_10092842 | Ga0070658_100928423 | 152 |
| 573 | 3300005327 | Ga0070658_10247226 | Ga0070658_102472262 | 152 |
| 574 | 3300005328 | Ga0070676_10149055 | Ga0070676_101490552 | 152 |
| 575 | 3300005339 | Ga0070660_100000029 | Ga0070660_10000002980 | 152 |
| 576 | 3300005339 | Ga0070660_100015930 | Ga0070660_1000159302 | 152 |
| 577 | 3300005344 | Ga0070661_100001417 | Ga0070661_10000141722 | 152 |
| 578 | 3300005344 | Ga0070661_100400221 | Ga0070661_1004002213 | 152 |
| 579 | 3300005355 | Ga0070671_100048591 | Ga0070671_1000485913 | 152 |
| 580 | 3300005356 | Ga0070674_101228322 | Ga0070674_1012283222 | 152 |
| 581 | 3300005364 | Ga0070673_100266969 | Ga0070673_1002669693 | 152 |
| 582 | 3300005366 | Ga0070659_100000006 | Ga0070659_1000000065 | 152 |
| 583 | 3300005366 | Ga0070659_100000307 | Ga0070659_10000030720 | 152 |
| 584 | 3300005367 | Ga0070667_100216118 | Ga0070667_1002161182 | 152 |
| 585 | 3300005367 | Ga0070667_100909936 | Ga0070667_1009099362 | 152 |
| 586 | 3300005445 | Ga0070708_100027484 | Ga0070708_1000274843 | 152 |
| 587 | 3300005455 | Ga0070663_100000002 | Ga0070663_100000002243 | 152 |
| 588 | 3300005455 | Ga0070663_100018810 | Ga0070663_1000188104 | 152 |
| 589 | 3300005455 | Ga0070663_100288472 | Ga0070663_1002884722 | 152 |
| 590 | 3300005455 | Ga0070663_100293494 | Ga0070663_1002934942 | 152 |
| 591 | 3300005455 | Ga0070663_100398795 | Ga0070663_1003987952 | 152 |
| 592 | 3300005456 | Ga0070678_100359437 | Ga0070678_1003594372 | 152 |
| 593 | 3300005457 | Ga0070662_100179746 | Ga0070662_1001797462 | 152 |
| 594 | 3300005457 | Ga0070662_100867174 | Ga0070662_1008671742 | 152 |
| 595 | 3300005467 | Ga0070706_100008574 | Ga0070706_10000857410 | 152 |
| 596 | 3300005539 | Ga0068853_100115482 | Ga0068853_1001154823 | 152 |
| 597 | 3300005539 | Ga0068853_101622124 | Ga0068853_1016221241 | 152 |
| 598 | 3300005543 | Ga0070672_100013787 | Ga0070672_1000137875 | 152 |
| 599 | 3300005563 | Ga0068855_100445628 | Ga0068855_1004456283 | 152 |
| 600 | 3300005563 | Ga0068855_100540458 | Ga0068855_1005404582 | 152 |
| 601 | 3300005563 | Ga0068855_100830538 | Ga0068855_1008305382 | 152 |
| 602 | 3300005564 | Ga0070664_100000004 | Ga0070664_100000004244 | 152 |
| 603 | 3300005577 | Ga0068857_100057826 | Ga0068857_1000578263 | 152 |
| 604 | 3300005577 | Ga0068857_100389899 | Ga0068857_1003898992 | 152 |
| 605 | 3300005578 | Ga0068854_100000007 | Ga0068854_10000000775 | 152 |
| 606 | 3300005578 | Ga0068854_101469546 | Ga0068854_1014695461 | 152 |
| 607 | 3300005614 | Ga0068856_100000105 | Ga0068856_10000010517 | 152 |
| 608 | 3300005614 | Ga0068856_101023881 | Ga0068856_1010238812 | 152 |
| 609 | 3300005616 | Ga0068852_100013481 | Ga0068852_1000134812 | 152 |
| 610 | 3300005616 | Ga0068852_100068820 | Ga0068852_1000688205 | 152 |
| 611 | 3300005617 | Ga0068859_100491199 | Ga0068859_1004911992 | 152 |
| 612 | 3300005719 | Ga0068861_101879197 | Ga0068861_1018791972 | 152 |
| 613 | 3300005841 | Ga0068863_100048750 | Ga0068863_1000487502 | 152 |
| 614 | 3300005842 | Ga0068858_101576166 | Ga0068858_1015761662 | 152 |
| 615 | 3300005843 | Ga0068860_100520270 | Ga0068860_1005202701 | 152 |
| 616 | 3300005844 | Ga0068862_100135585 | Ga0068862_1001355853 | 152 |
| 617 | 3300006038 | Ga0075365_10149154 | Ga0075365_101491543 | 152 |
| 618 | 3300006042 | Ga0075368_10204252 | Ga0075368_102042522 | 152 |
| 619 | 3300006048 | Ga0075363_100185993 | Ga0075363_1001859932 | 152 |
| 620 | 3300006178 | Ga0075367_10418751 | Ga0075367_104187511 | 152 |
| 621 | 3300006195 | Ga0075366_10088640 | Ga0075366_100886402 | 152 |
| 622 | 3300006195 | Ga0075366_10308888 | Ga0075366_103088882 | 152 |
| 623 | 3300006237 | Ga0097621_100363184 | Ga0097621_1003631842 | 152 |
| 624 | 3300006353 | Ga0075370_10039542 | Ga0075370_100395423 | 152 |
| 625 | 3300006844 | Ga0075428_100027331 | Ga0075428_1000273315 | 152 |
| 626 | 3300006847 | Ga0075431_101080908 | Ga0075431_1010809082 | 152 |
| 627 | 3300006871 | Ga0075434_100283591 | Ga0075434_1002835913 | 152 |
| 628 | 3300006931 | Ga0097620_100491111 | Ga0097620_1004911112 | 152 |
| 629 | 3300007076 | Ga0075435_100833826 | Ga0075435_1008338262 | 152 |
| 630 | 3300009036 | Ga0105244_10023604 | Ga0105244_100236042 | 152 |
| 631 | 3300009036 | Ga0105244_10060514 | Ga0105244_100605142 | 152 |
| 632 | 3300009092 | Ga0105250_10030058 | Ga0105250_100300582 | 152 |
| 633 | 3300009093 | Ga0105240_10006257 | Ga0105240_1000625711 | 152 |
| 634 | 3300009093 | Ga0105240_10060318 | Ga0105240_100603182 | 152 |
| 635 | 3300009093 | Ga0105240_10088421 | Ga0105240_100884213 | 152 |
| 636 | 3300009093 | Ga0105240_10101797 | Ga0105240_101017973 | 152 |
| 637 | 3300009093 | Ga0105240_10284603 | Ga0105240_102846032 | 152 |
| 638 | 3300009093 | Ga0105240_11165314 | Ga0105240_111653141 | 152 |
| 639 | 3300009093 | Ga0105240_11214318 | Ga0105240_112143182 | 152 |
| 640 | 3300009177 | Ga0105248_10005602 | Ga0105248_100056029 | 152 |
| 641 | 3300009177 | Ga0105248_10011634 | Ga0105248_100116349 | 152 |
| 642 | 3300009545 | Ga0105237_10015527 | Ga0105237_100155275 | 152 |
| 643 | 3300009545 | Ga0105237_10017774 | Ga0105237_100177743 | 152 |
| 644 | 3300009551 | Ga0105238_10014547 | Ga0105238_100145476 | 152 |
| 645 | 3300009551 | Ga0105238_11101693 | Ga0105238_111016932 | 152 |
| 646 | 3300009551 | Ga0105238_11375308 | Ga0105238_113753081 | 152 |
| 647 | 3300010375 | Ga0105239_10014021 | Ga0105239_100140218 | 152 |
| 648 | 3300010375 | Ga0105239_10103451 | Ga0105239_101034514 | 152 |
| 649 | 3300013100 | Ga0157373_10004956 | Ga0157373_1000495610 | 152 |
