F490934

General Info

Members Datasets Scaffolds Average Seq Length
1156 445 1152 153

Family's Representative Sequence

Representative Sequence 3300003760|Ga0055527_1005009|Ga0055527_10050092
Length 186
Sequence MTIVEKYWDDAREGDTCTSPTYLVTKXRILAXADLTGDHTPVHVDEEYANASHFGCLVAHGLFGLSIADGLKTQSDYRFLPGMSLGWTWDFLLPIKVGDVLHVTFRVGSMRASKSRPDWGIVVLPSXLINQDGQVVQRGEHRLMVPRRPEALXCRHVPSKAFASSTTAISSPARMSXAVSRRSAPK

Samples

Sample ID Description Type Environment
1 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
2 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
3 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
4 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
13 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
23 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
24 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
25 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
26 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
27 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
28 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
29 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
30 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
31 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
34 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
35 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
36 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
37 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
38 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
39 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
40 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
41 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
42 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
43 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
44 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
45 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
46 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
49 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
50 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
51 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
63 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
64 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
70 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
95 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
98 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
101 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
106 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
112 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
113 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
126 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
127 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
140 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
141 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
142 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
146 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
147 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
148 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
155 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
157 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
158 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
159 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
162 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
163 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
164 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
171 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
173 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
176 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
227 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
228 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
232 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
233 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
234 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
235 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
236 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
237 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
238 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
239 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
240 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
241 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
242 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
243 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
244 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
245 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
246 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
247 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
248 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
249 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
250 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
253 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
254 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
255 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
256 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
257 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
258 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
259 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
260 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
261 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
262 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
263 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
264 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
265 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
266 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
267 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
268 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
269 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
270 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
271 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
272 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
273 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
274 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
275 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
276 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
277 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
278 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
279 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
280 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
281 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
282 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
283 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
284 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
285 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
286 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
287 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
288 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
289 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
290 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
291 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
292 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
293 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
294 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
295 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
296 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
297 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
298 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
299 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
300 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
301 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
302 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
303 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
304 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
305 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
306 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
307 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
308 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
309 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
310 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
311 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
312 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
313 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
314 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
315 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
316 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
317 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
318 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
319 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
320 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
321 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
322 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
323 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
324 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
325 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
326 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
327 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
328 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
329 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
330 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
331 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
332 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
333 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
334 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
335 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
336 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
337 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
338 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
339 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
340 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
341 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
342 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
343 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
344 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
345 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
346 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
347 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
348 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
349 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
350 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
351 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
352 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
353 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
354 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
355 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
356 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
357 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
358 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
359 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
360 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
361 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
362 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
363 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
364 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
365 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
366 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
367 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
368 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
369 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
370 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
371 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
372 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
373 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
374 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
375 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
376 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
377 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
378 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
379 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
380 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
381 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