| 650 | 3300013100 | Ga0157373_10015931 | Ga0157373_100159313 | 152 |
| 651 | 3300013100 | Ga0157373_10711698 | Ga0157373_107116982 | 152 |
| 652 | 3300013102 | Ga0157371_10000086 | Ga0157371_1000008630 | 152 |
| 653 | 3300013102 | Ga0157371_10000223 | Ga0157371_1000022316 | 152 |
| 654 | 3300013102 | Ga0157371_10000986 | Ga0157371_1000098629 | 152 |
| 655 | 3300013102 | Ga0157371_10025877 | Ga0157371_100258772 | 152 |
| 656 | 3300013102 | Ga0157371_10893380 | Ga0157371_108933801 | 152 |
| 657 | 3300013104 | Ga0157370_10000074 | Ga0157370_1000007418 | 152 |
| 658 | 3300013104 | Ga0157370_10059009 | Ga0157370_100590095 | 152 |
| 659 | 3300013104 | Ga0157370_10113281 | Ga0157370_101132812 | 152 |
| 660 | 3300013104 | Ga0157370_11509944 | Ga0157370_115099441 | 152 |
| 661 | 3300013105 | Ga0157369_10000383 | Ga0157369_1000038322 | 152 |
| 662 | 3300013105 | Ga0157369_10001440 | Ga0157369_1000144029 | 152 |
| 663 | 3300013105 | Ga0157369_10001863 | Ga0157369_100018633 | 152 |
| 664 | 3300013105 | Ga0157369_10039961 | Ga0157369_100399614 | 152 |
| 665 | 3300013105 | Ga0157369_10138605 | Ga0157369_101386053 | 152 |
| 666 | 3300013105 | Ga0157369_10147744 | Ga0157369_101477444 | 152 |
| 667 | 3300013105 | Ga0157369_10165598 | Ga0157369_101655982 | 152 |
| 668 | 3300013296 | Ga0157374_10000116 | Ga0157374_1000011653 | 152 |
| 669 | 3300013297 | Ga0157378_10465018 | Ga0157378_104650182 | 152 |
| 670 | 3300013306 | Ga0163162_10005148 | Ga0163162_1000514810 | 152 |
| 671 | 3300013306 | Ga0163162_10043604 | Ga0163162_100436045 | 152 |
| 672 | 3300013307 | Ga0157372_10000085 | Ga0157372_1000008580 | 152 |
| 673 | 3300013307 | Ga0157372_10012524 | Ga0157372_100125242 | 152 |
| 674 | 3300013307 | Ga0157372_10516180 | Ga0157372_105161803 | 152 |
| 675 | 3300013308 | Ga0157375_10007536 | Ga0157375_1000753613 | 152 |
| 676 | 3300014968 | Ga0157379_10074906 | Ga0157379_100749062 | 152 |
| 677 | 3300015261 | Ga0182006_1000317 | Ga0182006_100031721 | 152 |
| 678 | 3300015261 | Ga0182006_1004530 | Ga0182006_10045305 | 152 |
| 679 | 3300015261 | Ga0182006_1006004 | Ga0182006_10060046 | 152 |
| 680 | 3300015261 | Ga0182006_1007384 | Ga0182006_10073842 | 152 |
| 681 | 3300015261 | Ga0182006_1018543 | Ga0182006_10185432 | 152 |
| 682 | 3300015261 | Ga0182006_1204321 | Ga0182006_12043212 | 152 |
| 683 | 3300015262 | Ga0182007_10012055 | Ga0182007_100120552 | 152 |
| 684 | 3300015262 | Ga0182007_10038048 | Ga0182007_100380482 | 152 |
| 685 | 3300015265 | Ga0182005_1103388 | Ga0182005_11033881 | 152 |
| 686 | 3300015683 | Ga0183362_10002 | Ga0183362_100021077 | 152 |
| 687 | 3300017792 | Ga0163161_11784556 | Ga0163161_117845561 | 152 |
| 688 | 3300020610 | Ga0154015_1180002 | Ga0154015_118000220 | 152 |
| 689 | 3300021361 | Ga0213872_10003058 | Ga0213872_100030583 | 152 |
| 690 | 3300025206 | Ga0209435_100010 | Ga0209435_10001090 | 152 |
| 691 | 3300025206 | Ga0209435_101521 | Ga0209435_1015213 | 152 |
| 692 | 3300025208 | Ga0209436_104404 | Ga0209436_1044042 | 152 |
| 693 | 3300025224 | Ga0209784_100008 | Ga0209784_100008443 | 152 |
| 694 | 3300025224 | Ga0209784_100829 | Ga0209784_1008294 | 152 |
| 695 | 3300025224 | Ga0209784_101133 | Ga0209784_1011332 | 152 |
| 696 | 3300025225 | Ga0209566_100006 | Ga0209566_100006443 | 152 |
| 697 | 3300025225 | Ga0209566_100354 | Ga0209566_10035411 | 152 |
| 698 | 3300025225 | Ga0209566_100567 | Ga0209566_1005677 | 152 |
| 699 | 3300025225 | Ga0209566_104658 | Ga0209566_1046581 | 152 |
| 700 | 3300025226 | Ga0209674_100025 | Ga0209674_100025241 | 152 |
| 701 | 3300025226 | Ga0209674_100070 | Ga0209674_10007090 | 152 |
| 702 | 3300025226 | Ga0209674_100093 | Ga0209674_100093135 | 152 |
| 703 | 3300025226 | Ga0209674_100120 | Ga0209674_10012088 | 152 |
| 704 | 3300025226 | Ga0209674_101148 | Ga0209674_1011486 | 152 |
| 705 | 3300025228 | Ga0209672_100002 | Ga0209672_1000021145 | 152 |
| 706 | 3300025228 | Ga0209672_100044 | Ga0209672_100044216 | 152 |
| 707 | 3300025228 | Ga0209672_100075 | Ga0209672_100075125 | 152 |
| 708 | 3300025228 | Ga0209672_100413 | Ga0209672_10041314 | 152 |
| 709 | 3300025229 | Ga0209147_100003 | Ga0209147_1000031145 | 152 |
| 710 | 3300025229 | Ga0209147_100005 | Ga0209147_100005450 | 152 |
| 711 | 3300025229 | Ga0209147_100039 | Ga0209147_100039216 | 152 |
| 712 | 3300025229 | Ga0209147_100119 | Ga0209147_10011940 | 152 |
| 713 | 3300025229 | Ga0209147_100176 | Ga0209147_10017659 | 152 |
| 714 | 3300025230 | Ga0209563_100016 | Ga0209563_100016443 | 152 |
| 715 | 3300025230 | Ga0209563_101301 | Ga0209563_1013017 | 152 |
| 716 | 3300025230 | Ga0209563_102708 | Ga0209563_1027084 | 152 |
| 717 | 3300025231 | Ga0207427_100777 | Ga0207427_1007775 | 152 |
| 718 | 3300025242 | Ga0209258_100005 | Ga0209258_100005787 | 152 |
| 719 | 3300025242 | Ga0209258_100007 | Ga0209258_100007450 | 152 |
| 720 | 3300025242 | Ga0209258_100062 | Ga0209258_100062216 | 152 |
| 721 | 3300025242 | Ga0209258_100153 | Ga0209258_100153125 | 152 |
| 722 | 3300025245 | Ga0207425_1000908 | Ga0207425_100090810 | 152 |
| 723 | 3300025245 | Ga0207425_1010792 | Ga0207425_10107922 | 152 |
| 724 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000012052 | 152 |
| 725 | 3300025246 | Ga0209646_1000016 | Ga0209646_1000016324 | 152 |
| 726 | 3300025246 | Ga0209646_1002708 | Ga0209646_10027083 | 152 |
| 727 | 3300025250 | Ga0209026_1000001 | Ga0209026_1000001708 | 152 |
| 728 | 3300025250 | Ga0209026_1001651 | Ga0209026_10016515 | 152 |
| 729 | 3300025253 | Ga0209677_100008 | Ga0209677_100008250 | 152 |
| 730 | 3300025254 | Ga0209148_1000006 | Ga0209148_10000061145 | 152 |
| 731 | 3300025254 | Ga0209148_1000051 | Ga0209148_100005146 | 152 |
| 732 | 3300025254 | Ga0209148_1000075 | Ga0209148_1000075216 | 152 |
| 733 | 3300025254 | Ga0209148_1000728 | Ga0209148_10007288 | 152 |
| 734 | 3300025254 | Ga0209148_1003409 | Ga0209148_10034095 | 152 |
| 735 | 3300025256 | Ga0209759_1000001 | Ga0209759_10000011683 | 152 |
| 736 | 3300025256 | Ga0209759_1000002 | Ga0209759_1000002247 | 152 |
| 737 | 3300025256 | Ga0209759_1000014 | Ga0209759_1000014209 | 152 |
| 738 | 3300025256 | Ga0209759_1000039 | Ga0209759_100003924 | 152 |
| 739 | 3300025256 | Ga0209759_1001110 | Ga0209759_10011104 | 152 |
| 740 | 3300025256 | Ga0209759_1002345 | Ga0209759_10023458 | 152 |
| 741 | 3300025256 | Ga0209759_1006058 | Ga0209759_10060582 | 152 |
| 742 | 3300025256 | Ga0209759_1019604 | Ga0209759_10196042 | 152 |
| 743 | 3300025258 | Ga0209129_1019612 | Ga0209129_10196123 | 152 |
| 744 | 3300025261 | Ga0209233_1000018 | Ga0209233_1000018208 | 152 |
| 745 | 3300025261 | Ga0209233_1051508 | Ga0209233_10515082 | 152 |
| 746 | 3300025263 | Ga0209565_1000016 | Ga0209565_1000016248 | 152 |
| 747 | 3300025272 | Ga0209455_1000003 | Ga0209455_10000031145 | 152 |
| 748 | 3300025272 | Ga0209455_1000011 | Ga0209455_1000011375 | 152 |
| 749 | 3300025272 | Ga0209455_1000067 | Ga0209455_1000067216 | 152 |
| 750 | 3300025272 | Ga0209455_1000221 | Ga0209455_100022159 | 152 |
| 751 | 3300025273 | Ga0209673_1000073 | Ga0209673_100007329 | 152 |
| 752 | 3300025273 | Ga0209673_1001044 | Ga0209673_100104415 | 152 |
| 753 | 3300025284 | Ga0209130_1000141 | Ga0209130_100014119 | 152 |
| 754 | 3300025284 | Ga0209130_1000210 | Ga0209130_100021029 | 152 |
| 755 | 3300025284 | Ga0209130_1012453 | Ga0209130_10124532 | 152 |
| 756 | 3300025291 | Ga0209675_1000356 | Ga0209675_100035614 | 152 |
| 757 | 3300025292 | Ga0209676_1000165 | Ga0209676_100016529 | 152 |
| 758 | 3300025295 | Ga0209564_1000165 | Ga0209564_1000165137 | 152 |
| 759 | 3300025295 | Ga0209564_1005057 | Ga0209564_100505712 | 152 |
| 760 | 3300025295 | Ga0209564_1010599 | Ga0209564_10105992 | 152 |
| 761 | 3300025298 | Ga0209050_1000084 | Ga0209050_1000084225 | 152 |
| 762 | 3300025298 | Ga0209050_1014814 | Ga0209050_10148142 | 152 |
| 763 | 3300025299 | Ga0209256_1000110 | Ga0209256_100011029 | 152 |
| 764 | 3300025302 | Ga0207426_1000103 | Ga0207426_1000103128 | 152 |
| 765 | 3300025302 | Ga0207426_1000145 | Ga0207426_100014516 | 152 |
| 766 | 3300025302 | Ga0207426_1002451 | Ga0207426_10024515 | 152 |
| 767 | 3300025303 | Ga0209051_1000058 | Ga0209051_1000058225 | 152 |
| 768 | 3300025304 | Ga0209257_1000092 | Ga0209257_1000092225 | 152 |
| 769 | 3300025711 | Ga0207696_1054182 | Ga0207696_10541822 | 152 |
| 770 | 3300025728 | Ga0207655_1023574 | Ga0207655_10235741 | 152 |
| 771 | 3300025728 | Ga0207655_1030654 | Ga0207655_10306543 | 152 |
| 772 | 3300025735 | Ga0207713_1052813 | Ga0207713_10528133 | 152 |
| 773 | 3300025904 | Ga0207647_10009559 | Ga0207647_100095595 | 152 |
| 774 | 3300025904 | Ga0207647_10011061 | Ga0207647_100110614 | 152 |
| 775 | 3300025904 | Ga0207647_10042812 | Ga0207647_100428122 | 152 |
| 776 | 3300025904 | Ga0207647_10501517 | Ga0207647_105015172 | 152 |
| 777 | 3300025907 | Ga0207645_10143331 | Ga0207645_101433312 | 152 |
| 778 | 3300025909 | Ga0207705_10107081 | Ga0207705_101070812 | 152 |
| 779 | 3300025909 | Ga0207705_10202607 | Ga0207705_102026073 | 152 |
| 780 | 3300025910 | Ga0207684_10609822 | Ga0207684_106098222 | 152 |
| 781 | 3300025913 | Ga0207695_10003008 | Ga0207695_100030088 | 152 |
| 782 | 3300025913 | Ga0207695_10003114 | Ga0207695_100031148 | 152 |
| 783 | 3300025913 | Ga0207695_10014899 | Ga0207695_100148993 | 152 |
| 784 | 3300025913 | Ga0207695_10032225 | Ga0207695_100322254 | 152 |
| 785 | 3300025913 | Ga0207695_10159983 | Ga0207695_101599831 | 152 |
| 786 | 3300025913 | Ga0207695_10595466 | Ga0207695_105954662 | 152 |
| 787 | 3300025913 | Ga0207695_10614241 | Ga0207695_106142412 | 152 |
| 788 | 3300025913 | Ga0207695_10892025 | Ga0207695_108920252 | 152 |
| 789 | 3300025914 | Ga0207671_10043088 | Ga0207671_100430884 | 152 |
| 790 | 3300025914 | Ga0207671_10065133 | Ga0207671_100651334 | 152 |
| 791 | 3300025919 | Ga0207657_10000072 | Ga0207657_1000007211 | 152 |
| 792 | 3300025919 | Ga0207657_10000389 | Ga0207657_1000038922 | 152 |
| 793 | 3300025919 | Ga0207657_10319697 | Ga0207657_103196972 | 152 |
| 794 | 3300025920 | Ga0207649_10001426 | Ga0207649_1000142616 | 152 |
| 795 | 3300025922 | Ga0207646_10715054 | Ga0207646_107150541 | 152 |
| 796 | 3300025922 | Ga0207646_11175496 | Ga0207646_111754961 | 152 |
| 797 | 3300025923 | Ga0207681_10139559 | Ga0207681_101395593 | 152 |
| 798 | 3300025924 | Ga0207694_10047952 | Ga0207694_100479522 | 152 |
| 799 | 3300025924 | Ga0207694_10795689 | Ga0207694_107956891 | 152 |
| 800 | 3300025924 | Ga0207694_10951144 | Ga0207694_109511442 | 152 |
| 801 | 3300025931 | Ga0207644_10351277 | Ga0207644_103512771 | 152 |
| 802 | 3300025932 | Ga0207690_10000019 | Ga0207690_10000019209 | 152 |
| 803 | 3300025932 | Ga0207690_10000722 | Ga0207690_1000072221 | 152 |
| 804 | 3300025933 | Ga0207706_10311127 | Ga0207706_103111273 | 152 |
| 805 | 3300025937 | Ga0207669_10312672 | Ga0207669_103126722 | 152 |
| 806 | 3300025940 | Ga0207691_10071487 | Ga0207691_100714873 | 152 |
| 807 | 3300025941 | Ga0207711_10012168 | Ga0207711_100121687 | 152 |
| 808 | 3300025945 | Ga0207679_10000002 | Ga0207679_10000002276 | 152 |
| 809 | 3300025949 | Ga0207667_10038803 | Ga0207667_100388034 | 152 |
| 810 | 3300025949 | Ga0207667_10866813 | Ga0207667_108668132 | 152 |