382 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
383 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
384 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
385 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
386 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
387 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
388 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
389 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
390 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
391 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
392 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
393 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
394 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
396 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
397 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
398 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
399 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
403 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
404 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
405 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
406 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
407 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
408 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
409 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
410 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
411 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
412 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
413 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
414 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
415 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
416 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
417 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
418 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
419 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
420 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
421 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
422 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
423 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
424 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
425 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
426 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
427 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
428 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
429 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
430 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
431 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
432 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
433 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
434 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.75
Metatranscriptomes 1.9
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.28
Nodule 0.09
Rhizoplane 3.29
Rhizosphere 68.25
Stem 0
Stem Tuber 0
Unclassified 7.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000084 3300001915 Bacteria 23727
2 JGI24740J21852_10000038 3300001979 Bacteria 44180
3 JGI24740J21852_10000091 3300001979 Bacteria 31370
4 JGI24740J21852_10019260 3300001979 Bacteria 2407
5 JGI24740J21852_10065968 3300001979 Bacteria 983
6 JGI24739J22299_10078299 3300001989 Bacteria 1018
7 JGI24739J22299_10163337 3300001989 Bacteria 657
8 JGI24737J22298_10010200 3300001990 Bacteria 3106
9 JGI24735J21928_10000589 3300002067 Bacteria 12773
10 JGI25156J39149_1000006 3300002705 Bacteria 261778
11 JGI25156J39149_1000135 3300002705 Bacteria 53930
12 JGI25156J39149_1006100 3300002705 Bacteria 3344
13 JGI25156J39149_1006124 3300002705 Bacteria 3334
14 JGI25156J39149_1006256 3300002705 Bacteria 3278
15 JGI25156J39149_1016753 3300002705 Bacteria 1414
16 JGI25156J39149_1026051 3300002705 Bacteria 931
17 JGI25154J39366_1000389 3300002738 Bacteria 23912
18 JGI25158J39367_1009898 3300002739 Bacteria 1297
19 JGI25157J39369_1000016 3300002741 Bacteria 192349
20 JGI25150J39212_1002582 3300002774 Bacteria 4455
21 JGI25151J46595_10014151 3300003187 Bacteria 3567
22 JGI25151J46595_10068449 3300003187 Bacteria 1089
23 JGI25151J46595_10086425 3300003187 Bacteria 888
24 JGI25165J46597_1000661 3300003214 Bacteria 28133
25 JGI25153J46596_10033361 3300003215 Bacteria 1700
26 rootH1_10027942 3300003316 Bacteria 1821
27 rootH1_10048720 3300003316 Bacteria 2940
28 rootH1_10054218 3300003316 Bacteria 6135
29 rootH1_10101357 3300003316 Bacteria 1067
30 rootH2_10050565 3300003320 Bacteria 1325
31 rootL2_10009476 3300003322 Bacteria 12918
32 rootL2_10012388 3300003322 Bacteria 5838
33 rootL2_10137787 3300003322 Bacteria 12087
34 rootH1_10120212 3300003323 Bacteria 3646
35 rootH1_10201936 3300003323 Bacteria 1646
36 JGI25160J50197_1000098 3300003354 Bacteria 87307
37 JGI25161J50226_1000037 3300003374 Bacteria 133331
38 Ga0055539_1000075 3300003752 Bacteria 130079
39 Ga0055533_1000140 3300003756 Bacteria 76502
40 Ga0055533_1000933 3300003756 Bacteria 8687
41 Ga0055532_1000003 3300003758 Bacteria 494004
42 Ga0055532_1000056 3300003758 Bacteria 158878
43 Ga0055532_1000265 3300003758 Bacteria 34085
44 Ga0055532_1005641 3300003758 Bacteria 1739
45 Ga0055525_1000492 3300003759 Bacteria 20296
46 Ga0055525_1011031 3300003759 Bacteria 762
47 Ga0055527_1000006 3300003760 Bacteria 494004
48 Ga0055527_1000323 3300003760 Bacteria 25846
49 Ga0055527_1002493 3300003760 Bacteria 3100
50 Ga0055527_1005009 3300003760 Bacteria 1763
51 Ga0055527_1006523 3300003760 Bacteria 1458
52 Ga0055535_1000003 3300003761 Bacteria 494004
53 Ga0055535_1000013 3300003761 Bacteria 299614
54 Ga0055535_1000115 3300003761 Bacteria 86313
55 Ga0055535_1000134 3300003761 Bacteria 78815
56 Ga0055535_1000701 3300003761 Bacteria 25846
57 Ga0055542_1000007 3300003762 Bacteria 494004
58 Ga0055542_1000028 3300003762 Bacteria 251458
59 Ga0055542_1000178 3300003762 Bacteria 78815
60 Ga0055542_1000861 3300003762 Bacteria 21268
61 Ga0055542_1002118 3300003762 Bacteria 7288
62 Ga0055529_1000003 3300003763 Bacteria 494004
63 Ga0055529_1000074 3300003763 Bacteria 158872
64 Ga0055529_1000203 3300003763 Bacteria 78815
65 Ga0055526_1000184 3300003771 Bacteria 54504
66 Ga0055537_1000006 3300003773 Bacteria 147020
67 Ga0055537_1007555 3300003773 Bacteria 2609
68 Ga0055524_1000032 3300003775 Bacteria 182182
69 Ga0055536_1005877 3300003781 Bacteria 5884
70 Ga0055536_1007682 3300003781 Bacteria 4777
71 Ga0055534_1004608 3300003784 Bacteria 3931
72 Ga0055534_1007435 3300003784 Bacteria 2609
73 Ga0055528_1002844 3300003790 Bacteria 9038
74 Ga0055528_1003256 3300003790 Bacteria 8273
75 Ga0055528_1016487 3300003790 Bacteria 2609
76 Ga0055530_10000380 3300003791 Bacteria 40324
77 Ga0055530_10000731 3300003791 Bacteria 27463
78 Ga0055530_10000890 3300003791 Bacteria 24579
79 Ga0055530_10003806 3300003791 Bacteria 8300
80 Ga0055540_1000046 3300003792 Bacteria 148762
81 Ga0055540_1001790 3300003792 Bacteria 12221
82 Ga0055540_1002356 3300003792 Bacteria 10109
83 Ga0055540_1019493 3300003792 Bacteria 1824
84 Ga0055531_10000084 3300003794 Bacteria 102550
85 Ga0055531_10003007 3300003794 Bacteria 10942
86 Ga0055541_1000425 3300003841 Bacteria 12425
87 Ga0055541_1002842 3300003841 Bacteria 3353
88 Ga0058692_1008655 3300003856 Bacteria 2617
89 Ga0055543_1000645 3300004625 Bacteria 18613
90 Ga0065165_1000821 3300005262 Bacteria 41157
91 Ga0065165_1022462 3300005262 Bacteria 2161
92 Ga0065165_1022630 3300005262 Bacteria 2149
93 Ga0065714_10077745 3300005288 Bacteria 2662
94 Ga0065704_10147436 3300005289 Bacteria 1459
95 Ga0070658_10027600 3300005327 Bacteria 4554
96 Ga0070658_10092842 3300005327 Bacteria 2489
97 Ga0070658_10247226 3300005327 Bacteria 1513
98 Ga0070658_10483300 3300005327 Bacteria 1069
99 Ga0070676_10018812 3300005328 Bacteria 3834
100 Ga0070676_10139974 3300005328 Bacteria 1539
101 Ga0070676_10149055 3300005328 Bacteria 1496
102 Ga0070670_100000540 3300005331 Bacteria 30079
103 Ga0070670_100022297 3300005331 Bacteria 5451
104 Ga0070670_100068177 3300005331 Bacteria 3054
105 Ga0068869_100002271 3300005334 Bacteria 11571
106 Ga0068869_101121546 3300005334 Bacteria 689
107 Ga0070666_10074877 3300005335 Bacteria 2308
108 Ga0068868_100032080 3300005338 Bacteria 4039
109 Ga0070660_100000029 3300005339 Bacteria 88220
110 Ga0070660_100015930 3300005339 Bacteria 5444
111 Ga0070660_100108727 3300005339 Bacteria 2204
112 Ga0070661_100001417 3300005344 Bacteria 16689
113 Ga0070661_100052691 3300005344 Bacteria 2978
114 Ga0070661_100400221 3300005344 Bacteria 1085
115 Ga0070668_100110348 3300005347 Bacteria 2189
116 Ga0070669_100020431 3300005353 Bacteria 4730
117 Ga0070671_100020456 3300005355 Bacteria 5398
118 Ga0070671_100048591 3300005355 Bacteria 3529
119 Ga0070674_101228322 3300005356 Bacteria 666
120 Ga0070673_100266969 3300005364 Bacteria 1497
121 Ga0070659_100000006 3300005366 Bacteria 229954
122 Ga0070659_100000307 3300005366 Bacteria 38077
123 Ga0070659_100025930 3300005366 Bacteria 4509
124 Ga0070659_100057651 3300005366 Bacteria 3063
125 Ga0070667_100005867 3300005367 Bacteria 10238
126 Ga0070667_100216118 3300005367 Bacteria 1705
127 Ga0070667_100909936 3300005367 Bacteria 819
128 Ga0070705_100168650 3300005440 Bacteria 1471
129 Ga0070700_100352045 3300005441 Bacteria 1092
130 Ga0070708_100027484 3300005445 Bacteria 4883
131 Ga0070663_100000002 3300005455 Bacteria 298075
132 Ga0070663_100018810 3300005455 Bacteria 4539
133 Ga0070663_100288472 3300005455 Bacteria 1310
134 Ga0070663_100293494 3300005455 Bacteria 1299
135 Ga0070663_100365164 3300005455 Bacteria 1172
136 Ga0070663_100380086 3300005455 Bacteria 1150
137 Ga0070663_100398795 3300005455 Bacteria 1124
138 Ga0070663_100588954 3300005455 Bacteria 934
139 Ga0070663_100800769 3300005455 Bacteria 808
140 Ga0070678_100359437 3300005456 Bacteria 1254
141 Ga0070678_100675304 3300005456 Bacteria 929
142 Ga0070662_100179746 3300005457 Bacteria 1667
143 Ga0070662_100205147 3300005457 Bacteria 1566
144 Ga0070662_100521362 3300005457 Bacteria 993
145 Ga0070662_100867174 3300005457 Bacteria 769
146 Ga0068867_100058308 3300005459 Bacteria 2861
147 Ga0068867_100546421 3300005459 Bacteria 1003
148 Ga0070706_100008574 3300005467 Bacteria 9529
149 Ga0070706_100765192 3300005467 Bacteria 895
150 Ga0070707_101217524 3300005468 Bacteria 719
151 Ga0070684_100203830 3300005535 Bacteria 1802
152 Ga0068853_100024762 3300005539 Bacteria 5035
153 Ga0068853_100115482 3300005539 Bacteria 2389
154 Ga0068853_100170844 3300005539 Bacteria 1967
155 Ga0068853_100603924 3300005539 Bacteria 1042
156 Ga0068853_101622124 3300005539 Bacteria 627
157 Ga0070672_100013787 3300005543 Bacteria 5715
158 Ga0070672_101234742 3300005543 Bacteria 666
159 Ga0070695_100150446 3300005545 Bacteria 1624
160 Ga0070696_100527259 3300005546 Bacteria 943
161 Ga0070693_100101426 3300005547 Bacteria 1754
162 Ga0068855_100445628 3300005563 Bacteria 1413
163 Ga0068855_100540458 3300005563 Bacteria 1262
164 Ga0068855_100830538 3300005563 Bacteria 980
165 Ga0070664_100000004 3300005564 Bacteria 298075
166 Ga0070664_100005230 3300005564 Bacteria 10411
167 Ga0070664_100076910 3300005564 Bacteria 2869
168 Ga0068857_100057826 3300005577 Bacteria 3442
169 Ga0068857_100317346 3300005577 Bacteria 1439
170 Ga0068857_100334396 3300005577 Bacteria 1400
171 Ga0068857_100389899 3300005577 Bacteria 1295
172 Ga0068857_101590763 3300005577 Bacteria 638
173 Ga0068854_100000007 3300005578 Bacteria 182830
174 Ga0068854_100376402 3300005578 Bacteria 1169
175 Ga0068854_101469546 3300005578 Bacteria 618
176 Ga0068856_100000105 3300005614 Bacteria 81780
177 Ga0068856_100305768 3300005614 Bacteria 1608
178 Ga0068856_100414966 3300005614 Bacteria 1366
179 Ga0068856_100712190 3300005614 Bacteria 1024
180 Ga0068856_101023881 3300005614 Bacteria 844
181 Ga0068852_100013481 3300005616 Bacteria 6258
182 Ga0068852_100017829 3300005616 Bacteria 5580
183 Ga0068852_100018858 3300005616 Bacteria 5445
184 Ga0068852_100068820 3300005616 Bacteria 3100
185 Ga0068852_100142243 3300005616 Bacteria 2222
186 Ga0068852_100168530 3300005616 Bacteria 2051
187 Ga0068852_101425210 3300005616 Bacteria 715
188 Ga0068859_100057856 3300005617 Bacteria 3905
189 Ga0068859_100116942 3300005617 Bacteria 2731
190 Ga0068859_100491199 3300005617 Bacteria 1323
191 Ga0068859_100632211 3300005617 Bacteria 1163
192 Ga0068864_100003727 3300005618 Bacteria 12581
193 Ga0068864_100025373 3300005618 Bacteria 4990