| 811 | 3300025972 | Ga0207668_10016062 | Ga0207668_100160624 | 152 |
| 812 | 3300025981 | Ga0207640_10000101 | Ga0207640_1000010142 | 152 |
| 813 | 3300025986 | Ga0207658_10112736 | Ga0207658_101127364 | 152 |
| 814 | 3300025986 | Ga0207658_10661784 | Ga0207658_106617842 | 152 |
| 815 | 3300026035 | Ga0207703_10876535 | Ga0207703_108765352 | 152 |
| 816 | 3300026041 | Ga0207639_10427501 | Ga0207639_104275012 | 152 |
| 817 | 3300026067 | Ga0207678_10000003 | Ga0207678_10000003245 | 152 |
| 818 | 3300026067 | Ga0207678_10030675 | Ga0207678_100306755 | 152 |
| 819 | 3300026067 | Ga0207678_10095757 | Ga0207678_100957573 | 152 |
| 820 | 3300026078 | Ga0207702_10000010 | Ga0207702_10000010195 | 152 |
| 821 | 3300026078 | Ga0207702_10581841 | Ga0207702_105818412 | 152 |
| 822 | 3300026078 | Ga0207702_10957693 | Ga0207702_109576931 | 152 |
| 823 | 3300026088 | Ga0207641_10420959 | Ga0207641_104209593 | 152 |
| 824 | 3300026116 | Ga0207674_10029272 | Ga0207674_100292723 | 152 |
| 825 | 3300026116 | Ga0207674_10616490 | Ga0207674_106164902 | 152 |
| 826 | 3300026118 | Ga0207675_100282899 | Ga0207675_1002828994 | 152 |
| 827 | 3300026142 | Ga0207698_10144329 | Ga0207698_101443292 | 152 |
| 828 | 3300026142 | Ga0207698_10313260 | Ga0207698_103132602 | 152 |
| 829 | 3300027312 | Ga0209371_1000095 | Ga0209371_100009522 | 152 |
| 830 | 3300027312 | Ga0209371_1000211 | Ga0209371_100021121 | 152 |
| 831 | 3300027312 | Ga0209371_1011309 | Ga0209371_10113094 | 152 |
| 832 | 3300027866 | Ga0209813_10147751 | Ga0209813_101477512 | 152 |
| 833 | 3300030500 | Ga0268256_1000116 | Ga0268256_100011697 | 152 |
| 834 | 3300030500 | Ga0268256_1000319 | Ga0268256_100031921 | 152 |
| 835 | 3300030500 | Ga0268256_1012649 | Ga0268256_10126492 | 152 |
| 836 | 3300031548 | Ga0307408_100010117 | Ga0307408_1000101175 | 152 |
| 837 | 3300031548 | Ga0307408_100010914 | Ga0307408_1000109146 | 152 |
| 838 | 3300031731 | Ga0307405_10001796 | Ga0307405_100017962 | 152 |
| 839 | 3300031731 | Ga0307405_10180755 | Ga0307405_101807552 | 152 |
| 840 | 3300031824 | Ga0307413_10193441 | Ga0307413_101934412 | 152 |
| 841 | 3300031824 | Ga0307413_10867135 | Ga0307413_108671352 | 152 |
| 842 | 3300031852 | Ga0307410_10033029 | Ga0307410_100330293 | 152 |
| 843 | 3300031901 | Ga0307406_10004428 | Ga0307406_100044282 | 152 |
| 844 | 3300031903 | Ga0307407_10090915 | Ga0307407_100909152 | 152 |
| 845 | 3300031911 | Ga0307412_10047156 | Ga0307412_100471563 | 152 |
| 846 | 3300031911 | Ga0307412_10460129 | Ga0307412_104601292 | 152 |
| 847 | 3300031995 | Ga0307409_100016120 | Ga0307409_1000161202 | 152 |
| 848 | 3300032002 | Ga0307416_100010204 | Ga0307416_1000102047 | 152 |
| 849 | 3300032002 | Ga0307416_100351229 | Ga0307416_1003512292 | 152 |
| 850 | 3300032004 | Ga0307414_10043576 | Ga0307414_100435762 | 152 |
| 851 | 3300032005 | Ga0307411_10001196 | Ga0307411_100011969 | 152 |
| 852 | 3300032126 | Ga0307415_100008780 | Ga0307415_1000087805 | 152 |
| 853 | 3300037312 | Ga0395899_0000035 | Ga0395899_0000035_37263_37721 | 152 |
| 854 | 3300037312 | Ga0395899_0097458 | Ga0395899_0097458_1538_1996 | 152 |
| 855 | 3300037312 | Ga0395899_0309102 | Ga0395899_0309102_555_1013 | 152 |
| 856 | 3300037418 | Ga0395900_0000113 | Ga0395900_0000113_37263_37721 | 152 |
| 857 | 3300037418 | Ga0395900_0003027 | Ga0395900_0003027_3716_4174 | 152 |
| 858 | 3300037418 | Ga0395900_0017077 | Ga0395900_0017077_2798_3256 | 152 |
| 859 | 3300037418 | Ga0395900_0039514 | Ga0395900_0039514_1384_1842 | 152 |
| 860 | 3300037418 | Ga0395900_0078296 | Ga0395900_0078296_597_1055 | 152 |
| 861 | 3300037418 | Ga0395900_0087484 | Ga0395900_0087484_1421_1879 | 152 |
| 862 | 3300037418 | Ga0395900_0402185 | Ga0395900_0402185_204_662 | 152 |
| 863 | 3300037466 | Ga0395898_0000254 | Ga0395898_0000254_55924_56382 | 152 |
| 864 | 3300037466 | Ga0395898_0000444 | Ga0395898_0000444_34087_34545 | 152 |
| 865 | 3300037466 | Ga0395898_0002993 | Ga0395898_0002993_10420_10878 | 152 |
| 866 | 3300037466 | Ga0395898_0188758 | Ga0395898_0188758_171_629 | 152 |
| 867 | 3300037466 | Ga0395898_0377900 | Ga0395898_0377900_344_802 | 152 |
| 868 | 3300037471 | Ga0395905_0197938 | Ga0395905_0197938_1399_1863 | 152 |
| 869 | 3300038443 | Ga0395901_0000009 | Ga0395901_0000009_184596_185054 | 152 |
| 870 | 3300038443 | Ga0395901_0000302 | Ga0395901_0000302_3031_3489 | 152 |
| 871 | 3300038443 | Ga0395901_0026100 | Ga0395901_0026100_2702_3160 | 152 |
| 872 | 3300038443 | Ga0395901_0032650 | Ga0395901_0032650_2073_2531 | 152 |
| 873 | 3300038443 | Ga0395901_0144831 | Ga0395901_0144831_156_614 | 152 |
| 874 | 3300038443 | Ga0395901_0308651 | Ga0395901_0308651_741_1199 | 152 |
| 875 | 3300039447 | Ga0436361_0834992 | Ga0436361_0834992_1125_1610 | 152 |
| 876 | 3300041406 | Ga0439439_0008993 | Ga0439439_0008993_1681_2148 | 152 |
| 877 | 3300041411 | Ga0439466_0107144 | Ga0439466_0107144_212_679 | 152 |
| 878 | 3300042005 | Ga0439448_0170772 | Ga0439448_0170772_154_612 | 152 |
| 879 | 3300042007 | Ga0439449_0000091 | Ga0439449_0000091_6531_6998 | 152 |
| 880 | 3300042010 | Ga0439452_043402 | Ga0439452_043402_491_949 | 152 |
| 881 | 3300042015 | Ga0439462_0001751 | Ga0439462_0001751_166_633 | 152 |
| 882 | 3300042015 | Ga0439462_0063207 | Ga0439462_0063207_255_722 | 152 |
| 883 | 3300042129 | Ga0450891_009863 | Ga0450891_009863_47_514 | 152 |
| 884 | 3300042134 | Ga0450898_049360 | Ga0450898_049360_138_614 | 152 |
| 885 | 3300042138 | Ga0450903_011050 | Ga0450903_011050_355_822 | 152 |
| 886 | 3300042156 | Ga0439446_0004975 | Ga0439446_0004975_2765_3232 | 152 |
| 887 | 3300042157 | Ga0439458_0089039 | Ga0439458_0089039_47_505 | 152 |
| 888 | 3300042157 | Ga0439458_0172519 | Ga0439458_0172519_102_569 | 152 |
| 889 | 3300042435 | Ga0439434_0074192 | Ga0439434_0074192_132_599 | 152 |
| 890 | 3300042436 | Ga0439435_0033244 | Ga0439435_0033244_384_851 | 152 |
| 891 | 3300042438 | Ga0439459_0174293 | Ga0439459_0174293_89_556 | 152 |
| 892 | 3300042439 | Ga0439464_0007334 | Ga0439464_0007334_2352_2810 | 152 |
| 893 | 3300042439 | Ga0439464_0251902 | Ga0439464_0251902_20_478 | 152 |
| 894 | 3300044650 | Ga0466986_0231794 | Ga0466986_0231794_386_850 | 152 |
| 895 | 3300044656 | Ga0466969_0001266 | Ga0466969_0001266_12624_13082 | 152 |
| 896 | 3300044656 | Ga0466969_0058166 | Ga0466969_0058166_377_835 | 152 |
| 897 | 3300044656 | Ga0466969_0257838 | Ga0466969_0257838_321_779 | 152 |
| 898 | 3300044658 | Ga0466972_0001179 | Ga0466972_0001179_1664_2122 | 152 |
| 899 | 3300044672 | Ga0466982_0564883 | Ga0466982_0564883_14_472 | 152 |
| 900 | 3300044683 | Ga0466965_0047726 | Ga0466965_0047726_170_628 | 152 |
| 901 | 3300044684 | Ga0466966_0000043 | Ga0466966_0000043_34750_35208 | 152 |
| 902 | 3300044684 | Ga0466966_0000309 | Ga0466966_0000309_22572_23033 | 152 |
| 903 | 3300044684 | Ga0466966_0029640 | Ga0466966_0029640_198_659 | 152 |
| 904 | 3300044684 | Ga0466966_0069877 | Ga0466966_0069877_1333_1791 | 152 |
| 905 | 3300044684 | Ga0466966_0209084 | Ga0466966_0209084_339_797 | 152 |
| 906 | 3300044693 | Ga0466961_0000026 | Ga0466961_0000026_24825_25283 | 152 |
| 907 | 3300044693 | Ga0466961_0001377 | Ga0466961_0001377_7978_8436 | 152 |
| 908 | 3300044693 | Ga0466961_0014187 | Ga0466961_0014187_4486_4944 | 152 |
| 909 | 3300044693 | Ga0466961_0126232 | Ga0466961_0126232_1073_1531 | 152 |
| 910 | 3300044694 | Ga0466963_0000484 | Ga0466963_0000484_590_1048 | 152 |
| 911 | 3300044694 | Ga0466963_0031544 | Ga0466963_0031544_2784_3242 | 152 |
| 912 | 3300044719 | Ga0466971_0005125 | Ga0466971_0005125_4065_4526 | 152 |
| 913 | 3300044719 | Ga0466971_0008279 | Ga0466971_0008279_469_927 | 152 |
| 914 | 3300044719 | Ga0466971_0020938 | Ga0466971_0020938_1461_1919 | 152 |
| 915 | 3300044719 | Ga0466971_0023300 | Ga0466971_0023300_1092_1550 | 152 |
| 916 | 3300044765 | Ga0466970_0000060 | Ga0466970_0000060_23240_23698 | 152 |
| 917 | 3300044765 | Ga0466970_0006300 | Ga0466970_0006300_4821_5282 | 152 |
| 918 | 3300044765 | Ga0466970_0156797 | Ga0466970_0156797_204_662 | 152 |
| 919 | 3300044842 | Ga0466957_0003198 | Ga0466957_0003198_6104_6565 | 152 |
| 920 | 3300044842 | Ga0466957_0006531 | Ga0466957_0006531_3156_3614 | 152 |
| 921 | 3300044842 | Ga0466957_0044637 | Ga0466957_0044637_584_1042 | 152 |
| 922 | 3300045049 | Ga0466959_0000129 | Ga0466959_0000129_24549_25007 | 152 |
| 923 | 3300045049 | Ga0466959_0013198 | Ga0466959_0013198_710_1168 | 152 |
| 924 | 3300045049 | Ga0466959_0013429 | Ga0466959_0013429_4410_4868 | 152 |
| 925 | 3300045049 | Ga0466959_0114717 | Ga0466959_0114717_873_1331 | 152 |
| 926 | 3300045836 | Ga0466958_0003437 | Ga0466958_0003437_4399_4857 | 152 |
| 927 | 3300045836 | Ga0466958_0030082 | Ga0466958_0030082_2056_2514 | 152 |
| 928 | 3300045836 | Ga0466958_0228778 | Ga0466958_0228778_89_550 | 152 |
| 929 | 3300045976 | Ga0466967_0002547 | Ga0466967_0002547_9989_10447 | 152 |
| 930 | 3300045976 | Ga0466967_0103605 | Ga0466967_0103605_1896_2363 | 152 |
| 931 | 3300045976 | Ga0466967_0730741 | Ga0466967_0730741_313_783 | 152 |
| 932 | 3300046454 | Ga0495592_0087784 | Ga0495592_0087784_252_719 | 152 |
| 933 | 3300046455 | Ga0495603_0006343 | Ga0495603_0006343_4961_5419 | 152 |
| 934 | 3300046455 | Ga0495603_0041414 | Ga0495603_0041414_1471_1929 | 152 |
| 935 | 3300046455 | Ga0495603_0313690 | Ga0495603_0313690_426_884 | 152 |
| 936 | 3300046457 | Ga0495590_0001136 | Ga0495590_0001136_4063_4521 | 152 |
| 937 | 3300046458 | Ga0495591_121300 | Ga0495591_121300_127_585 | 152 |
| 938 | 3300046459 | Ga0495629_0000517 | Ga0495629_0000517_1688_2146 | 152 |
| 939 | 3300046459 | Ga0495629_0000586 | Ga0495629_0000586_26699_27157 | 152 |
| 940 | 3300046459 | Ga0495629_0001679 | Ga0495629_0001679_3646_4104 | 152 |
| 941 | 3300046459 | Ga0495629_0060857 | Ga0495629_0060857_72_539 | 152 |
| 942 | 3300046459 | Ga0495629_0552036 | Ga0495629_0552036_146_604 | 152 |
| 943 | 3300046460 | Ga0495638_0006568 | Ga0495638_0006568_7604_8062 | 152 |
| 944 | 3300046461 | Ga0495641_0012345 | Ga0495641_0012345_2847_3305 | 152 |
| 945 | 3300046462 | Ga0495651_0013214 | Ga0495651_0013214_1699_2157 | 152 |
| 946 | 3300046463 | Ga0495653_0032148 | Ga0495653_0032148_2376_2834 | 152 |
| 947 | 3300046463 | Ga0495653_0064837 | Ga0495653_0064837_787_1245 | 152 |
| 948 | 3300046463 | Ga0495653_0110614 | Ga0495653_0110614_42_509 | 152 |
| 949 | 3300046463 | Ga0495653_0145368 | Ga0495653_0145368_148_606 | 152 |
| 950 | 3300046463 | Ga0495653_0154177 | Ga0495653_0154177_260_718 | 152 |
| 951 | 3300046471 | Ga0495650_0011835 | Ga0495650_0011835_3797_4255 | 152 |
| 952 | 3300046471 | Ga0495650_0060376 | Ga0495650_0060376_771_1229 | 152 |
| 953 | 3300046472 | Ga0495580_0000142 | Ga0495580_0000142_420_878 | 152 |
| 954 | 3300046472 | Ga0495580_0000495 | Ga0495580_0000495_1816_2274 | 152 |
| 955 | 3300046472 | Ga0495580_0034264 | Ga0495580_0034264_2104_2562 | 152 |
| 956 | 3300046472 | Ga0495580_0099569 | Ga0495580_0099569_898_1356 | 152 |
| 957 | 3300046472 | Ga0495580_0141534 | Ga0495580_0141534_1116_1574 | 152 |
| 958 | 3300046472 | Ga0495580_0201356 | Ga0495580_0201356_713_1171 | 152 |
| 959 | 3300046472 | Ga0495580_0245885 | Ga0495580_0245885_566_1024 | 152 |