194 Ga0068861_100006842 3300005719 Bacteria 7785
195 Ga0068861_101879197 3300005719 Bacteria 595
196 Ga0068851_10080322 3300005834 Bacteria 1702
197 Ga0068851_10121300 3300005834 Bacteria 1405
198 Ga0068870_10001893 3300005840 Bacteria 8628
199 Ga0068863_100048750 3300005841 Bacteria 4016
200 Ga0068863_100085322 3300005841 Bacteria 2992
201 Ga0068863_100086430 3300005841 Bacteria 2971
202 Ga0068858_100011316 3300005842 Bacteria 8430
203 Ga0068858_101576166 3300005842 Bacteria 648
204 Ga0068860_100013006 3300005843 Bacteria 8172
205 Ga0068860_100520270 3300005843 Bacteria 1190
206 Ga0068862_100028341 3300005844 Bacteria 4715
207 Ga0068862_100135585 3300005844 Bacteria 2181
208 Ga0081539_10266234 3300005985 Bacteria 753
209 Ga0075365_10001937 3300006038 Bacteria 9772
210 Ga0075365_10149154 3300006038 Bacteria 1626
211 Ga0075368_10001130 3300006042 Bacteria 8413
212 Ga0075368_10204252 3300006042 Bacteria 836
213 Ga0075368_10206456 3300006042 Bacteria 832
214 Ga0075363_100020439 3300006048 Bacteria 3320
215 Ga0075363_100185993 3300006048 Bacteria 1183
216 Ga0075363_100209451 3300006048 Bacteria 1115
217 Ga0075363_100615349 3300006048 Bacteria 651
218 Ga0075364_10005448 3300006051 Bacteria 7393
219 Ga0075364_10012743 3300006051 Bacteria 5156
220 Ga0075432_10004475 3300006058 Bacteria 4765
221 Ga0075362_10001157 3300006177 Bacteria 8246
222 Ga0075362_10029335 3300006177 Bacteria 2370
223 Ga0075367_10000488 3300006178 Bacteria 14852
224 Ga0075367_10094701 3300006178 Bacteria 1820
225 Ga0075367_10418751 3300006178 Bacteria 848
226 Ga0075367_10572047 3300006178 Bacteria 718
227 Ga0075369_10001709 3300006186 Bacteria 7598
228 Ga0075366_10024831 3300006195 Bacteria 3496
229 Ga0075366_10073998 3300006195 Bacteria 2031
230 Ga0075366_10088640 3300006195 Bacteria 1853
231 Ga0075366_10104313 3300006195 Bacteria 1703
232 Ga0075366_10221684 3300006195 Bacteria 1152
233 Ga0075366_10308888 3300006195 Bacteria 968
234 Ga0097621_100363184 3300006237 Bacteria 1290
235 Ga0075370_10000375 3300006353 Bacteria 16453
236 Ga0075370_10000575 3300006353 Bacteria 14121
237 Ga0075370_10023715 3300006353 Bacteria 3382
238 Ga0075370_10039542 3300006353 Bacteria 2658
239 Ga0075370_10060742 3300006353 Bacteria 2153
240 Ga0068871_101061949 3300006358 Bacteria 756
241 Ga0075428_100027331 3300006844 Bacteria 6314
242 Ga0075431_101080908 3300006847 Bacteria 767
243 Ga0075434_100283591 3300006871 Bacteria 1676
244 Ga0097620_100057853 3300006931 Bacteria 3905
245 Ga0097620_100116928 3300006931 Bacteria 2731
246 Ga0097620_100491111 3300006931 Bacteria 1323
247 Ga0097620_100632069 3300006931 Bacteria 1163
248 Ga0079104_1038669 3300006946 Bacteria 1129
249 Ga0075435_100833826 3300007076 Bacteria 803
250 Ga0105251_10000005 3300009011 Bacteria 259226
251 Ga0105251_10000427 3300009011 Bacteria 40852
252 Ga0105251_10003188 3300009011 Bacteria 12129
253 Ga0105244_10012387 3300009036 Bacteria 5040
254 Ga0105244_10023604 3300009036 Bacteria 3369
255 Ga0105244_10060514 3300009036 Bacteria 1907
256 Ga0105244_10282175 3300009036 Bacteria 770
257 Ga0105250_10030058 3300009092 Bacteria 2185
258 Ga0105250_10192633 3300009092 Bacteria 858
259 Ga0105240_10004916 3300009093 Bacteria 20092
260 Ga0105240_10006257 3300009093 Bacteria 17511
261 Ga0105240_10060318 3300009093 Bacteria 4729
262 Ga0105240_10088421 3300009093 Bacteria 3790
263 Ga0105240_10101797 3300009093 Bacteria 3492
264 Ga0105240_10203394 3300009093 Bacteria 2319
265 Ga0105240_10284603 3300009093 Bacteria 1898
266 Ga0105240_11165314 3300009093 Bacteria 817
267 Ga0105240_11214318 3300009093 Bacteria 798
268 Ga0105240_11650691 3300009093 Bacteria 670
269 Ga0105245_10014386 3300009098 Bacteria 6892
270 Ga0105245_10374711 3300009098 Bacteria 1416
271 Ga0105245_11123170 3300009098 Bacteria 833
272 Ga0105247_10034404 3300009101 Bacteria 3085
273 Ga0105243_10004528 3300009148 Bacteria 10982
274 Ga0105243_10032819 3300009148 Bacteria 4013
275 Ga0105243_10165120 3300009148 Bacteria 1913
276 Ga0105241_10169198 3300009174 Bacteria 1803
277 Ga0105242_10340120 3300009176 Bacteria 1383
278 Ga0105242_10567469 3300009176 Bacteria 1091
279 Ga0105248_10005602 3300009177 Bacteria 13799
280 Ga0105248_10006219 3300009177 Bacteria 13091
281 Ga0105248_10011634 3300009177 Bacteria 9694
282 Ga0105248_10236846 3300009177 Bacteria 2055
283 Ga0105248_10639287 3300009177 Bacteria 1200
284 Ga0105248_11017885 3300009177 Bacteria 936
285 Ga0105237_10015527 3300009545 Bacteria 7923
286 Ga0105237_10017774 3300009545 Bacteria 7372
287 Ga0105237_10141187 3300009545 Bacteria 2403
288 Ga0105237_10159765 3300009545 Bacteria 2252
289 Ga0105237_10377768 3300009545 Bacteria 1422
290 Ga0105238_10014547 3300009551 Bacteria 7958
291 Ga0105238_10051201 3300009551 Bacteria 4154
292 Ga0105238_10056077 3300009551 Bacteria 3953
293 Ga0105238_10671102 3300009551 Bacteria 1047
294 Ga0105238_11101693 3300009551 Bacteria 817
295 Ga0105238_11375308 3300009551 Bacteria 733
296 Ga0105238_12195069 3300009551 Bacteria 587
297 Ga0105249_10276877 3300009553 Bacteria 1674
298 Ga0105239_10014021 3300010375 Bacteria 8898
299 Ga0105239_10103451 3300010375 Bacteria 3152
300 Ga0105239_10158456 3300010375 Bacteria 2528
301 Ga0157347_1011112 3300012502 Bacteria 953
302 Ga0157373_10004956 3300013100 Bacteria 10008
303 Ga0157373_10015931 3300013100 Bacteria 5489
304 Ga0157373_10025435 3300013100 Bacteria 4282
305 Ga0157373_10261531 3300013100 Bacteria 1225
306 Ga0157373_10711698 3300013100 Bacteria 736
307 Ga0157371_10000086 3300013102 Bacteria 146397
308 Ga0157371_10000223 3300013102 Bacteria 82671
309 Ga0157371_10000986 3300013102 Bacteria 31519
310 Ga0157371_10025877 3300013102 Bacteria 4270
311 Ga0157371_10082692 3300013102 Bacteria 2273
312 Ga0157371_10123211 3300013102 Bacteria 1843
313 Ga0157371_10893380 3300013102 Bacteria 673
314 Ga0157370_10000074 3300013104 Bacteria 108622
315 Ga0157370_10042603 3300013104 Bacteria 4373
316 Ga0157370_10059009 3300013104 Bacteria 3647
317 Ga0157370_10113281 3300013104 Bacteria 2535
318 Ga0157370_11509944 3300013104 Bacteria 604
319 Ga0157369_10000383 3300013105 Bacteria 58625
320 Ga0157369_10001241 3300013105 Bacteria 31779
321 Ga0157369_10001440 3300013105 Bacteria 29208
322 Ga0157369_10001863 3300013105 Bacteria 25417
323 Ga0157369_10039961 3300013105 Bacteria 5124
324 Ga0157369_10138605 3300013105 Bacteria 2574
325 Ga0157369_10147744 3300013105 Bacteria 2485
326 Ga0157369_10165598 3300013105 Bacteria 2332
327 Ga0157369_10546899 3300013105 Bacteria 1197
328 Ga0157374_10000116 3300013296 Bacteria 73468
329 Ga0157374_10009373 3300013296 Bacteria 8399
330 Ga0157374_10043751 3300013296 Bacteria 4138
331 Ga0157374_10223274 3300013296 Bacteria 1849
332 Ga0157378_10010746 3300013297 Bacteria 8001
333 Ga0157378_10465018 3300013297 Bacteria 1258
334 Ga0163162_10005148 3300013306 Bacteria 12599
335 Ga0163162_10043604 3300013306 Bacteria 4492
336 Ga0163162_10160493 3300013306 Bacteria 2370
337 Ga0163162_10476825 3300013306 Bacteria 1379
338 Ga0163162_11008243 3300013306 Bacteria 942
339 Ga0157372_10000085 3300013307 Bacteria 96915
340 Ga0157372_10012524 3300013307 Bacteria 9032
341 Ga0157372_10166010 3300013307 Bacteria 2553
342 Ga0157372_10312934 3300013307 Bacteria 1828
343 Ga0157372_10516180 3300013307 Bacteria 1393
344 Ga0157375_10007536 3300013308 Bacteria 9515
345 Ga0157375_10194238 3300013308 Bacteria 2185
346 Ga0163163_10128554 3300014325 Bacteria 2572
347 Ga0163163_10574087 3300014325 Bacteria 1191
348 Ga0157380_12314693 3300014326 Bacteria 602
349 Ga0182008_10002465 3300014497 Bacteria 11584
350 Ga0182008_10002632 3300014497 Bacteria 11135
351 Ga0182008_10021729 3300014497 Bacteria 3295
352 Ga0182008_10294901 3300014497 Bacteria 847
353 Ga0157379_10021652 3300014968 Bacteria 5693
354 Ga0157379_10074906 3300014968 Bacteria 3030
355 Ga0182006_1000317 3300015261 Bacteria 42256
356 Ga0182006_1002482 3300015261 Bacteria 10055
357 Ga0182006_1004530 3300015261 Bacteria 6840
358 Ga0182006_1006004 3300015261 Bacteria 5691
359 Ga0182006_1007384 3300015261 Bacteria 5034
360 Ga0182006_1018543 3300015261 Bacteria 2939
361 Ga0182006_1020371 3300015261 Bacteria 2780
362 Ga0182006_1091634 3300015261 Bacteria 1093
363 Ga0182006_1204321 3300015261 Bacteria 654
364 Ga0182007_10001059 3300015262 Bacteria 14995
365 Ga0182007_10012055 3300015262 Bacteria 3338
366 Ga0182007_10038048 3300015262 Bacteria 1614
367 Ga0182005_1103388 3300015265 Bacteria 800
368 Ga0182005_1118525 3300015265 Bacteria 752
369 Ga0183362_10002 3300015683 Bacteria 1432711
370 Ga0163161_10000657 3300017792 Bacteria 27646
371 Ga0163161_11784556 3300017792 Bacteria 547
372 Ga0154015_1180002 3300020610 Bacteria 31491
373 Ga0213872_10003058 3300021361 Bacteria 9432
374 Ga0209435_100010 3300025206 Bacteria 475373
375 Ga0209435_101521 3300025206 Bacteria 2899
376 Ga0209436_104404 3300025208 Bacteria 3489
377 Ga0209784_100008 3300025224 Bacteria 740293
378 Ga0209784_100829 3300025224 Bacteria 6984
379 Ga0209784_101133 3300025224 Bacteria 4310
380 Ga0209566_100006 3300025225 Bacteria 789272
381 Ga0209566_100354 3300025225 Bacteria 39082
382 Ga0209566_100567 3300025225 Bacteria 24190
383 Ga0209566_104658 3300025225 Bacteria 1838
384 Ga0209674_100025 3300025226 Bacteria 515942
385 Ga0209674_100070 3300025226 Bacteria 242214
386 Ga0209674_100093 3300025226 Bacteria 170423
387 Ga0209674_100120 3300025226 Bacteria 134811
388 Ga0209674_101148 3300025226 Bacteria 7661
389 Ga0209672_100002 3300025228 Bacteria 1733325
390 Ga0209672_100044 3300025228 Bacteria 270292
391 Ga0209672_100075 3300025228 Bacteria 159275
392 Ga0209672_100413 3300025228 Bacteria 25187
393 Ga0209672_100982 3300025228 Bacteria 12586
394 Ga0209672_101155 3300025228 Bacteria 10845
395 Ga0209147_100003 3300025229 Bacteria 1733325
396 Ga0209147_100005 3300025229 Bacteria 1036530
397 Ga0209147_100039 3300025229 Bacteria 311101
398 Ga0209147_100119 3300025229 Bacteria 142860
399 Ga0209147_100176 3300025229 Bacteria 80329
400 Ga0209147_101077 3300025229 Bacteria 11501
401 Ga0209563_100016 3300025230 Bacteria 802091
402 Ga0209563_101301 3300025230 Bacteria 6813
403 Ga0209563_102708 3300025230 Bacteria 3895
404 Ga0207427_100777 3300025231 Bacteria 14536
405 Ga0209258_100005 3300025242 Bacteria 1087938
406 Ga0209258_100007 3300025242 Bacteria 1036530
407 Ga0209258_100062 3300025242 Bacteria 311101
408 Ga0209258_100067 3300025242 Bacteria 287603
409 Ga0209258_100153 3300025242 Bacteria 159275
410 Ga0207425_1000434 3300025245 Bacteria 27651
411 Ga0207425_1000908 3300025245 Bacteria 14229
412 Ga0207425_1001023 3300025245 Bacteria 13062
413 Ga0207425_1010792 3300025245 Bacteria 2208
414 Ga0209646_1000001 3300025246 Bacteria 3092932
415 Ga0209646_1000016 3300025246 Bacteria 501688
416 Ga0209646_1002708 3300025246 Bacteria 3782
417 Ga0209026_1000001 3300025250 Bacteria 1228671
418 Ga0209026_1001651 3300025250 Bacteria 9453
419 Ga0209677_100008 3300025253 Bacteria 802091
420 Ga0209148_1000006 3300025254 Bacteria 1733325
421 Ga0209148_1000051 3300025254 Bacteria 401000
422 Ga0209148_1000067 3300025254 Bacteria 338678
423 Ga0209148_1000075 3300025254 Bacteria 311101
424 Ga0209148_1000728 3300025254 Bacteria 25777
425 Ga0209148_1003409 3300025254 Bacteria 4417
426 Ga0209759_1000001 3300025256 Bacteria 2799452
427 Ga0209759_1000002 3300025256 Bacteria 1027596
428 Ga0209759_1000014 3300025256 Bacteria 396291
429 Ga0209759_1000039 3300025256 Bacteria 256444
430 Ga0209759_1001110 3300025256 Bacteria 17366
431 Ga0209759_1002345 3300025256 Bacteria 8458
432 Ga0209759_1006058 3300025256 Bacteria 4121
433 Ga0209759_1019604 3300025256 Bacteria 1598
434 Ga0209129_1000030 3300025258 Bacteria 391958
435 Ga0209129_1019612 3300025258 Bacteria 1274
436 Ga0209129_1031627 3300025258 Bacteria 880
437 Ga0209233_1000018 3300025261 Bacteria 886857
438 Ga0209233_1051508 3300025261 Bacteria 834
439 Ga0209565_1000016 3300025263 Bacteria 477707
440 Ga0209565_1000019 3300025263 Bacteria 438920
441 Ga0209565_1001223 3300025263 Bacteria 12115
442 Ga0209455_1000003 3300025272 Bacteria 1471893
443 Ga0209455_1000011 3300025272 Bacteria 947242
444 Ga0209455_1000067 3300025272 Bacteria 311101
445 Ga0209455_1000221 3300025272 Bacteria 78847
446 Ga0209673_1000066 3300025273 Bacteria 250037
447 Ga0209673_1000073 3300025273 Bacteria 233645
448 Ga0209673_1000095 3300025273 Bacteria 197466
449 Ga0209673_1001044 3300025273 Bacteria 32181
450 Ga0209130_1000011 3300025284 Bacteria 431723
451 Ga0209130_1000141 3300025284 Bacteria 115378
452 Ga0209130_1000210 3300025284 Bacteria 77155