| 960 | 3300046472 | Ga0495580_0290474 | Ga0495580_0290474_628_1086 | 152 |
| 961 | 3300046473 | Ga0495582_0015769 | Ga0495582_0015769_3494_3961 | 152 |
| 962 | 3300046473 | Ga0495582_0019877 | Ga0495582_0019877_1891_2349 | 152 |
| 963 | 3300046473 | Ga0495582_0114894 | Ga0495582_0114894_339_797 | 152 |
| 964 | 3300046476 | Ga0495662_0048379 | Ga0495662_0048379_792_1250 | 152 |
| 965 | 3300046477 | Ga0495664_0000149 | Ga0495664_0000149_6917_7375 | 152 |
| 966 | 3300046477 | Ga0495664_0006570 | Ga0495664_0006570_4973_5440 | 152 |
| 967 | 3300046477 | Ga0495664_0013453 | Ga0495664_0013453_1933_2391 | 152 |
| 968 | 3300046477 | Ga0495664_0624366 | Ga0495664_0624366_128_586 | 152 |
| 969 | 3300046500 | Ga0495596_0030259 | Ga0495596_0030259_1287_1745 | 152 |
| 970 | 3300046501 | Ga0495607_0325571 | Ga0495607_0325571_107_565 | 152 |
| 971 | 3300046506 | Ga0495583_0002966 | Ga0495583_0002966_6528_6986 | 152 |
| 972 | 3300046506 | Ga0495583_0040051 | Ga0495583_0040051_340_798 | 152 |
| 973 | 3300046507 | Ga0495606_0008201 | Ga0495606_0008201_7011_7469 | 152 |
| 974 | 3300046507 | Ga0495606_0062041 | Ga0495606_0062041_1747_2214 | 152 |
| 975 | 3300046514 | Ga0495618_0012638 | Ga0495618_0012638_3167_3625 | 152 |
| 976 | 3300046514 | Ga0495618_0075319 | Ga0495618_0075319_309_776 | 152 |
| 977 | 3300046516 | Ga0495628_0019740 | Ga0495628_0019740_62_520 | 152 |
| 978 | 3300046516 | Ga0495628_0032491 | Ga0495628_0032491_2336_2794 | 152 |
| 979 | 3300046516 | Ga0495628_0047551 | Ga0495628_0047551_375_833 | 152 |
| 980 | 3300046516 | Ga0495628_0122346 | Ga0495628_0122346_1305_1763 | 152 |
| 981 | 3300046516 | Ga0495628_0162264 | Ga0495628_0162264_840_1298 | 152 |
| 982 | 3300046516 | Ga0495628_0288253 | Ga0495628_0288253_709_1176 | 152 |
| 983 | 3300046516 | Ga0495628_0535227 | Ga0495628_0535227_29_496 | 152 |
| 984 | 3300046517 | Ga0495630_0020639 | Ga0495630_0020639_3814_4272 | 152 |
| 985 | 3300046517 | Ga0495630_0028929 | Ga0495630_0028929_529_996 | 152 |
| 986 | 3300046517 | Ga0495630_0083495 | Ga0495630_0083495_1829_2287 | 152 |
| 987 | 3300046524 | Ga0495648_0003737 | Ga0495648_0003737_5920_6378 | 152 |
| 988 | 3300046524 | Ga0495648_0007144 | Ga0495648_0007144_6004_6462 | 152 |
| 989 | 3300046524 | Ga0495648_0007593 | Ga0495648_0007593_5163_5621 | 152 |
| 990 | 3300046524 | Ga0495648_0094444 | Ga0495648_0094444_196_654 | 152 |
| 991 | 3300046526 | Ga0495666_0001598 | Ga0495666_0001598_5719_6177 | 152 |
| 992 | 3300046526 | Ga0495666_0075413 | Ga0495666_0075413_906_1364 | 152 |
| 993 | 3300046528 | Ga0495642_0007805 | Ga0495642_0007805_227_685 | 152 |
| 994 | 3300046529 | Ga0495652_0008580 | Ga0495652_0008580_7502_7960 | 152 |
| 995 | 3300046529 | Ga0495652_0010563 | Ga0495652_0010563_1974_2432 | 152 |
| 996 | 3300046529 | Ga0495652_0039526 | Ga0495652_0039526_2102_2560 | 152 |
| 997 | 3300046529 | Ga0495652_0513060 | Ga0495652_0513060_71_538 | 152 |
| 998 | 3300046531 | Ga0495665_0006558 | Ga0495665_0006558_1180_1638 | 152 |
| 999 | 3300046531 | Ga0495665_0096230 | Ga0495665_0096230_306_764 | 152 |
| 1000 | 3300046531 | Ga0495665_0225943 | Ga0495665_0225943_396_854 | 152 |
| 1001 | 3300046531 | Ga0495665_0440500 | Ga0495665_0440500_24_482 | 152 |
| 1002 | 3300046531 | Ga0495665_0524614 | Ga0495665_0524614_116_583 | 152 |
| 1003 | 3300046533 | Ga0495640_0009773 | Ga0495640_0009773_6499_6966 | 152 |
| 1004 | 3300046533 | Ga0495640_0031297 | Ga0495640_0031297_2656_3114 | 152 |
| 1005 | 3300046535 | Ga0495586_0034012 | Ga0495586_0034012_1099_1557 | 152 |
| 1006 | 3300046535 | Ga0495586_0196004 | Ga0495586_0196004_284_742 | 152 |
| 1007 | 3300046536 | Ga0495587_0001137 | Ga0495587_0001137_11530_11988 | 152 |
| 1008 | 3300046543 | Ga0495645_0005083 | Ga0495645_0005083_4680_5138 | 152 |
| 1009 | 3300046543 | Ga0495645_0023662 | Ga0495645_0023662_3291_3749 | 152 |
| 1010 | 3300046543 | Ga0495645_0307709 | Ga0495645_0307709_65_523 | 152 |
| 1011 | 3300046543 | Ga0495645_0510483 | Ga0495645_0510483_63_521 | 152 |
| 1012 | 3300046642 | Ga0495634_0002825 | Ga0495634_0002825_6791_7249 | 152 |
| 1013 | 3300046642 | Ga0495634_0076659 | Ga0495634_0076659_1192_1659 | 152 |
| 1014 | 3300046663 | Ga0495635_0000635 | Ga0495635_0000635_1544_2002 | 152 |
| 1015 | 3300046663 | Ga0495635_0814476 | Ga0495635_0814476_18_476 | 152 |
| 1016 | 3300046663 | Ga0495635_0992851 | Ga0495635_0992851_42_509 | 152 |
| 1017 | 3300046674 | Ga0495588_0015467 | Ga0495588_0015467_1255_1713 | 152 |
| 1018 | 3300046678 | Ga0495599_0010543 | Ga0495599_0010543_4581_5039 | 152 |
| 1019 | 3300046678 | Ga0495599_0092709 | Ga0495599_0092709_376_834 | 152 |
| 1020 | 3300046679 | Ga0495623_0043618 | Ga0495623_0043618_914_1372 | 152 |
| 1021 | 3300046679 | Ga0495623_0095104 | Ga0495623_0095104_192_659 | 152 |
| 1022 | 3300046679 | Ga0495623_0132150 | Ga0495623_0132150_315_773 | 152 |
| 1023 | 3300046679 | Ga0495623_0599511 | Ga0495623_0599511_74_532 | 152 |
| 1024 | 3300046680 | Ga0495646_0002054 | Ga0495646_0002054_5957_6415 | 152 |
| 1025 | 3300046680 | Ga0495646_0087347 | Ga0495646_0087347_178_645 | 152 |
| 1026 | 3300046680 | Ga0495646_0167769 | Ga0495646_0167769_436_894 | 152 |
| 1027 | 3300046680 | Ga0495646_0223546 | Ga0495646_0223546_34_492 | 152 |
| 1028 | 3300046680 | Ga0495646_0563475 | Ga0495646_0563475_33_491 | 152 |
| 1029 | 3300046689 | Ga0495613_0006353 | Ga0495613_0006353_2101_2559 | 152 |
| 1030 | 3300046690 | Ga0495624_0000416 | Ga0495624_0000416_2403_2861 | 152 |
| 1031 | 3300046690 | Ga0495624_0011083 | Ga0495624_0011083_262_720 | 152 |
| 1032 | 3300046690 | Ga0495624_0031482 | Ga0495624_0031482_1292_1750 | 152 |
| 1033 | 3300046690 | Ga0495624_0216162 | Ga0495624_0216162_137_604 | 152 |
| 1034 | 3300046692 | Ga0495671_0011589 | Ga0495671_0011589_1232_1690 | 152 |
| 1035 | 3300046694 | Ga0495649_0006208 | Ga0495649_0006208_1821_2279 | 152 |
| 1036 | 3300046694 | Ga0495649_0008319 | Ga0495649_0008319_405_863 | 152 |
| 1037 | 3300046694 | Ga0495649_0038208 | Ga0495649_0038208_1589_2056 | 152 |
| 1038 | 3300046694 | Ga0495649_0264115 | Ga0495649_0264115_218_685 | 152 |
| 1039 | 3300047315 | Ga0495581_0002468 | Ga0495581_0002468_6641_7099 | 152 |
| 1040 | 3300047315 | Ga0495581_0024077 | Ga0495581_0024077_1097_1555 | 152 |
| 1041 | 3300047317 | Ga0495604_0011020 | Ga0495604_0011020_5829_6287 | 152 |
| 1042 | 3300047317 | Ga0495604_0014111 | Ga0495604_0014111_359_826 | 152 |
| 1043 | 3300047317 | Ga0495604_0056243 | Ga0495604_0056243_1916_2374 | 152 |
| 1044 | 3300047317 | Ga0495604_0332872 | Ga0495604_0332872_390_848 | 152 |
| 1045 | 3300047319 | Ga0495674_0007725 | Ga0495674_0007725_5055_5513 | 152 |
| 1046 | 3300047319 | Ga0495674_0010470 | Ga0495674_0010470_1340_1798 | 152 |
| 1047 | 3300047319 | Ga0495674_0014141 | Ga0495674_0014141_4631_5089 | 152 |
| 1048 | 3300047319 | Ga0495674_0017052 | Ga0495674_0017052_3727_4185 | 152 |
| 1049 | 3300047319 | Ga0495674_0116308 | Ga0495674_0116308_1646_2104 | 152 |
| 1050 | 3300047319 | Ga0495674_0126356 | Ga0495674_0126356_691_1149 | 152 |
| 1051 | 3300047319 | Ga0495674_0818369 | Ga0495674_0818369_207_665 | 152 |
| 1052 | 3300047320 | Ga0495672_0006413 | Ga0495672_0006413_7670_8128 | 152 |
| 1053 | 3300047320 | Ga0495672_0016206 | Ga0495672_0016206_3393_3851 | 152 |
| 1054 | 3300047320 | Ga0495672_0025309 | Ga0495672_0025309_452_910 | 152 |
| 1055 | 3300047320 | Ga0495672_0167347 | Ga0495672_0167347_479_937 | 152 |
| 1056 | 3300047321 | Ga0495676_0009149 | Ga0495676_0009149_4392_4850 | 152 |
| 1057 | 3300047321 | Ga0495676_0212051 | Ga0495676_0212051_18_476 | 152 |
| 1058 | 3300047321 | Ga0495676_0257393 | Ga0495676_0257393_680_1147 | 152 |
| 1059 | 3300047322 | Ga0495680_0009118 | Ga0495680_0009118_5889_6347 | 152 |
| 1060 | 3300047322 | Ga0495680_0098131 | Ga0495680_0098131_550_1008 | 152 |
| 1061 | 3300047322 | Ga0495680_0146979 | Ga0495680_0146979_787_1245 | 152 |
| 1062 | 3300047322 | Ga0495680_0317619 | Ga0495680_0317619_175_642 | 152 |
| 1063 | 3300047322 | Ga0495680_0400765 | Ga0495680_0400765_301_759 | 152 |
| 1064 | 3300047323 | Ga0495683_0003326 | Ga0495683_0003326_3762_4220 | 152 |
| 1065 | 3300047323 | Ga0495683_0152303 | Ga0495683_0152303_558_1016 | 152 |
| 1066 | 3300047443 | Ga0495687_000207 | Ga0495687_000207_66160_66627 | 152 |
| 1067 | 3300047443 | Ga0495687_163490 | Ga0495687_163490_65_523 | 152 |
| 1068 | 3300047444 | Ga0495675_0007904 | Ga0495675_0007904_932_1390 | 152 |
| 1069 | 3300047444 | Ga0495675_0089483 | Ga0495675_0089483_152_610 | 152 |
| 1070 | 3300047444 | Ga0495675_0240245 | Ga0495675_0240245_558_1025 | 152 |
| 1071 | 3300047446 | Ga0495679_000103 | Ga0495679_000103_65718_66176 | 152 |
| 1072 | 3300047446 | Ga0495679_003183 | Ga0495679_003183_2409_2867 | 152 |
| 1073 | 3300047446 | Ga0495679_024465 | Ga0495679_024465_1283_1741 | 152 |
| 1074 | 3300047469 | Ga0495673_0089393 | Ga0495673_0089393_477_935 | 152 |
| 1075 | 3300047470 | Ga0495681_0019317 | Ga0495681_0019317_191_649 | 152 |
| 1076 | 3300047673 | Ga0495593_0007253 | Ga0495593_0007253_2391_2849 | 152 |
| 1077 | 3300047673 | Ga0495593_0012829 | Ga0495593_0012829_602_1060 | 152 |
| 1078 | 3300047673 | Ga0495593_0016859 | Ga0495593_0016859_3310_3777 | 152 |
| 1079 | 3300048088 | Ga0495602_0011434 | Ga0495602_0011434_4626_5084 | 152 |
| 1080 | 3300048088 | Ga0495602_0245692 | Ga0495602_0245692_591_1058 | 152 |
| 1081 | 3300048088 | Ga0495602_0436685 | Ga0495602_0436685_372_830 | 152 |
| 1082 | 3300048088 | Ga0495602_0473077 | Ga0495602_0473077_329_787 | 152 |
| 1083 | 3300048089 | Ga0495614_0015565 | Ga0495614_0015565_1759_2217 | 152 |
| 1084 | 3300048091 | Ga0495626_0005595 | Ga0495626_0005595_4390_4848 | 152 |
| 1085 | 3300048903 | Ga0496100_0002550 | Ga0496100_0002550_8221_8679 | 152 |
| 1086 | 3300048904 | Ga0496101_0002228 | Ga0496101_0002228_89_547 | 152 |
| 1087 | 3300048904 | Ga0496101_0269745 | Ga0496101_0269745_847_1305 | 152 |
| 1088 | 3300048905 | Ga0496102_0000247 | Ga0496102_0000247_8055_8513 | 152 |
| 1089 | 3300048905 | Ga0496102_0357330 | Ga0496102_0357330_413_871 | 152 |
| 1090 | 3300048905 | Ga0496102_0765825 | Ga0496102_0765825_126_584 | 152 |
| 1091 | 3300048906 | Ga0496103_0000278 | Ga0496103_0000278_43777_44235 | 152 |
| 1092 | 3300048906 | Ga0496103_0674933 | Ga0496103_0674933_109_567 | 152 |
| 1093 | 3300048907 | Ga0496104_0012686 | Ga0496104_0012686_6709_7167 | 152 |
| 1094 | 3300048907 | Ga0496104_0442682 | Ga0496104_0442682_357_815 | 152 |
| 1095 | 3300048907 | Ga0496104_0841253 | Ga0496104_0841253_76_540 | 152 |
| 1096 | 3300048908 | Ga0496105_0193414 | Ga0496105_0193414_623_1081 | 152 |
| 1097 | 3300048908 | Ga0496105_0333670 | Ga0496105_0333670_128_586 | 152 |
| 1098 | 3300048912 | Ga0496109_0253568 | Ga0496109_0253568_80_550 | 152 |
| 1099 | 3300048912 | Ga0496109_1580520 | Ga0496109_1580520_52_510 | 152 |
| 1100 | 3300048913 | Ga0496110_0855295 | Ga0496110_0855295_117_587 | 152 |
| 1101 | 3300048915 | Ga0496112_0969349 | Ga0496112_0969349_85_549 | 152 |
| 1102 | 3300048916 | Ga0496113_0247667 | Ga0496113_0247667_390_848 | 152 |
| 1103 | 3300048916 | Ga0496113_0877810 | Ga0496113_0877810_163_621 | 152 |
| 1104 | 3300048917 | Ga0496114_0049041 | Ga0496114_0049041_777_1235 | 152 |
| 1105 | 3300048917 | Ga0496114_0921698 | Ga0496114_0921698_147_605 | 152 |