453 Ga0209130_1004492 3300025284 Bacteria 5270
454 Ga0209130_1012453 3300025284 Bacteria 2224
455 Ga0209675_1000031 3300025291 Bacteria 273599
456 Ga0209675_1000356 3300025291 Bacteria 39400
457 Ga0209675_1004844 3300025291 Bacteria 5831
458 Ga0209676_1000005 3300025292 Bacteria 1076001
459 Ga0209676_1000123 3300025292 Bacteria 195351
460 Ga0209676_1000165 3300025292 Bacteria 156709
461 Ga0209676_1002917 3300025292 Bacteria 11181
462 Ga0209676_1020438 3300025292 Bacteria 2249
463 Ga0209025_1000078 3300025294 Bacteria 271683
464 Ga0209025_1000319 3300025294 Bacteria 107011
465 Ga0209025_1001554 3300025294 Bacteria 29174
466 Ga0209025_1009510 3300025294 Bacteria 6754
467 Ga0209564_1000056 3300025295 Bacteria 340873
468 Ga0209564_1000099 3300025295 Bacteria 225256
469 Ga0209564_1000165 3300025295 Bacteria 160244
470 Ga0209564_1005057 3300025295 Bacteria 7704
471 Ga0209564_1010599 3300025295 Bacteria 4223
472 Ga0209758_1000037 3300025297 Bacteria 439101
473 Ga0209050_1000007 3300025298 Bacteria 1187891
474 Ga0209050_1000084 3300025298 Bacteria 263245
475 Ga0209050_1000188 3300025298 Bacteria 138865
476 Ga0209050_1014814 3300025298 Bacteria 3327
477 Ga0209256_1000022 3300025299 Bacteria 481843
478 Ga0209256_1000043 3300025299 Bacteria 340873
479 Ga0209256_1000110 3300025299 Bacteria 182312
480 Ga0207426_1000029 3300025302 Bacteria 473835
481 Ga0207426_1000103 3300025302 Bacteria 250320
482 Ga0207426_1000145 3300025302 Bacteria 191065
483 Ga0207426_1000260 3300025302 Bacteria 114246
484 Ga0207426_1002451 3300025302 Bacteria 11822
485 Ga0207426_1003898 3300025302 Bacteria 7678
486 Ga0209051_1000036 3300025303 Bacteria 339863
487 Ga0209051_1000058 3300025303 Bacteria 263137
488 Ga0209051_1000091 3300025303 Bacteria 173683
489 Ga0209051_1000494 3300025303 Bacteria 50941
490 Ga0209257_1000011 3300025304 Bacteria 1112630
491 Ga0209257_1000057 3300025304 Bacteria 396985
492 Ga0209257_1000092 3300025304 Bacteria 263137
493 Ga0207697_10041147 3300025315 Bacteria 1898
494 Ga0207656_10008463 3300025321 Bacteria 3790
495 Ga0207656_10046457 3300025321 Bacteria 1863
496 Ga0207696_1054182 3300025711 Bacteria 1140
497 Ga0207655_1001871 3300025728 Bacteria 18120
498 Ga0207655_1023574 3300025728 Bacteria 3047
499 Ga0207655_1030654 3300025728 Bacteria 2497
500 Ga0207713_1000036 3300025735 Bacteria 259717
501 Ga0207713_1002789 3300025735 Bacteria 12345
502 Ga0207713_1007353 3300025735 Bacteria 6515
503 Ga0207713_1052813 3300025735 Bacteria 1606
504 Ga0207680_10060019 3300025903 Bacteria 2313
505 Ga0207680_10061690 3300025903 Bacteria 2287
506 Ga0207680_10164462 3300025903 Bacteria 1490
507 Ga0207647_10009559 3300025904 Bacteria 6883
508 Ga0207647_10011061 3300025904 Bacteria 6345
509 Ga0207647_10014440 3300025904 Bacteria 5444
510 Ga0207647_10042812 3300025904 Bacteria 2837
511 Ga0207647_10200988 3300025904 Bacteria 1153
512 Ga0207647_10501517 3300025904 Bacteria 677
513 Ga0207645_10031101 3300025907 Bacteria 3436
514 Ga0207645_10143331 3300025907 Bacteria 1557
515 Ga0207643_10195687 3300025908 Bacteria 1229
516 Ga0207705_10084916 3300025909 Bacteria 2312
517 Ga0207705_10107081 3300025909 Bacteria 2062
518 Ga0207705_10202607 3300025909 Bacteria 1504
519 Ga0207684_10609822 3300025910 Bacteria 932
520 Ga0207654_10454470 3300025911 Bacteria 898
521 Ga0207695_10003008 3300025913 Bacteria 24230
522 Ga0207695_10003114 3300025913 Bacteria 23727
523 Ga0207695_10014899 3300025913 Bacteria 9177
524 Ga0207695_10032225 3300025913 Bacteria 5738
525 Ga0207695_10159983 3300025913 Bacteria 2184
526 Ga0207695_10333238 3300025913 Bacteria 1406
527 Ga0207695_10400404 3300025913 Bacteria 1257
528 Ga0207695_10595466 3300025913 Bacteria 987
529 Ga0207695_10614241 3300025913 Bacteria 968
530 Ga0207695_10892025 3300025913 Bacteria 769
531 Ga0207671_10043088 3300025914 Bacteria 3337
532 Ga0207671_10065133 3300025914 Bacteria 2710
533 Ga0207671_10068770 3300025914 Bacteria 2639
534 Ga0207671_10343119 3300025914 Bacteria 1183
535 Ga0207657_10000072 3300025919 Bacteria 93655
536 Ga0207657_10000389 3300025919 Bacteria 46345
537 Ga0207657_10319697 3300025919 Bacteria 1227
538 Ga0207657_10985322 3300025919 Bacteria 647
539 Ga0207649_10001426 3300025920 Bacteria 14134
540 Ga0207646_10715054 3300025922 Bacteria 895
541 Ga0207646_11175496 3300025922 Bacteria 673
542 Ga0207681_10033213 3300025923 Bacteria 3381
543 Ga0207681_10139559 3300025923 Bacteria 1803
544 Ga0207694_10047952 3300025924 Bacteria 3304
545 Ga0207694_10152653 3300025924 Bacteria 1861
546 Ga0207694_10677670 3300025924 Bacteria 869
547 Ga0207694_10795689 3300025924 Bacteria 799
548 Ga0207694_10797322 3300025924 Bacteria 798
549 Ga0207694_10951144 3300025924 Bacteria 727
550 Ga0207650_10005387 3300025925 Bacteria 8727
551 Ga0207650_10007014 3300025925 Bacteria 7686
552 Ga0207650_10088595 3300025925 Bacteria 2360
553 Ga0207650_10201358 3300025925 Bacteria 1595
554 Ga0207687_10012072 3300025927 Bacteria 5649
555 Ga0207644_10007558 3300025931 Bacteria 7085
556 Ga0207644_10351277 3300025931 Bacteria 1197
557 Ga0207644_11125769 3300025931 Bacteria 660
558 Ga0207690_10000019 3300025932 Bacteria 235380
559 Ga0207690_10000722 3300025932 Bacteria 21290
560 Ga0207690_10064824 3300025932 Bacteria 2496
561 Ga0207690_10095002 3300025932 Bacteria 2117
562 Ga0207706_10311127 3300025933 Bacteria 1371
563 Ga0207706_10506764 3300025933 Bacteria 1041
564 Ga0207706_10534820 3300025933 Bacteria 1010
565 Ga0207686_10277216 3300025934 Bacteria 1236
566 Ga0207709_10001089 3300025935 Bacteria 19893
567 Ga0207709_10012585 3300025935 Bacteria 4662
568 Ga0207669_10312672 3300025937 Bacteria 1199
569 Ga0207704_11108880 3300025938 Bacteria 673
570 Ga0207691_10071487 3300025940 Bacteria 3131
571 Ga0207691_10423659 3300025940 Bacteria 1134
572 Ga0207711_10012168 3300025941 Bacteria 7152
573 Ga0207711_10015519 3300025941 Bacteria 6322
574 Ga0207711_10397875 3300025941 Bacteria 1280
575 Ga0207689_10000556 3300025942 Bacteria 35605
576 Ga0207689_10091608 3300025942 Bacteria 2497
577 Ga0207689_10271241 3300025942 Bacteria 1405
578 Ga0207679_10000002 3300025945 Bacteria 634491
579 Ga0207679_10026449 3300025945 Bacteria 4001
580 Ga0207679_10073814 3300025945 Bacteria 2583
581 Ga0207667_10038803 3300025949 Bacteria 5080
582 Ga0207667_10066718 3300025949 Bacteria 3750
583 Ga0207667_10866813 3300025949 Bacteria 896
584 Ga0207668_10016062 3300025972 Bacteria 4664
585 Ga0207668_10017548 3300025972 Bacteria 4486
586 Ga0207640_10000101 3300025981 Bacteria 66091
587 Ga0207640_10573321 3300025981 Bacteria 952
588 Ga0207658_10006734 3300025986 Bacteria 7821
589 Ga0207658_10112736 3300025986 Bacteria 2153
590 Ga0207658_10661784 3300025986 Bacteria 942
591 Ga0207677_10010768 3300026023 Bacteria 5185
592 Ga0207677_11861798 3300026023 Bacteria 559
593 Ga0207703_10005102 3300026035 Bacteria 10621
594 Ga0207703_10876535 3300026035 Bacteria 859
595 Ga0207639_10022579 3300026041 Bacteria 4533
596 Ga0207639_10427501 3300026041 Bacteria 1199
597 Ga0207678_10000003 3300026067 Bacteria 282716
598 Ga0207678_10030675 3300026067 Bacteria 4694
599 Ga0207678_10095757 3300026067 Bacteria 2537
600 Ga0207678_10358986 3300026067 Bacteria 1257
601 Ga0207678_10370686 3300026067 Bacteria 1237
602 Ga0207678_10420443 3300026067 Bacteria 1159
603 Ga0207702_10000010 3300026078 Bacteria 292789
604 Ga0207702_10458938 3300026078 Bacteria 1237
605 Ga0207702_10581841 3300026078 Bacteria 1097
606 Ga0207702_10957693 3300026078 Bacteria 849
607 Ga0207641_10050978 3300026088 Bacteria 3504
608 Ga0207641_10067199 3300026088 Bacteria 3070
609 Ga0207641_10420959 3300026088 Bacteria 1286
610 Ga0207648_10100100 3300026089 Bacteria 2539
611 Ga0207648_10194167 3300026089 Bacteria 1800
612 Ga0207648_10232950 3300026089 Bacteria 1638
613 Ga0207648_10673350 3300026089 Bacteria 957
614 Ga0207676_10004509 3300026095 Bacteria 9848
615 Ga0207676_10237638 3300026095 Bacteria 1632
616 Ga0207676_10495173 3300026095 Bacteria 1160
617 Ga0207674_10029272 3300026116 Bacteria 5799
618 Ga0207674_10245152 3300026116 Bacteria 1739
619 Ga0207674_10409664 3300026116 Bacteria 1310
620 Ga0207674_10616490 3300026116 Bacteria 1048
621 Ga0207675_100000530 3300026118 Bacteria 37109
622 Ga0207675_100282899 3300026118 Bacteria 1612
623 Ga0207698_10048515 3300026142 Bacteria 3225
624 Ga0207698_10057456 3300026142 Bacteria 3011
625 Ga0207698_10144329 3300026142 Bacteria 2056
626 Ga0207698_10185212 3300026142 Bacteria 1848
627 Ga0207698_10313260 3300026142 Bacteria 1466
628 Ga0207698_10323557 3300026142 Bacteria 1445
629 Ga0209371_1000095 3300027312 Bacteria 166175
630 Ga0209371_1000211 3300027312 Bacteria 81758
631 Ga0209371_1011309 3300027312 Bacteria 2660
632 Ga0209813_10003543 3300027866 Bacteria 3661
633 Ga0209813_10089423 3300027866 Bacteria 1031
634 Ga0209813_10147751 3300027866 Bacteria 839
635 Ga0207428_10093489 3300027907 Bacteria 2332
636 Ga0268266_11486230 3300028379 Bacteria 653
637 Ga0268265_10003468 3300028380 Bacteria 11334
638 Ga0268265_10024384 3300028380 Bacteria 4278
639 Ga0268265_11730424 3300028380 Bacteria 631
640 Ga0268264_10001980 3300028381 Bacteria 18431
641 Ga0307515_10610861 3300028794 Bacteria 701
642 Ga0268256_1000116 3300030500 Bacteria 115451
643 Ga0268256_1000319 3300030500 Bacteria 47885
644 Ga0268256_1012649 3300030500 Bacteria 2597
645 Ga0307408_100000926 3300031548 Bacteria 22869
646 Ga0307408_100010117 3300031548 Bacteria 6218
647 Ga0307408_100010914 3300031548 Bacteria 5996
648 Ga0307408_100017628 3300031548 Bacteria 4781
649 Ga0307408_100072377 3300031548 Bacteria 2551
650 Ga0307408_100884878 3300031548 Bacteria 816
651 Ga0307514_10017303 3300031649 Bacteria 5933
652 Ga0307516_10923911 3300031730 Bacteria 540
653 Ga0307405_10001796 3300031731 Bacteria 9182
654 Ga0307405_10180755 3300031731 Bacteria 1514
655 Ga0307413_10193441 3300031824 Bacteria 1462
656 Ga0307413_10867135 3300031824 Bacteria 764
657 Ga0307410_10033029 3300031852 Bacteria 3337
658 Ga0307406_10000530 3300031901 Bacteria 21943
659 Ga0307406_10001271 3300031901 Bacteria 14130
660 Ga0307406_10004428 3300031901 Bacteria 7643
661 Ga0307407_10050490 3300031903 Bacteria 2380
662 Ga0307407_10090915 3300031903 Bacteria 1870
663 Ga0307412_10019028 3300031911 Bacteria 4147
664 Ga0307412_10047156 3300031911 Bacteria 2828
665 Ga0307412_10135786 3300031911 Bacteria 1794
666 Ga0307412_10460129 3300031911 Bacteria 1050
667 Ga0307409_100016120 3300031995 Bacteria 4933
668 Ga0307416_100010204 3300032002 Bacteria 6193
669 Ga0307416_100010649 3300032002 Bacteria 6089
670 Ga0307416_100351229 3300032002 Bacteria 1492
671 Ga0307414_10043576 3300032004 Bacteria 3058
672 Ga0307414_10102929 3300032004 Bacteria 2153
673 Ga0307414_10293112 3300032004 Bacteria 1372
674 Ga0307411_10001196 3300032005 Bacteria 10269
675 Ga0307415_100008780 3300032126 Bacteria 5624
676 Ga0373948_0053336 3300034817 Bacteria 873
677 Ga0395899_0000035 3300037312 Bacteria 295584
678 Ga0395899_0097458 3300037312 Bacteria 2126
679 Ga0395899_0309102 3300037312 Bacteria 1068
680 Ga0395900_0000113 3300037418 Bacteria 139979
681 Ga0395900_0003027 3300037418 Bacteria 18294
682 Ga0395900_0017077 3300037418 Bacteria 7408
683 Ga0395900_0039514 3300037418 Bacteria 4862
684 Ga0395900_0078296 3300037418 Bacteria 3397
685 Ga0395900_0087484 3300037418 Bacteria 3202
686 Ga0395900_0402185 3300037418 Bacteria 1333
687 Ga0395898_0000254 3300037466 Bacteria 131247
688 Ga0395898_0000444 3300037466 Bacteria 85520
689 Ga0395898_0002993 3300037466 Bacteria 19184
690 Ga0395898_0188758 3300037466 Bacteria 1969
691 Ga0395898_0377900 3300037466 Bacteria 1351
692 Ga0395905_0197938 3300037471 Bacteria 1884
693 Ga0395905_0198135 3300037471 Bacteria 1883
694 Ga0395905_1115185 3300037471 Bacteria 692
695 Ga0395901_0000009 3300038443 Bacteria 479396
696 Ga0395901_0000302 3300038443 Bacteria 61152
697 Ga0395901_0026100 3300038443 Bacteria 5998
698 Ga0395901_0032650 3300038443 Bacteria 5369
699 Ga0395901_0144831 3300038443 Bacteria 2498
700 Ga0395901_0308651 3300038443 Bacteria 1639
701 Ga0436361_0834992 3300039447 Bacteria 23798
702 Ga0439436_0002289 3300041404 Bacteria 5737
703 Ga0439438_043902 3300041405 Bacteria 1153
704 Ga0439439_0008993 3300041406 Bacteria 2368
705 Ga0439439_0049299 3300041406 Bacteria 1102
706 Ga0439466_0081898 3300041411 Bacteria 1017
707 Ga0439466_0107144 3300041411 Bacteria 868
708 Ga0439431_0016108 3300041997 Bacteria 1746
709 Ga0439448_0170772 3300042005 Bacteria 758
710 Ga0439432_020286 3300042006 Bacteria 2211
711 Ga0439449_0000091 3300042007 Bacteria 29348
712 Ga0439449_0001822 3300042007 Bacteria 8383
713 Ga0439452_043402 3300042010 Bacteria 1052
714 Ga0439462_0001751 3300042015 Bacteria 4909
715 Ga0439462_0002942 3300042015 Bacteria 4035
716 Ga0439462_0063207 3300042015 Bacteria 1002
717 Ga0439462_0136483 3300042015 Bacteria 686
718 Ga0450911_000225 3300042115 Bacteria 21810
719 Ga0450911_014977 3300042115 Bacteria 1028
720 Ga0450920_006489 3300042122 Bacteria 2106
721 Ga0450923_007891 3300042125 Bacteria 1816
722 Ga0450923_026559 3300042125 Bacteria 1160
723 Ga0450897_019183 3300042128 Bacteria 722
724 Ga0450891_009863 3300042129 Bacteria 880
725 Ga0450894_006910 3300042131 Bacteria 1462
726 Ga0450898_049360 3300042134 Bacteria 811
727 Ga0450902_051631 3300042137 Bacteria 706
728 Ga0450903_011050 3300042138 Bacteria 1457
729 Ga0450906_035608 3300042145 Bacteria 878
730 Ga0439446_0004975 3300042156 Bacteria 3398
731 Ga0439446_0020533 3300042156 Bacteria 1862
732 Ga0439446_0074031 3300042156 Bacteria 1046
733 Ga0439458_0089039 3300042157 Bacteria 793
734 Ga0439458_0172519 3300042157 Bacteria 585
735 Ga0450909_005967 3300042185 Bacteria 1759
736 Ga0439434_0015977 3300042435 Bacteria 2241
737 Ga0439434_0074192 3300042435 Bacteria 1074
738 Ga0439435_0033244 3300042436 Bacteria 1411
739 Ga0439435_0121905 3300042436 Bacteria 817
740 Ga0439459_0021413 3300042438 Bacteria 1241
741 Ga0439459_0174293 3300042438 Bacteria 575
742 Ga0439464_0007334 3300042439 Bacteria 2882
743 Ga0439464_0161633 3300042439 Bacteria 704
744 Ga0439464_0251902 3300042439 Bacteria 570
745 Ga0450893_0032267 3300042532 Bacteria 937
746 Ga0451577_0984295 3300042876 Bacteria 758
747 Ga0466986_0231794 3300044650 Bacteria 1192
748 Ga0466969_0001266 3300044656 Bacteria 13617
749 Ga0466969_0058166 3300044656 Bacteria 1882
750 Ga0466969_0257838 3300044656 Bacteria 790
751 Ga0466972_0001179 3300044658 Bacteria 12540
752 Ga0466982_0564883 3300044672 Bacteria 572
753 Ga0466965_0047726 3300044683 Bacteria 2120
754 Ga0466966_0000043 3300044684 Bacteria 93998
755 Ga0466966_0000309 3300044684 Bacteria 31554
756 Ga0466966_0029640 3300044684 Bacteria 3558
757 Ga0466966_0069877 3300044684 Bacteria 2202
758 Ga0466966_0209084 3300044684 Bacteria 1179
759 Ga0466961_0000026 3300044693 Bacteria 92667
760 Ga0466961_0000383 3300044693 Bacteria 28540
761 Ga0466961_0001377 3300044693 Bacteria 15025
762 Ga0466961_0014187 3300044693 Bacteria 5113
763 Ga0466961_0126232 3300044693 Bacteria 1605
764 Ga0466963_0000484 3300044694 Bacteria 18542
765 Ga0466963_0031544 3300044694 Bacteria 3427
766 Ga0466964_0233160 3300044706 Bacteria 899
767 Ga0466971_0005125 3300044719 Bacteria 5675
768 Ga0466971_0008279 3300044719 Bacteria 4536
769 Ga0466971_0020938 3300044719 Bacteria 2907
770 Ga0466971_0023300 3300044719 Bacteria 2759
771 Ga0466970_0000060 3300044765 Bacteria 42753
772 Ga0466970_0006300 3300044765 Bacteria 5926
773 Ga0466970_0156797 3300044765 Bacteria 1258
774 Ga0466957_0003198 3300044842 Bacteria 8950
775 Ga0466957_0006531 3300044842 Bacteria 6586
776 Ga0466957_0044637 3300044842 Bacteria 2686
777 Ga0466957_0458910 3300044842 Bacteria 879
778 Ga0466959_0000129 3300045049 Bacteria 48753
779 Ga0466959_0013198 3300045049 Bacteria 5985
780 Ga0466959_0013429 3300045049 Bacteria 5935
781 Ga0466959_0114717 3300045049 Bacteria 1919
782 Ga0466959_0551113 3300045049 Bacteria 778
783 Ga0451576_0086095 3300045051 Bacteria 3268
784 Ga0466958_0003437 3300045836 Bacteria 8217
785 Ga0466958_0030082 3300045836 Bacteria 3222
786 Ga0466958_0228778 3300045836 Bacteria 1187
787 Ga0466967_0002547 3300045976 Bacteria 11424
788 Ga0466967_0103605 3300045976 Bacteria 2604
789 Ga0466967_0730741 3300045976 Bacteria 981
790 Ga0495592_0087784 3300046454 Bacteria 2236
791 Ga0495603_0006343 3300046455 Bacteria 7074
792 Ga0495603_0041414 3300046455 Bacteria 2754
793 Ga0495603_0313690 3300046455 Bacteria 900
794 Ga0495590_0001136 3300046457 Bacteria 11652
795 Ga0495590_0001242 3300046457 Bacteria 11107
796 Ga0495591_121300 3300046458 Bacteria 638
797 Ga0495629_0000517 3300046459 Bacteria 32307
798 Ga0495629_0000586 3300046459 Bacteria 29559
799 Ga0495629_0001679 3300046459 Bacteria 17381
800 Ga0495629_0060857 3300046459 Bacteria 2638
801 Ga0495629_0429509 3300046459 Bacteria 896
802 Ga0495629_0552036 3300046459 Bacteria 773
803 Ga0495638_0006568 3300046460 Bacteria 8458
804 Ga0495641_0012345 3300046461 Bacteria 4787
805 Ga0495651_0013214 3300046462 Bacteria 6383
806 Ga0495653_0032148 3300046463 Bacteria 4169
807 Ga0495653_0064837 3300046463 Bacteria 2751
808 Ga0495653_0110614 3300046463 Bacteria 1974
809 Ga0495653_0145368 3300046463 Bacteria 1662
810 Ga0495653_0154177 3300046463 Bacteria 1602
811 Ga0495650_0011835 3300046471 Bacteria 4739
812 Ga0495650_0060376 3300046471 Bacteria 1523
813 Ga0495580_0000142 3300046472 Bacteria 51382
814 Ga0495580_0000495 3300046472 Bacteria 32967
815 Ga0495580_0007425 3300046472 Bacteria 8811
816 Ga0495580_0034264 3300046472 Bacteria 3656
817 Ga0495580_0099569 3300046472 Bacteria 2022
818 Ga0495580_0141534 3300046472 Bacteria 1667
819 Ga0495580_0201356 3300046472 Bacteria 1371
820 Ga0495580_0245885 3300046472 Bacteria 1225
821 Ga0495580_0290474 3300046472 Bacteria 1114
822 Ga0495582_0015769 3300046473 Bacteria 4144
823 Ga0495582_0019877 3300046473 Bacteria 3673
824 Ga0495582_0114894 3300046473 Bacteria 1513
825 Ga0495605_0085722 3300046474 Bacteria 1466
826 Ga0495662_0048379 3300046476 Bacteria 2053
827 Ga0495664_0000149 3300046477 Bacteria 35104
828 Ga0495664_0006570 3300046477 Bacteria 6426
829 Ga0495664_0013453 3300046477 Bacteria 4640
830 Ga0495664_0624366 3300046477 Bacteria 639
831 Ga0495596_0030259 3300046500 Bacteria 2168
832 Ga0495596_0180299 3300046500 Bacteria 821
833 Ga0495607_0325571 3300046501 Bacteria 716
834 Ga0495583_0002966 3300046506 Bacteria 13618
835 Ga0495583_0040051 3300046506 Bacteria 2203
836 Ga0495606_0008201 3300046507 Bacteria 9138
837 Ga0495606_0055462 3300046507 Bacteria 2563
838 Ga0495606_0062041 3300046507 Bacteria 2388
839 Ga0495610_0014119 3300046512 Bacteria 4711
840 Ga0495616_0002706 3300046513 Bacteria 11619
841 Ga0495616_0083202 3300046513 Bacteria 1527
842 Ga0495618_0012638 3300046514 Bacteria 5128
843 Ga0495618_0075319 3300046514 Bacteria 2149
844 Ga0495620_0007723 3300046515 Bacteria 5812
845 Ga0495628_0019740 3300046516 Bacteria 5568
846 Ga0495628_0032491 3300046516 Bacteria 4213
847 Ga0495628_0047551 3300046516 Bacteria 3403
848 Ga0495628_0122346 3300046516 Bacteria 1995
849 Ga0495628_0162264 3300046516 Bacteria 1698
850 Ga0495628_0288253 3300046516 Bacteria 1217
851 Ga0495628_0535227 3300046516 Bacteria 842
852 Ga0495630_0020639 3300046517 Bacteria 4858
853 Ga0495630_0028929 3300046517 Bacteria 4118
854 Ga0495630_0083495 3300046517 Bacteria 2411
855 Ga0495630_0733761 3300046517 Bacteria 755
856 Ga0495631_0000007 3300046518 Bacteria 130158
857 Ga0495637_0155607 3300046520 Bacteria 860
858 Ga0495643_0000261 3300046522 Bacteria 77011
859 Ga0495648_0003737 3300046524 Bacteria 13267
860 Ga0495648_0007144 3300046524 Bacteria 8978
861 Ga0495648_0007593 3300046524 Bacteria 8660
862 Ga0495648_0024057 3300046524 Bacteria 4157
863 Ga0495648_0094444 3300046524 Bacteria 1665
864 Ga0495648_0389674 3300046524 Bacteria 626
865 Ga0495666_0001598 3300046526 Bacteria 11153
866 Ga0495666_0075413 3300046526 Bacteria 1599
867 Ga0495642_0007805 3300046528 Bacteria 4101
868 Ga0495652_0008580 3300046529 Bacteria 9319
869 Ga0495652_0010563 3300046529 Bacteria 8366
870 Ga0495652_0039526 3300046529 Bacteria 4079
871 Ga0495652_0072702 3300046529 Bacteria 2865
872 Ga0495652_0513060 3300046529 Bacteria 829
873 Ga0495665_0006558 3300046531 Bacteria 6285
874 Ga0495665_0096230 3300046531 Bacteria 1555
875 Ga0495665_0225943 3300046531 Bacteria 967
876 Ga0495665_0440500 3300046531 Bacteria 659
877 Ga0495665_0524614 3300046531 Bacteria 595
878 Ga0495640_0009773 3300046533 Bacteria 7453
879 Ga0495640_0031297 3300046533 Bacteria 3799
880 Ga0495586_0034012 3300046535 Bacteria 2736
881 Ga0495586_0196004 3300046535 Bacteria 1144
882 Ga0495587_0001137 3300046536 Bacteria 17418
883 Ga0495597_0100199 3300046542 Bacteria 1222
884 Ga0495645_0005083 3300046543 Bacteria 9014
885 Ga0495645_0023662 3300046543 Bacteria 4450
886 Ga0495645_0307709 3300046543 Bacteria 1033
887 Ga0495645_0510483 3300046543 Bacteria 750
888 Ga0495668_0032056 3300046616 Bacteria 2959
889 Ga0495634_0002825 3300046642 Bacteria 14255
890 Ga0495634_0076659 3300046642 Bacteria 2194
891 Ga0495625_0000056 3300046660 Bacteria 186024
892 Ga0495625_0156761 3300046660 Bacteria 1527
893 Ga0495635_0000635 3300046663 Bacteria 22541
894 Ga0495635_0814476 3300046663 Bacteria 601
895 Ga0495635_0992851 3300046663 Bacteria 534
896 Ga0495588_0015467 3300046674 Bacteria 3673
897 Ga0495588_0218424 3300046674 Bacteria 1006
898 Ga0495599_0010543 3300046678 Bacteria 5655
899 Ga0495599_0092709 3300046678 Bacteria 1884
900 Ga0495623_0043618 3300046679 Bacteria 2853
901 Ga0495623_0095104 3300046679 Bacteria 1821
902 Ga0495623_0132150 3300046679 Bacteria 1493
903 Ga0495623_0599511 3300046679 Bacteria 572
904 Ga0495646_0002054 3300046680 Bacteria 12208
905 Ga0495646_0087347 3300046680 Bacteria 1807
906 Ga0495646_0167769 3300046680 Bacteria 1211
907 Ga0495646_0223546 3300046680 Bacteria 1017
908 Ga0495646_0563475 3300046680 Bacteria 581
909 Ga0495613_0006353 3300046689 Bacteria 8838
910 Ga0495624_0000416 3300046690 Bacteria 33753
911 Ga0495624_0011083 3300046690 Bacteria 6204
912 Ga0495624_0031482 3300046690 Bacteria 3447
913 Ga0495624_0216162 3300046690 Bacteria 1162
914 Ga0495624_0485495 3300046690 Bacteria 739
915 Ga0495670_0084782 3300046691 Bacteria 1617
916 Ga0495671_0011589 3300046692 Bacteria 4845
917 Ga0495649_0006208 3300046694 Bacteria 7459
918 Ga0495649_0008319 3300046694 Bacteria 6246
919 Ga0495649_0038208 3300046694 Bacteria 2635
920 Ga0495649_0178661 3300046694 Bacteria 1108
921 Ga0495649_0264115 3300046694 Bacteria 882
922 Ga0495589_0519939 3300046794 Bacteria 543
923 Ga0495600_0227112 3300046809 Bacteria 1193
924 Ga0495660_0090964 3300046810 Bacteria 1586
925 Ga0495660_0135472 3300046810 Bacteria 1231
926 Ga0495581_0002468 3300047315 Bacteria 10463
927 Ga0495581_0024077 3300047315 Bacteria 3527
928 Ga0495604_0003914 3300047317 Bacteria 11856
929 Ga0495604_0011020 3300047317 Bacteria 7175
930 Ga0495604_0014111 3300047317 Bacteria 6370
931 Ga0495604_0056243 3300047317 Bacteria 3029
932 Ga0495604_0332872 3300047317 Bacteria 1012
933 Ga0495674_0007725 3300047319 Bacteria 10271
934 Ga0495674_0010470 3300047319 Bacteria 8779
935 Ga0495674_0014141 3300047319 Bacteria 7476
936 Ga0495674_0017052 3300047319 Bacteria 6766
937 Ga0495674_0116308 3300047319 Bacteria 2262
938 Ga0495674_0126356 3300047319 Bacteria 2157
939 Ga0495674_0818369 3300047319 Bacteria 723
940 Ga0495672_0006413 3300047320 Bacteria 9126
941 Ga0495672_0016206 3300047320 Bacteria 5034
942 Ga0495672_0025309 3300047320 Bacteria 3802
943 Ga0495672_0167347 3300047320 Bacteria 1124
944 Ga0495676_0009149 3300047321 Bacteria 9030
945 Ga0495676_0059065 3300047321 Bacteria 3014
946 Ga0495676_0212051 3300047321 Bacteria 1339
947 Ga0495676_0257393 3300047321 Bacteria 1188
948 Ga0495680_0009118 3300047322 Bacteria 8955
949 Ga0495680_0098131 3300047322 Bacteria 2186
950 Ga0495680_0146979 3300047322 Bacteria 1721
951 Ga0495680_0317619 3300047322 Bacteria 1090
952 Ga0495680_0400765 3300047322 Bacteria 947
953 Ga0495683_0000483 3300047323 Bacteria 30928
954 Ga0495683_0003326 3300047323 Bacteria 9400
955 Ga0495683_0018608 3300047323 Bacteria 3588
956 Ga0495683_0040476 3300047323 Bacteria 2354
957 Ga0495683_0152303 3300047323 Bacteria 1075
958 Ga0495687_000207 3300047443 Bacteria 84210
959 Ga0495687_010068 3300047443 Bacteria 5217
960 Ga0495687_085518 3300047443 Bacteria 1222
961 Ga0495687_163490 3300047443 Bacteria 745
962 Ga0495675_0007904 3300047444 Bacteria 6571
963 Ga0495675_0089483 3300047444 Bacteria 1932
964 Ga0495675_0240245 3300047444 Bacteria 1090
965 Ga0495677_0147119 3300047445 Bacteria 906
966 Ga0495679_000103 3300047446 Bacteria 76165
967 Ga0495679_003183 3300047446 Bacteria 8002
968 Ga0495679_024465 3300047446 Bacteria 2034
969 Ga0495673_0089393 3300047469 Bacteria 1261
970 Ga0495673_0175641 3300047469 Bacteria 814
971 Ga0495681_0019317 3300047470 Bacteria 3726
972 Ga0495593_0007253 3300047673 Bacteria 6495
973 Ga0495593_0012829 3300047673 Bacteria 4786
974 Ga0495593_0016859 3300047673 Bacteria 4112
975 Ga0495593_0031481 3300047673 Bacteria 2897
976 Ga0495593_0040623 3300047673 Bacteria 2504
977 Ga0495602_0011434 3300048088 Bacteria 9180
978 Ga0495602_0017599 3300048088 Bacteria 7160
979 Ga0495602_0038320 3300048088 Bacteria 4434
980 Ga0495602_0245692 3300048088 Bacteria 1336
981 Ga0495602_0436685 3300048088 Bacteria 926
982 Ga0495602_0473077 3300048088 Bacteria 880
983 Ga0495614_0015565 3300048089 Bacteria 3315
984 Ga0495626_0005595 3300048091 Bacteria 7287
985 Ga0495626_0009926 3300048091 Bacteria 5117
986 Ga0496100_0002550 3300048903 Bacteria 9281
987 Ga0496100_0101416 3300048903 Bacteria 1984
988 Ga0496101_0002228 3300048904 Bacteria 11847
989 Ga0496101_0019182 3300048904 Bacteria 4664
990 Ga0496101_0269745 3300048904 Bacteria 1328
991 Ga0496102_0000247 3300048905 Bacteria 70783
992 Ga0496102_0011536 3300048905 Bacteria 7623
993 Ga0496102_0357330 3300048905 Bacteria 1375
994 Ga0496102_0765825 3300048905 Bacteria 888
995 Ga0496103_0000278 3300048906 Bacteria 48336
996 Ga0496103_0004113 3300048906 Bacteria 8833
997 Ga0496103_0674933 3300048906 Bacteria 656
998 Ga0496104_0012686 3300048907 Bacteria 7589
999 Ga0496104_0442682 3300048907 Bacteria 1211
1000 Ga0496104_0841253 3300048907 Bacteria 823
1001 Ga0496105_0193414 3300048908 Bacteria 1663
1002 Ga0496105_0333670 3300048908 Bacteria 1213
1003 Ga0496106_0034656 3300048909 Bacteria 3771
1004 Ga0496106_0339206 3300048909 Bacteria 1207
1005 Ga0496107_0007427 3300048910 Bacteria 7557
1006 Ga0496107_0129345 3300048910 Bacteria 1864
1007 Ga0496108_0220724 3300048911 Bacteria 1647
1008 Ga0496108_0726060 3300048911 Bacteria 860
1009 Ga0496108_0767753 3300048911 Bacteria 833
1010 Ga0496109_0156865 3300048912 Bacteria 2132
1011 Ga0496109_0253568 3300048912 Bacteria 1657
1012 Ga0496109_1580520 3300048912 Bacteria 590
1013 Ga0496110_0033465 3300048913 Bacteria 4446
1014 Ga0496110_0855295 3300048913 Bacteria 815
1015 Ga0496111_0097044 3300048914 Bacteria 2163
1016 Ga0496112_0049701 3300048915 Bacteria 4110
1017 Ga0496112_0969349 3300048915 Bacteria 771
1018 Ga0496112_1626283 3300048915 Bacteria 559
1019 Ga0496113_0004854 3300048916 Bacteria 8324
1020 Ga0496113_0247667 3300048916 Bacteria 1422
1021 Ga0496113_0877810 3300048916 Bacteria 710
1022 Ga0496114_0049041 3300048917 Bacteria 3513
1023 Ga0496114_0921698 3300048917 Bacteria 755
1024 Ga0496116_0067882 3300048919 Bacteria 2275
1025 Ga0496116_0077471 3300048919 Bacteria 2077
1026 Ga0496116_0210565 3300048919 Bacteria 1008
1027 Ga0496116_0261687 3300048919 Bacteria 852
1028 Ga0496117_0000445 3300048920 Bacteria 68610
1029 Ga0496117_0018250 3300048920 Bacteria 5822
1030 Ga0496117_0028196 3300048920 Bacteria 4352
1031 Ga0496117_0077015 3300048920 Bacteria 2208
1032 Ga0496117_0142136 3300048920 Bacteria 1435
1033 Ga0496118_0000138 3300048921 Bacteria 128826
1034 Ga0496118_0038446 3300048921 Bacteria 3835
1035 Ga0496118_0064386 3300048921 Bacteria 2690
1036 Ga0496118_0088277 3300048921 Bacteria 2145
1037 Ga0496118_0201297 3300048921 Bacteria 1179
1038 Ga0496118_0283728 3300048921 Bacteria 920
1039 Ga0496118_0319804 3300048921 Bacteria 842
1040 Ga0496121_0001530 3300048924 Bacteria 38696
1041 Ga0496121_0007122 3300048924 Bacteria 13575
1042 Ga0496121_0009428 3300048924 Bacteria 11220
1043 Ga0496121_0019431 3300048924 Bacteria 6793
1044 Ga0496121_0200367 3300048924 Bacteria 1423
1045 Ga0496122_0037608 3300048925 Bacteria 3893
1046 Ga0496122_0096052 3300048925 Bacteria 2000
1047 Ga0496122_0097709 3300048925 Bacteria 1975
1048 Ga0496122_0107920 3300048925 Bacteria 1838
1049 Ga0496122_0125380 3300048925 Bacteria 1645
1050 Ga0496123_0061360 3300048926 Bacteria 2416
1051 Ga0496123_0085045 3300048926 Bacteria 1905
1052 Ga0496123_0167325 3300048926 Bacteria 1164
1053 Ga0496123_0489792 3300048926 Bacteria 539
1054 Ga0496124_0019236 3300048927 Bacteria 6365
1055 Ga0496124_0109845 3300048927 Bacteria 2221
1056 Ga0496124_0135768 3300048927 Bacteria 1948
1057 Ga0496124_0199425 3300048927 Bacteria 1523
1058 Ga0496124_0397733 3300048927 Bacteria 957
1059 Ga0496125_0010667 3300048928 Bacteria 9276
1060 Ga0496125_0018669 3300048928 Bacteria 6578
1061 Ga0496125_0152093 3300048928 Bacteria 1587
1062 Ga0496126_0001647 3300048929 Bacteria 33697
1063 Ga0496126_0116341 3300048929 Bacteria 2324
1064 Ga0496126_0198850 3300048929 Bacteria 1694
1065 Ga0501309_017261 3300049129 Bacteria 990
1066 Ga0495678_043424 3300049459 Bacteria 1785
1067 Ga0495682_0000254 3300049460 Bacteria 42240
1068 Ga0495682_0003881 3300049460 Bacteria 6538
1069 Ga0495682_0030071 3300049460 Bacteria 2010
1070 Ga0495682_0049284 3300049460 Bacteria 1534
1071 Ga0501292_060251 3300049515 Bacteria 687
1072 Ga0501294_024554 3300049517 Bacteria 672
1073 Ga0501034_0000003 3300049571 Bacteria 471748
1074 Ga0501046_1138357 3300049580 Bacteria 538
1075 Ga0501048_0582599 3300049582 Bacteria 803
1076 Ga0501072_0224223 3300049588 Bacteria 1498
1077 Ga0501206_000487 3300049653 Bacteria 4790
1078 Ga0501207_075224 3300049654 Bacteria 641
1079 Ga0501262_010025 3300049759 Bacteria 1180
1080 Ga0501265_003053 3300049762 Bacteria 1903
1081 nmdc:mga03683_26699_c1 3300050489 Bacteria 2280
1082 nmdc:mga03683_545_c1 3300050489 Bacteria 10807
1083 nmdc:mga03683_6134_c1 3300050489 Bacteria 4101
1084 nmdc:mga03n38_29907_c1 3300050490 Bacteria 2285
1085 nmdc:mga03n38_4827_c1 3300050490 Bacteria 4516
1086 nmdc:mga03n38_9667_c1 3300050490 Bacteria 3516
1087 nmdc:mga00v17_14264_c1 3300050491 Bacteria 4431
1088 nmdc:mga00v17_1957_c1 3300050491 Bacteria 10639
1089 nmdc:mga00v17_620390_c1 3300050491 Bacteria 696
1090 nmdc:mga0yw44_5595_c1 3300050492 Bacteria 5969
1091 nmdc:mga0yw44_822_c1 3300050492 Bacteria 11590
1092 nmdc:mga0k408_11610_c1 3300050493 Bacteria 4801
1093 nmdc:mga0k408_1313_c1 3300050493 Bacteria 13430
1094 nmdc:mga0k408_18508_c1 3300050493 Bacteria 3888
1095 nmdc:mga0k408_36108_c1 3300050493 Bacteria 2836
1096 nmdc:mga0k408_40895_c1 3300050493 Bacteria 2669
1097 nmdc:mga0k408_637108_c1 3300050493 Bacteria 627
1098 nmdc:mga06z11_1020_c1 3300050494 Bacteria 10220
1099 nmdc:mga06z11_267741_c1 3300050494 Bacteria 1010
1100 nmdc:mga06z11_80647_c1 3300050494 Bacteria 1745
1101 nmdc:mga04h51_135699_c1 3300050495 Bacteria 929
1102 nmdc:mga04h51_173348_c1 3300050495 Bacteria 836
1103 nmdc:mga04h51_1956_c1 3300050495 Bacteria 4802
1104 nmdc:mga07m45_1263_c1 3300050496 Bacteria 11509
1105 nmdc:mga07m45_26187_c1 3300050496 Bacteria 3204
1106 nmdc:mga07m45_570823_c1 3300050496 Bacteria 654
1107 nmdc:mga07m45_82856_c1 3300050496 Bacteria 1832
1108 nmdc:mga07m45_9583_c1 3300050496 Bacteria 5031
1109 nmdc:mga07m45_98435_c1 3300050496 Bacteria 1679
1110 nmdc:mga06r32_1022248_c1 3300050510 Bacteria 778
1111 nmdc:mga0n895_445597_c1 3300050512 Bacteria 1307
1112 nmdc:mga0sz30_7217_c1 3300050516 Bacteria 4162
1113 Ga0500643_013144 3300053087 Bacteria 2936
1114 Ga0500651_0000957 3300053093 Bacteria 14201
1115 Ga0500566_0142346 3300053094 Bacteria 1271
1116 Ga0500660_054333 3300053100 Bacteria 1964
1117 Ga0500571_000024 3300053110 Bacteria 52195
1118 Ga0500592_008481 3300053116 Bacteria 1630
1119 Ga0500608_001647 3300053122 Bacteria 8021
1120 Ga0500618_031463 3300053125 Bacteria 1244
1121 Ga0500559_0027986 3300053136 Bacteria 2406
1122 Ga0500559_0096536 3300053136 Bacteria 1358
1123 Ga0500564_068558 3300053138 Bacteria 1602
1124 Ga0500568_0003259 3300053139 Bacteria 9165
1125 Ga0500574_007237 3300053141 Bacteria 2288
1126 Ga0500619_193608 3300053154 Bacteria 684
1127 Ga0500638_004803 3300053162 Bacteria 5284
1128 Ga0500636_0153160 3300053177 Bacteria 1264
1129 Ga0500565_022799 3300053734 Bacteria 768
1130 Ga0587084_001920 3300059477 Bacteria 2067
1131 Ga0587084_003128 3300059477 Bacteria 1792
1132 Ga0587084_040228 3300059477 Bacteria 791
1133 Ga0587083_0016341 3300059505 Bacteria 1312
1134 Ga0587090_001520 3300059510 Bacteria 2371
1135 Ga0587090_002110 3300059510 Bacteria 2138
1136 Ga0587090_007688 3300059510 Bacteria 1423
1137 Ga0587090_017945 3300059510 Bacteria 1076
1138 Ga0587094_019363 3300059513 Bacteria 976
1139 Ga0587101_018139 3300059623 Bacteria 983
1140 Ga0587067_008178 3300059640 Bacteria 1520
1141 Ga0587068_008866 3300059641 Bacteria 1469
1142 Ga0587068_024858 3300059641 Bacteria 1006
1143 Ga0587072_011558 3300059643 Bacteria 1446
1144 Ga0587076_012201 3300059645 Bacteria 1279
1145 Ga0587076_023408 3300059645 Bacteria 1040
1146 Ga0587105_001077 3300059651 Bacteria 1337
1147 Ga0587111_0012970 3300060346 Bacteria 1482
1148 Ga0587111_0020665 3300060346 Bacteria 1262
1149 Ga0587111_0024244 3300060346 Bacteria 1193
1150 Ga0466962_0001661 3300061719 Bacteria 10431
1151 Ga0466962_0004649 3300061719 Bacteria 6594
1152 Ga0466962_0011849 3300061719 Bacteria 4196

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046472 Ga0495580_0007425 Ga0495580_0007425_7151_7612 129
2 3300046474 Ga0495605_0085722 Ga0495605_0085722_598_1059 129
3 3300046513 Ga0495616_0083202 Ga0495616_0083202_340_801 129
4 3300046524 Ga0495648_0024057 Ga0495648_0024057_643_1104 129
5 3300046694 Ga0495649_0178661 Ga0495649_0178661_629_1090 129
6 3300047323 Ga0495683_0018608 Ga0495683_0018608_2993_3454 129
7 3300047443 Ga0495687_085518 Ga0495687_085518_539_1000 129
8 3300049460 Ga0495682_0030071 Ga0495682_0030071_37_498 129
9 3300042115 Ga0450911_000225 Ga0450911_000225_4477_4935 146
10 3300042137 Ga0450902_051631 Ga0450902_051631_231_689 146
11 3300048927 Ga0496124_0135768 Ga0496124_0135768_142_600 146
12 3300048928 Ga0496125_0010667 Ga0496125_0010667_5824_6282 146
13 3300048929 Ga0496126_0116341 Ga0496126_0116341_1745_2203 146
14 iso_pu_bacteria 2928115317 2928116997 148
15 3300001989 JGI24739J22299_10163337 JGI24739J22299_101633371 149
16 3300003316 rootH1_10101357 rootH1_101013572 149
17 3300003322 rootL2_10012388 rootL2_100123882 149
18 3300003792 Ga0055540_1002356 Ga0055540_100235610 149
19 3300005289 Ga0065704_10147436 Ga0065704_101474362 149
20 3300005457 Ga0070662_100205147 Ga0070662_1002051473 149
21 3300006038 Ga0075365_10001937 Ga0075365_1000193713 149
22 3300006042 Ga0075368_10001130 Ga0075368_100011308 149
23 3300006048 Ga0075363_100020439 Ga0075363_1000204394 149
24 3300006051 Ga0075364_10012743 Ga0075364_100127434 149
25 3300006178 Ga0075367_10000488 Ga0075367_1000048813 149
26 3300006186 Ga0075369_10001709 Ga0075369_100017098 149
27 3300006195 Ga0075366_10024831 Ga0075366_100248314 149
28 3300006353 Ga0075370_10000375 Ga0075370_1000037514 149
29 3300009176 Ga0105242_10567469 Ga0105242_105674692 149
30 3300014497 Ga0182008_10021729 Ga0182008_100217295 149
31 3300014497 Ga0182008_10294901 Ga0182008_102949012 149
32 3300015261 Ga0182006_1020371 Ga0182006_10203712 149
33 3300025292 Ga0209676_1020438 Ga0209676_10204382 149
34 3300025303 Ga0209051_1000494 Ga0209051_100049436 149
35 3300025903 Ga0207680_10164462 Ga0207680_101644623 149
36 3300025981 Ga0207640_10573321 Ga0207640_105733212 149
37 3300027866 Ga0209813_10003543 Ga0209813_100035432 149
38 3300028379 Ga0268266_11486230 Ga0268266_114862302 149
39 3300028380 Ga0268265_11730424 Ga0268265_117304241 149
40 3300031649 Ga0307514_10017303 Ga0307514_100173035 149
41 3300031901 Ga0307406_10001271 Ga0307406_1000127114 149
42 3300031911 Ga0307412_10135786 Ga0307412_101357862 149
43 3300032004 Ga0307414_10102929 Ga0307414_101029292 149
44 3300046524 Ga0495648_0389674 Ga0495648_0389674_99_569 149
45 3300048909 Ga0496106_0339206 Ga0496106_0339206_536_1006 149
46 3300048910 Ga0496107_0129345 Ga0496107_0129345_646_1116 149
47 3300050489 nmdc:mga03683_26699_c1 nmdc:mga03683_26699_c1_697_1167 149
48 3300050489 nmdc:mga03683_6134_c1 nmdc:mga03683_6134_c1_1684_2139 149
49 3300050490 nmdc:mga03n38_4827_c1 nmdc:mga03n38_4827_c1_1596_2066 149
50 3300050491 nmdc:mga00v17_14264_c1 nmdc:mga00v17_14264_c1_2360_2830 149
51 3300050492 nmdc:mga0yw44_5595_c1 nmdc:mga0yw44_5595_c1_1347_1817 149
52 3300050493 nmdc:mga0k408_1313_c1 nmdc:mga0k408_1313_c1_7495_7965 149
53 3300050494 nmdc:mga06z11_1020_c1 nmdc:mga06z11_1020_c1_4078_4548 149
54 3300050495 nmdc:mga04h51_1956_c1 nmdc:mga04h51_1956_c1_1303_1773 149
55 3300050496 nmdc:mga07m45_9583_c1 nmdc:mga07m45_9583_c1_1420_1890 149
56 3300050516 nmdc:mga0sz30_7217_c1 nmdc:mga0sz30_7217_c1_983_1453 149
57 3300053122 Ga0500608_001647 Ga0500608_001647_2934_3389 149
58 3300001979 JGI24740J21852_10019260 JGI24740J21852_100192604 150
59 3300001979 JGI24740J21852_10065968 JGI24740J21852_100659681 150
60 3300001989 JGI24739J22299_10078299 JGI24739J22299_100782992 150
61 3300001990 JGI24737J22298_10010200 JGI24737J22298_100102003 150
62 3300002067 JGI24735J21928_10000589 JGI24735J21928_1000058912 150
63 3300002739 JGI25158J39367_1009898 JGI25158J39367_10098983 150
64 3300002774 JGI25150J39212_1002582 JGI25150J39212_10025823 150
65 3300003187 JGI25151J46595_10014151 JGI25151J46595_100141513 150
66 3300003187 JGI25151J46595_10068449 JGI25151J46595_100684493 150
67 3300003215 JGI25153J46596_10033361 JGI25153J46596_100333613 150
68 3300003316 rootH1_10027942 rootH1_100279424 150
69 3300003323 rootH1_10120212 rootH1_101202125 150
70 3300003760 Ga0055527_1006523 Ga0055527_10065232 150
71 3300003761 Ga0055535_1000115 Ga0055535_100011578 150
72 3300003762 Ga0055542_1000028 Ga0055542_100002885 150
73 3300003773 Ga0055537_1007555 Ga0055537_10075553 150
74 3300003781 Ga0055536_1007682 Ga0055536_10076823 150
75 3300003784 Ga0055534_1007435 Ga0055534_10074353 150
76 3300003790 Ga0055528_1016487 Ga0055528_10164873 150
77 3300003791 Ga0055530_10000380 Ga0055530_1000038023 150
78 3300003791 Ga0055530_10003806 Ga0055530_100038063 150
79 3300003792 Ga0055540_1001790 Ga0055540_100179010 150
80 3300003792 Ga0055540_1019493 Ga0055540_10194933 150
81 3300003794 Ga0055531_10000084 Ga0055531_1000008474 150
82 3300005288 Ga0065714_10077745 Ga0065714_100777452 150
83 3300005327 Ga0070658_10483300 Ga0070658_104833002 150
84 3300005334 Ga0068869_101121546 Ga0068869_1011215462 150
85 3300005335 Ga0070666_10074877 Ga0070666_100748773 150
86 3300005366 Ga0070659_100025930 Ga0070659_1000259302 150
87 3300005455 Ga0070663_100800769 Ga0070663_1008007691 150
88 3300005456 Ga0070678_100675304 Ga0070678_1006753042 150
89 3300005539 Ga0068853_100024762 Ga0068853_1000247625 150
90 3300005539 Ga0068853_100170844 Ga0068853_1001708443 150
91 3300005539 Ga0068853_100603924 Ga0068853_1006039242 150
92 3300005564 Ga0070664_100076910 Ga0070664_1000769104 150
93 3300005577 Ga0068857_100317346 Ga0068857_1003173463 150
94 3300005577 Ga0068857_101590763 Ga0068857_1015907632 150
95 3300005578 Ga0068854_100376402 Ga0068854_1003764022 150
96 3300005614 Ga0068856_100305768 Ga0068856_1003057682 150
97 3300005614 Ga0068856_100712190 Ga0068856_1007121902 150
98 3300005616 Ga0068852_100017829 Ga0068852_1000178293 150
99 3300005616 Ga0068852_100142243 Ga0068852_1001422432 150
100 3300005616 Ga0068852_101425210 Ga0068852_1014252102 150
101 3300005834 Ga0068851_10080322 Ga0068851_100803222 150
102 3300006042 Ga0075368_10206456 Ga0075368_102064561 150
103 3300006048 Ga0075363_100209451 Ga0075363_1002094513 150
104 3300006048 Ga0075363_100615349 Ga0075363_1006153491 150
105 3300006051 Ga0075364_10005448 Ga0075364_100054483 150
106 3300006058 Ga0075432_10004475 Ga0075432_100044753 150
107 3300006177 Ga0075362_10001157 Ga0075362_100011575 150
108 3300006177 Ga0075362_10029335 Ga0075362_100293353 150
109 3300006178 Ga0075367_10094701 Ga0075367_100947013 150
110 3300006178 Ga0075367_10572047 Ga0075367_105720471 150
111 3300006195 Ga0075366_10073998 Ga0075366_100739982 150
112 3300006195 Ga0075366_10104313 Ga0075366_101043132 150
113 3300006195 Ga0075366_10221684 Ga0075366_102216842 150
114 3300006353 Ga0075370_10000575 Ga0075370_100005755 150
115 3300006353 Ga0075370_10023715 Ga0075370_100237153 150
116 3300006353 Ga0075370_10060742 Ga0075370_100607422 150
117 3300006946 Ga0079104_1038669 Ga0079104_10386691 150
118 3300009011 Ga0105251_10000427 Ga0105251_100004275 150
119 3300009036 Ga0105244_10012387 Ga0105244_100123873 150
120 3300009036 Ga0105244_10282175 Ga0105244_102821752 150
121 3300009092 Ga0105250_10192633 Ga0105250_101926332 150
122 3300009093 Ga0105240_10203394 Ga0105240_102033943 150
123 3300009093 Ga0105240_11650691 Ga0105240_116506911 150
124 3300009098 Ga0105245_11123170 Ga0105245_111231701 150
125 3300009148 Ga0105243_10004528 Ga0105243_100045288 150
126 3300009148 Ga0105243_10032819 Ga0105243_100328193 150
127 3300009176 Ga0105242_10340120 Ga0105242_103401202 150
128 3300009545 Ga0105237_10159765 Ga0105237_101597653 150
129 3300009551 Ga0105238_10051201 Ga0105238_100512014 150
130 3300009551 Ga0105238_10056077 Ga0105238_100560772 150
131 3300009551 Ga0105238_12195069 Ga0105238_121950692 150
132 3300010375 Ga0105239_10158456 Ga0105239_101584563 150
133 3300012502 Ga0157347_1011112 Ga0157347_10111122 150
134 3300013100 Ga0157373_10025435 Ga0157373_100254352 150
135 3300013100 Ga0157373_10261531 Ga0157373_102615312 150
136 3300013102 Ga0157371_10082692 Ga0157371_100826923 150
137 3300013102 Ga0157371_10123211 Ga0157371_101232113 150
138 3300013104 Ga0157370_10042603 Ga0157370_100426032 150
139 3300013105 Ga0157369_10001241 Ga0157369_100012419 150
140 3300013296 Ga0157374_10009373 Ga0157374_100093737 150
141 3300013306 Ga0163162_10476825 Ga0163162_104768252 150
142 3300013307 Ga0157372_10312934 Ga0157372_103129342 150
143 3300014326 Ga0157380_12314693 Ga0157380_123146931 150
144 3300014497 Ga0182008_10002465 Ga0182008_100024659 150
145 3300014497 Ga0182008_10002632 Ga0182008_100026329 150
146 3300015261 Ga0182006_1002482 Ga0182006_100248210 150
147 3300015261 Ga0182006_1091634 Ga0182006_10916342 150
148 3300015262 Ga0182007_10001059 Ga0182007_100010595 150
149 3300015265 Ga0182005_1118525 Ga0182005_11185252 150
150 3300017792 Ga0163161_10000657 Ga0163161_100006576 150
151 3300025228 Ga0209672_100982 Ga0209672_1009826 150
152 3300025228 Ga0209672_101155 Ga0209672_1011554 150
153 3300025229 Ga0209147_101077 Ga0209147_1010772 150
154 3300025242 Ga0209258_100067 Ga0209258_100067168 150
155 3300025245 Ga0207425_1000434 Ga0207425_100043415 150
156 3300025245 Ga0207425_1001023 Ga0207425_10010238 150
157 3300025254 Ga0209148_1000067 Ga0209148_1000067211 150
158 3300025258 Ga0209129_1000030 Ga0209129_100003094 150
159 3300025258 Ga0209129_1031627 Ga0209129_10316271 150
160 3300025263 Ga0209565_1000019 Ga0209565_1000019166 150
161 3300025263 Ga0209565_1001223 Ga0209565_100122311 150
162 3300025273 Ga0209673_1000066 Ga0209673_10000669 150
163 3300025273 Ga0209673_1000095 Ga0209673_100009585 150
164 3300025284 Ga0209130_1000011 Ga0209130_1000011158 150
165 3300025284 Ga0209130_1004492 Ga0209130_10044924 150
166 3300025291 Ga0209675_1000031 Ga0209675_100003116 150
167 3300025291 Ga0209675_1004844 Ga0209675_10048445 150
168 3300025292 Ga0209676_1000005 Ga0209676_1000005960 150
169 3300025292 Ga0209676_1000123 Ga0209676_1000123140 150
170 3300025292 Ga0209676_1002917 Ga0209676_100291712 150
171 3300025294 Ga0209025_1000078 Ga0209025_100007814 150
172 3300025294 Ga0209025_1000319 Ga0209025_100031947 150
173 3300025294 Ga0209025_1001554 Ga0209025_10015545 150
174 3300025294 Ga0209025_1009510 Ga0209025_10095104 150
175 3300025295 Ga0209564_1000056 Ga0209564_100005681 150
176 3300025295 Ga0209564_1000099 Ga0209564_100009910 150
177 3300025297 Ga0209758_1000037 Ga0209758_1000037245 150
178 3300025298 Ga0209050_1000007 Ga0209050_1000007137 150
179 3300025298 Ga0209050_1000188 Ga0209050_1000188103 150
180 3300025299 Ga0209256_1000022 Ga0209256_1000022300 150
181 3300025299 Ga0209256_1000043 Ga0209256_100004381 150
182 3300025302 Ga0207426_1000029 Ga0207426_1000029245 150
183 3300025302 Ga0207426_1000260 Ga0207426_100026073 150
184 3300025302 Ga0207426_1003898 Ga0207426_100389811 150
185 3300025303 Ga0209051_1000036 Ga0209051_1000036311 150
186 3300025303 Ga0209051_1000091 Ga0209051_1000091140 150
187 3300025304 Ga0209257_1000011 Ga0209257_1000011934 150
188 3300025304 Ga0209257_1000057 Ga0209257_100005798 150
189 3300025321 Ga0207656_10046457 Ga0207656_100464573 150
190 3300025728 Ga0207655_1001871 Ga0207655_10018714 150
191 3300025735 Ga0207713_1007353 Ga0207713_10073533 150
192 3300025903 Ga0207680_10061690 Ga0207680_100616903 150
193 3300025904 Ga0207647_10014440 Ga0207647_100144405 150
194 3300025904 Ga0207647_10200988 Ga0207647_102009883 150
195 3300025908 Ga0207643_10195687 Ga0207643_101956872 150
196 3300025911 Ga0207654_10454470 Ga0207654_104544702 150
197 3300025913 Ga0207695_10400404 Ga0207695_104004042 150
198 3300025914 Ga0207671_10068770 Ga0207671_100687702 150
199 3300025924 Ga0207694_10152653 Ga0207694_101526533 150
200 3300025931 Ga0207644_11125769 Ga0207644_111257691 150
201 3300025932 Ga0207690_10064824 Ga0207690_100648243 150
202 3300025932 Ga0207690_10095002 Ga0207690_100950022 150
203 3300025933 Ga0207706_10506764 Ga0207706_105067642 150
204 3300025934 Ga0207686_10277216 Ga0207686_102772162 150
205 3300025935 Ga0207709_10001089 Ga0207709_1000108916 150
206 3300025935 Ga0207709_10012585 Ga0207709_100125855 150
207 3300025938 Ga0207704_11108880 Ga0207704_111088801 150
208 3300025942 Ga0207689_10091608 Ga0207689_100916082 150
209 3300025942 Ga0207689_10271241 Ga0207689_102712412 150
210 3300025945 Ga0207679_10073814 Ga0207679_100738142 150
211 3300025949 Ga0207667_10066718 Ga0207667_100667184 150
212 3300026041 Ga0207639_10022579 Ga0207639_100225793 150
213 3300026067 Ga0207678_10358986 Ga0207678_103589861 150
214 3300026067 Ga0207678_10370686 Ga0207678_103706861 150
215 3300026078 Ga0207702_10458938 Ga0207702_104589382 150
216 3300026089 Ga0207648_10100100 Ga0207648_101001002 150
217 3300026116 Ga0207674_10245152 Ga0207674_102451522 150
218 3300026116 Ga0207674_10409664 Ga0207674_104096643 150
219 3300026142 Ga0207698_10048515 Ga0207698_100485151 150
220 3300026142 Ga0207698_10185212 Ga0207698_101852122 150
221 3300027866 Ga0209813_10089423 Ga0209813_100894232 150
222 3300027907 Ga0207428_10093489 Ga0207428_100934893 150
223 3300028380 Ga0268265_10003468 Ga0268265_100034683 150
224 3300031548 Ga0307408_100000926 Ga0307408_10000092612 150
225 3300031548 Ga0307408_100017628 Ga0307408_1000176286 150
226 3300031548 Ga0307408_100072377 Ga0307408_1000723773 150
227 3300031730 Ga0307516_10923911 Ga0307516_109239111 150
228 3300031901 Ga0307406_10000530 Ga0307406_1000053013 150
229 3300031903 Ga0307407_10050490 Ga0307407_100504902 150
230 3300031911 Ga0307412_10019028 Ga0307412_100190286 150
231 3300032002 Ga0307416_100010649 Ga0307416_1000106494 150
232 3300032004 Ga0307414_10293112 Ga0307414_102931122 150
233 3300034817 Ga0373948_0053336 Ga0373948_0053336_48_503 150
234 3300037471 Ga0395905_0198135 Ga0395905_0198135_753_1217 150
235 3300041404 Ga0439436_0002289 Ga0439436_0002289_4795_5256 150
236 3300041405 Ga0439438_043902 Ga0439438_043902_142_603 150
237 3300041406 Ga0439439_0049299 Ga0439439_0049299_600_1061 150
238 3300041411 Ga0439466_0081898 Ga0439466_0081898_22_483 150
239 3300042006 Ga0439432_020286 Ga0439432_020286_1365_1826 150
240 3300042007 Ga0439449_0001822 Ga0439449_0001822_4801_5262 150
241 3300042015 Ga0439462_0002942 Ga0439462_0002942_1474_1935 150
242 3300042015 Ga0439462_0136483 Ga0439462_0136483_168_629 150
243 3300042115 Ga0450911_014977 Ga0450911_014977_214_675 150
244 3300042122 Ga0450920_006489 Ga0450920_006489_1482_1943 150
245 3300042125 Ga0450923_007891 Ga0450923_007891_734_1195 150
246 3300042125 Ga0450923_026559 Ga0450923_026559_424_885 150
247 3300042128 Ga0450897_019183 Ga0450897_019183_58_519 150
248 3300042131 Ga0450894_006910 Ga0450894_006910_605_1066 150
249 3300042145 Ga0450906_035608 Ga0450906_035608_71_532 150
250 3300042156 Ga0439446_0020533 Ga0439446_0020533_143_604 150
251 3300042156 Ga0439446_0074031 Ga0439446_0074031_396_857 150
252 3300042185 Ga0450909_005967 Ga0450909_005967_863_1324 150
253 3300042435 Ga0439434_0015977 Ga0439434_0015977_492_953 150
254 3300042436 Ga0439435_0121905 Ga0439435_0121905_121_582 150
255 3300042438 Ga0439459_0021413 Ga0439459_0021413_77_538 150
256 3300042439 Ga0439464_0161633 Ga0439464_0161633_82_543 150
257 3300042532 Ga0450893_0032267 Ga0450893_0032267_243_704 150
258 3300044842 Ga0466957_0458910 Ga0466957_0458910_77_538 150
259 3300045051 Ga0451576_0086095 Ga0451576_0086095_2417_2869 150
260 3300046457 Ga0495590_0001242 Ga0495590_0001242_7716_8177 150
261 3300046459 Ga0495629_0429509 Ga0495629_0429509_112_573 150
262 3300046500 Ga0495596_0180299 Ga0495596_0180299_342_803 150
263 3300046507 Ga0495606_0055462 Ga0495606_0055462_215_676 150
264 3300046512 Ga0495610_0014119 Ga0495610_0014119_453_914 150
265 3300046513 Ga0495616_0002706 Ga0495616_0002706_2215_2676 150
266 3300046515 Ga0495620_0007723 Ga0495620_0007723_4882_5343 150
267 3300046517 Ga0495630_0733761 Ga0495630_0733761_214_675 150
268 3300046518 Ga0495631_0000007 Ga0495631_0000007_80824_81285 150
269 3300046520 Ga0495637_0155607 Ga0495637_0155607_162_623 150
270 3300046542 Ga0495597_0100199 Ga0495597_0100199_351_812 150
271 3300046660 Ga0495625_0000056 Ga0495625_0000056_61034_61495 150
272 3300046660 Ga0495625_0156761 Ga0495625_0156761_302_763 150
273 3300046674 Ga0495588_0218424 Ga0495588_0218424_519_980 150
274 3300046690 Ga0495624_0485495 Ga0495624_0485495_33_494 150
275 3300046691 Ga0495670_0084782 Ga0495670_0084782_420_881 150
276 3300046794 Ga0495589_0519939 Ga0495589_0519939_53_514 150
277 3300046809 Ga0495600_0227112 Ga0495600_0227112_137_598 150
278 3300046810 Ga0495660_0090964 Ga0495660_0090964_355_816 150
279 3300046810 Ga0495660_0135472 Ga0495660_0135472_717_1178 150
280 3300047317 Ga0495604_0003914 Ga0495604_0003914_258_719 150
281 3300047321 Ga0495676_0059065 Ga0495676_0059065_1401_1862 150
282 3300047323 Ga0495683_0000483 Ga0495683_0000483_27763_28224 150
283 3300047323 Ga0495683_0040476 Ga0495683_0040476_31_492 150
284 3300047443 Ga0495687_010068 Ga0495687_010068_1875_2336 150
285 3300047445 Ga0495677_0147119 Ga0495677_0147119_184_636 150
286 3300047469 Ga0495673_0175641 Ga0495673_0175641_255_716 150
287 3300047673 Ga0495593_0031481 Ga0495593_0031481_2348_2809 150
288 3300047673 Ga0495593_0040623 Ga0495593_0040623_1735_2196 150
289 3300048088 Ga0495602_0017599 Ga0495602_0017599_6672_7133 150
290 3300048088 Ga0495602_0038320 Ga0495602_0038320_3752_4213 150
291 3300048091 Ga0495626_0009926 Ga0495626_0009926_2800_3261 150
292 3300048903 Ga0496100_0101416 Ga0496100_0101416_580_1041 150
293 3300048904 Ga0496101_0019182 Ga0496101_0019182_161_622 150
294 3300048905 Ga0496102_0011536 Ga0496102_0011536_1734_2195 150
295 3300048906 Ga0496103_0004113 Ga0496103_0004113_5972_6433 150
296 3300048909 Ga0496106_0034656 Ga0496106_0034656_1335_1796 150
297 3300048910 Ga0496107_0007427 Ga0496107_0007427_6769_7230 150
298 3300048911 Ga0496108_0767753 Ga0496108_0767753_121_582 150
299 3300048913 Ga0496110_0033465 Ga0496110_0033465_1397_1858 150
300 3300048914 Ga0496111_0097044 Ga0496111_0097044_245_706 150
301 3300048915 Ga0496112_0049701 Ga0496112_0049701_2739_3200 150
302 3300048916 Ga0496113_0004854 Ga0496113_0004854_7167_7628 150
303 3300048919 Ga0496116_0067882 Ga0496116_0067882_667_1128 150
304 3300048919 Ga0496116_0210565 Ga0496116_0210565_58_519 150
305 3300048920 Ga0496117_0018250 Ga0496117_0018250_2888_3349 150
306 3300048920 Ga0496117_0142136 Ga0496117_0142136_561_1022 150
307 3300048921 Ga0496118_0038446 Ga0496118_0038446_1392_1853 150
308 3300048921 Ga0496118_0064386 Ga0496118_0064386_1242_1703 150
309 3300048924 Ga0496121_0019431 Ga0496121_0019431_563_1024 150
310 3300048924 Ga0496121_0200367 Ga0496121_0200367_420_881 150
311 3300048925 Ga0496122_0097709 Ga0496122_0097709_121_582 150
312 3300048925 Ga0496122_0107920 Ga0496122_0107920_1206_1667 150
313 3300048926 Ga0496123_0061360 Ga0496123_0061360_1505_1966 150
314 3300048926 Ga0496123_0489792 Ga0496123_0489792_66_527 150
315 3300048927 Ga0496124_0019236 Ga0496124_0019236_1073_1534 150
316 3300048927 Ga0496124_0109845 Ga0496124_0109845_629_1090 150
317 3300048927 Ga0496124_0199425 Ga0496124_0199425_879_1340 150
318 3300048928 Ga0496125_0018669 Ga0496125_0018669_501_962 150
319 3300048928 Ga0496125_0152093 Ga0496125_0152093_758_1219 150
320 3300049129 Ga0501309_017261 Ga0501309_017261_481_933 150
321 3300049459 Ga0495678_043424 Ga0495678_043424_794_1255 150
322 3300049515 Ga0501292_060251 Ga0501292_060251_81_533 150
323 3300049517 Ga0501294_024554 Ga0501294_024554_136_588 150
324 3300049653 Ga0501206_000487 Ga0501206_000487_575_1027 150
325 3300049654 Ga0501207_075224 Ga0501207_075224_85_537 150
326 3300049759 Ga0501262_010025 Ga0501262_010025_609_1061 150
327 3300049762 Ga0501265_003053 Ga0501265_003053_1060_1512 150
328 3300050489 nmdc:mga03683_545_c1 nmdc:mga03683_545_c1_5631_6092 150
329 3300050490 nmdc:mga03n38_29907_c1 nmdc:mga03n38_29907_c1_1200_1661 150
330 3300050490 nmdc:mga03n38_9667_c1 nmdc:mga03n38_9667_c1_557_1018 150
331 3300050491 nmdc:mga00v17_1957_c1 nmdc:mga00v17_1957_c1_5567_6028 150
332 3300050491 nmdc:mga00v17_620390_c1 nmdc:mga00v17_620390_c1_74_535 150
333 3300050492 nmdc:mga0yw44_822_c1 nmdc:mga0yw44_822_c1_10561_11022 150
334 3300050493 nmdc:mga0k408_11610_c1 nmdc:mga0k408_11610_c1_1654_2109 150
335 3300050493 nmdc:mga0k408_40895_c1 nmdc:mga0k408_40895_c1_792_1253 150
336 3300050494 nmdc:mga06z11_267741_c1 nmdc:mga06z11_267741_c1_349_810 150
337 3300050494 nmdc:mga06z11_80647_c1 nmdc:mga06z11_80647_c1_944_1405 150
338 3300050495 nmdc:mga04h51_135699_c1 nmdc:mga04h51_135699_c1_402_863 150
339 3300050496 nmdc:mga07m45_1263_c1 nmdc:mga07m45_1263_c1_238_699 150
340 3300050496 nmdc:mga07m45_570823_c1 nmdc:mga07m45_570823_c1_122_583 150
341 3300050496 nmdc:mga07m45_82856_c1 nmdc:mga07m45_82856_c1_1354_1815 150
342 3300050496 nmdc:mga07m45_98435_c1 nmdc:mga07m45_98435_c1_40_495 150
343 3300053087 Ga0500643_013144 Ga0500643_013144_1792_2253 150
344 3300053093 Ga0500651_0000957 Ga0500651_0000957_13322_13783 150
345 3300053110 Ga0500571_000024 Ga0500571_000024_38849_39310 150
346 3300053116 Ga0500592_008481 Ga0500592_008481_724_1185 150
347 3300053125 Ga0500618_031463 Ga0500618_031463_335_796 150
348 3300053136 Ga0500559_0027986 Ga0500559_0027986_111_572 150
349 3300053138 Ga0500564_068558 Ga0500564_068558_576_1037 150
350 3300053139 Ga0500568_0003259 Ga0500568_0003259_6156_6617 150
351 3300053141 Ga0500574_007237 Ga0500574_007237_1335_1796 150
352 3300053154 Ga0500619_193608 Ga0500619_193608_80_541 150
353 3300053162 Ga0500638_004803 Ga0500638_004803_1239_1700 150
354 3300053177 Ga0500636_0153160 Ga0500636_0153160_397_858 150
355 3300053734 Ga0500565_022799 Ga0500565_022799_192_653 150
356 3300059641 Ga0587068_024858 Ga0587068_024858_149_610 150
357 3300059645 Ga0587076_023408 Ga0587076_023408_192_653 150
358 iso_pu_bacteria 2863421361 2863422838 150
359 3300005327 Ga0070658_10027600 Ga0070658_100276003 151
360 3300005328 Ga0070676_10018812 Ga0070676_100188122 151
361 3300005328 Ga0070676_10139974 Ga0070676_101399743 151
362 3300005331 Ga0070670_100000540 Ga0070670_10000054017 151
363 3300005331 Ga0070670_100022297 Ga0070670_1000222974 151
364 3300005331 Ga0070670_100068177 Ga0070670_1000681773 151
365 3300005334 Ga0068869_100002271 Ga0068869_10000227111 151
366 3300005338 Ga0068868_100032080 Ga0068868_1000320802 151
367 3300005339 Ga0070660_100108727 Ga0070660_1001087273 151
368 3300005344 Ga0070661_100052691 Ga0070661_1000526912 151
369 3300005347 Ga0070668_100110348 Ga0070668_1001103482 151
370 3300005353 Ga0070669_100020431 Ga0070669_1000204313 151
371 3300005355 Ga0070671_100020456 Ga0070671_1000204567 151
372 3300005366 Ga0070659_100057651 Ga0070659_1000576514 151
373 3300005367 Ga0070667_100005867 Ga0070667_1000058678 151
374 3300005440 Ga0070705_100168650 Ga0070705_1001686502 151
375 3300005441 Ga0070700_100352045 Ga0070700_1003520451 151
376 3300005455 Ga0070663_100365164 Ga0070663_1003651642 151
377 3300005455 Ga0070663_100380086 Ga0070663_1003800862 151
378 3300005455 Ga0070663_100588954 Ga0070663_1005889542 151
379 3300005457 Ga0070662_100521362 Ga0070662_1005213621 151
380 3300005459 Ga0068867_100058308 Ga0068867_1000583082 151
381 3300005459 Ga0068867_100546421 Ga0068867_1005464212 151
382 3300005467 Ga0070706_100765192 Ga0070706_1007651921 151
383 3300005468 Ga0070707_101217524 Ga0070707_1012175241 151
384 3300005535 Ga0070684_100203830 Ga0070684_1002038302 151
385 3300005543 Ga0070672_101234742 Ga0070672_1012347422 151
386 3300005545 Ga0070695_100150446 Ga0070695_1001504463 151
387 3300005546 Ga0070696_100527259 Ga0070696_1005272592 151
388 3300005547 Ga0070693_100101426 Ga0070693_1001014262 151
389 3300005564 Ga0070664_100005230 Ga0070664_10000523012 151
390 3300005577 Ga0068857_100334396 Ga0068857_1003343963 151
391 3300005614 Ga0068856_100414966 Ga0068856_1004149663 151
392 3300005616 Ga0068852_100018858 Ga0068852_1000188584 151
393 3300005616 Ga0068852_100168530 Ga0068852_1001685302 151
394 3300005617 Ga0068859_100057856 Ga0068859_1000578563 151
395 3300005617 Ga0068859_100116942 Ga0068859_1001169422 151
396 3300005617 Ga0068859_100632211 Ga0068859_1006322112 151
397 3300005618 Ga0068864_100003727 Ga0068864_10000372712 151
398 3300005618 Ga0068864_100025373 Ga0068864_1000253732 151
399 3300005719 Ga0068861_100006842 Ga0068861_1000068428 151
400 3300005834 Ga0068851_10121300 Ga0068851_101213003 151
401 3300005840 Ga0068870_10001893 Ga0068870_100018939 151
402 3300005841 Ga0068863_100085322 Ga0068863_1000853223 151
403 3300005841 Ga0068863_100086430 Ga0068863_1000864303 151
404 3300005842 Ga0068858_100011316 Ga0068858_1000113168 151
405 3300005843 Ga0068860_100013006 Ga0068860_1000130068 151
406 3300005844 Ga0068862_100028341 Ga0068862_1000283412 151
407 3300005985 Ga0081539_10266234 Ga0081539_102662342 151
408 3300006358 Ga0068871_101061949 Ga0068871_1010619491 151
409 3300006931 Ga0097620_100057853 Ga0097620_1000578533 151
410 3300006931 Ga0097620_100116928 Ga0097620_1001169282 151
411 3300006931 Ga0097620_100632069 Ga0097620_1006320692 151
412 3300009011 Ga0105251_10000005 Ga0105251_1000000547 151
413 3300009011 Ga0105251_10003188 Ga0105251_100031885 151
414 3300009093 Ga0105240_10004916 Ga0105240_1000491611 151
415 3300009098 Ga0105245_10014386 Ga0105245_100143867 151
416 3300009098 Ga0105245_10374711 Ga0105245_103747112 151
417 3300009101 Ga0105247_10034404 Ga0105247_100344043 151
418 3300009148 Ga0105243_10165120 Ga0105243_101651202 151
419 3300009174 Ga0105241_10169198 Ga0105241_101691983 151
420 3300009177 Ga0105248_10006219 Ga0105248_1000621913 151
421 3300009177 Ga0105248_10236846 Ga0105248_102368462 151
422 3300009177 Ga0105248_10639287 Ga0105248_106392872 151
423 3300009177 Ga0105248_11017885 Ga0105248_110178852 151
424 3300009545 Ga0105237_10141187 Ga0105237_101411872 151
425 3300009545 Ga0105237_10377768 Ga0105237_103777682 151
426 3300009551 Ga0105238_10671102 Ga0105238_106711021 151
427 3300009553 Ga0105249_10276877 Ga0105249_102768772 151
428 3300013105 Ga0157369_10546899 Ga0157369_105468992 151
429 3300013296 Ga0157374_10043751 Ga0157374_100437515 151
430 3300013296 Ga0157374_10223274 Ga0157374_102232743 151
431 3300013297 Ga0157378_10010746 Ga0157378_100107468 151
432 3300013306 Ga0163162_10160493 Ga0163162_101604934 151
433 3300013306 Ga0163162_11008243 Ga0163162_110082432 151
434 3300013307 Ga0157372_10166010 Ga0157372_101660103 151
435 3300013308 Ga0157375_10194238 Ga0157375_101942382 151
436 3300014325 Ga0163163_10128554 Ga0163163_101285542 151
437 3300014325 Ga0163163_10574087 Ga0163163_105740872 151
438 3300014968 Ga0157379_10021652 Ga0157379_100216526 151
439 3300025315 Ga0207697_10041147 Ga0207697_100411472 151
440 3300025321 Ga0207656_10008463 Ga0207656_100084632 151
441 3300025735 Ga0207713_1000036 Ga0207713_1000036155 151
442 3300025735 Ga0207713_1002789 Ga0207713_10027895 151
443 3300025903 Ga0207680_10060019 Ga0207680_100600192 151
444 3300025907 Ga0207645_10031101 Ga0207645_100311014 151
445 3300025909 Ga0207705_10084916 Ga0207705_100849162 151
446 3300025913 Ga0207695_10333238 Ga0207695_103332382 151
447 3300025914 Ga0207671_10343119 Ga0207671_103431192 151
448 3300025919 Ga0207657_10985322 Ga0207657_109853222 151
449 3300025923 Ga0207681_10033213 Ga0207681_100332133 151
450 3300025924 Ga0207694_10677670 Ga0207694_106776701 151
451 3300025924 Ga0207694_10797322 Ga0207694_107973222 151
452 3300025925 Ga0207650_10005387 Ga0207650_100053872 151
453 3300025925 Ga0207650_10007014 Ga0207650_100070143 151
454 3300025925 Ga0207650_10088595 Ga0207650_100885953 151
455 3300025925 Ga0207650_10201358 Ga0207650_102013582 151
456 3300025927 Ga0207687_10012072 Ga0207687_100120725 151
457 3300025931 Ga0207644_10007558 Ga0207644_100075582 151
458 3300025933 Ga0207706_10534820 Ga0207706_105348202 151
459 3300025940 Ga0207691_10423659 Ga0207691_104236591 151
460 3300025941 Ga0207711_10015519 Ga0207711_100155197 151
461 3300025941 Ga0207711_10397875 Ga0207711_103978752 151
462 3300025942 Ga0207689_10000556 Ga0207689_1000055616 151
463 3300025945 Ga0207679_10026449 Ga0207679_100264495 151
464 3300025972 Ga0207668_10017548 Ga0207668_100175484 151
465 3300025986 Ga0207658_10006734 Ga0207658_100067342 151
466 3300026023 Ga0207677_10010768 Ga0207677_100107683 151
467 3300026023 Ga0207677_11861798 Ga0207677_118617981 151
468 3300026035 Ga0207703_10005102 Ga0207703_1000510210 151
469 3300026067 Ga0207678_10420443 Ga0207678_104204432 151
470 3300026088 Ga0207641_10050978 Ga0207641_100509783 151
471 3300026088 Ga0207641_10067199 Ga0207641_100671993 151
472 3300026089 Ga0207648_10194167 Ga0207648_101941672 151
473 3300026089 Ga0207648_10232950 Ga0207648_102329502 151
474 3300026089 Ga0207648_10673350 Ga0207648_106733502 151
475 3300026095