| 1106 | 3300048919 | Ga0496116_0077471 | Ga0496116_0077471_100_564 | 152 |
| 1107 | 3300048919 | Ga0496116_0261687 | Ga0496116_0261687_82_546 | 152 |
| 1108 | 3300048920 | Ga0496117_0000445 | Ga0496117_0000445_8242_8700 | 152 |
| 1109 | 3300048920 | Ga0496117_0028196 | Ga0496117_0028196_929_1387 | 152 |
| 1110 | 3300048920 | Ga0496117_0077015 | Ga0496117_0077015_257_721 | 152 |
| 1111 | 3300048921 | Ga0496118_0000138 | Ga0496118_0000138_51196_51654 | 152 |
| 1112 | 3300048921 | Ga0496118_0088277 | Ga0496118_0088277_827_1285 | 152 |
| 1113 | 3300048921 | Ga0496118_0201297 | Ga0496118_0201297_24_485 | 152 |
| 1114 | 3300048921 | Ga0496118_0283728 | Ga0496118_0283728_244_711 | 152 |
| 1115 | 3300048921 | Ga0496118_0319804 | Ga0496118_0319804_163_627 | 152 |
| 1116 | 3300048924 | Ga0496121_0001530 | Ga0496121_0001530_477_941 | 152 |
| 1117 | 3300048924 | Ga0496121_0007122 | Ga0496121_0007122_603_1061 | 152 |
| 1118 | 3300048924 | Ga0496121_0009428 | Ga0496121_0009428_603_1061 | 152 |
| 1119 | 3300048925 | Ga0496122_0096052 | Ga0496122_0096052_168_632 | 152 |
| 1120 | 3300048925 | Ga0496122_0125380 | Ga0496122_0125380_970_1428 | 152 |
| 1121 | 3300048926 | Ga0496123_0167325 | Ga0496123_0167325_213_671 | 152 |
| 1122 | 3300048929 | Ga0496126_0001647 | Ga0496126_0001647_29965_30423 | 152 |
| 1123 | 3300048929 | Ga0496126_0198850 | Ga0496126_0198850_415_873 | 152 |
| 1124 | 3300049460 | Ga0495682_0003881 | Ga0495682_0003881_5607_6065 | 152 |
| 1125 | 3300049460 | Ga0495682_0049284 | Ga0495682_0049284_552_1010 | 152 |
| 1126 | 3300050493 | nmdc:mga0k408_18508_c1 | nmdc:mga0k408_18508_c1_2483_2968 | 152 |
| 1127 | 3300050493 | nmdc:mga0k408_36108_c1 | nmdc:mga0k408_36108_c1_1829_2287 | 152 |
| 1128 | 3300050493 | nmdc:mga0k408_637108_c1 | nmdc:mga0k408_637108_c1_82_540 | 152 |
| 1129 | 3300050495 | nmdc:mga04h51_173348_c1 | nmdc:mga04h51_173348_c1_219_704 | 152 |
| 1130 | 3300050496 | nmdc:mga07m45_26187_c1 | nmdc:mga07m45_26187_c1_113_571 | 152 |
| 1131 | 3300050510 | nmdc:mga06r32_1022248_c1 | nmdc:mga06r32_1022248_c1_221_688 | 152 |
| 1132 | 3300050512 | nmdc:mga0n895_445597_c1 | nmdc:mga0n895_445597_c1_162_632 | 152 |
| 1133 | 3300053094 | Ga0500566_0142346 | Ga0500566_0142346_302_793 | 152 |
| 1134 | 3300053100 | Ga0500660_054333 | Ga0500660_054333_477_959 | 152 |
| 1135 | 3300053136 | Ga0500559_0096536 | Ga0500559_0096536_644_1123 | 152 |
| 1136 | 3300059477 | Ga0587084_001920 | Ga0587084_001920_865_1323 | 152 |
| 1137 | 3300059477 | Ga0587084_003128 | Ga0587084_003128_825_1283 | 152 |
| 1138 | 3300059477 | Ga0587084_040228 | Ga0587084_040228_278_736 | 152 |
| 1139 | 3300059505 | Ga0587083_0016341 | Ga0587083_0016341_687_1145 | 152 |
| 1140 | 3300059510 | Ga0587090_001520 | Ga0587090_001520_865_1323 | 152 |
| 1141 | 3300059510 | Ga0587090_002110 | Ga0587090_002110_1506_1964 | 152 |
| 1142 | 3300059510 | Ga0587090_007688 | Ga0587090_007688_780_1238 | 152 |
| 1143 | 3300059510 | Ga0587090_017945 | Ga0587090_017945_90_548 | 152 |
| 1144 | 3300059513 | Ga0587094_019363 | Ga0587094_019363_169_627 | 152 |
| 1145 | 3300059623 | Ga0587101_018139 | Ga0587101_018139_341_799 | 152 |
| 1146 | 3300059640 | Ga0587067_008178 | Ga0587067_008178_224_682 | 152 |
| 1147 | 3300059641 | Ga0587068_008866 | Ga0587068_008866_162_620 | 152 |
| 1148 | 3300059643 | Ga0587072_011558 | Ga0587072_011558_63_521 | 152 |
| 1149 | 3300059645 | Ga0587076_012201 | Ga0587076_012201_149_607 | 152 |
| 1150 | 3300059651 | Ga0587105_001077 | Ga0587105_001077_724_1182 | 152 |
| 1151 | 3300060346 | Ga0587111_0012970 | Ga0587111_0012970_308_766 | 152 |
| 1152 | 3300060346 | Ga0587111_0020665 | Ga0587111_0020665_32_490 | 152 |
| 1153 | 3300060346 | Ga0587111_0024244 | Ga0587111_0024244_215_673 | 152 |
| 1154 | 3300061719 | Ga0466962_0001661 | Ga0466962_0001661_4664_5125 | 152 |
| 1155 | 3300061719 | Ga0466962_0004649 | Ga0466962_0004649_2974_3432 | 152 |
| 1156 | 3300061719 | Ga0466962_0011849 | Ga0466962_0011849_3181_3639 | 152 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5cpg-assembly1.cif.gz_B | r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form | 0.8935 | 7 | 148 |
| 4ffu-assembly2.cif.gz_K | crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021 | 0.8851 | 4 | 147 |
| 4ffu-assembly2.cif.gz_K | crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021 | 0.879 | 4 | 147 |
| 4ffu-assembly1.cif.gz_D | crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021 | 0.8785 | 4 | 149 |
| 3exz-assembly1.cif.gz_A | crystal structure of the maoc-like dehydratase from rhodospirillum rubrum. northeast structural genomics consortium target rrr103a. | 0.8764 | 6 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1z54D00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9081 | 81 | 144 | 3.10.129.10 |
| 4ffuI00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9031 | 4 | 149 | 3.10.129.10 |
| 5cpgB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8935 | 7 | 148 | 3.10.129.10 |
| af_Q9W440_48_153_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8899 | 81 | 145 | 3.10.129.10 |
| af_I6Y9H2_24_180_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8856 | 1 | 148 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A2WH49-F1-model_v4 | deleted | 0.9683 | 1 | 152 |
|
| AF-A2WH49-F1-model_v4 | deleted | 0.9622 | 1 | 152 |
|
| AF-A0A0N0ZBV9-F1-model_v4 | deleted | 0.9584 | 1 | 152 |
|
| AF-A0A7W9TR50-F1-model_v4 | Acyl dehydratase | 0.9493 | 2 | 152 |
|
| AF-A0A840Y4M6-F1-model_v4 | Acyl dehydratase | 0.9476 | 4 | 147 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar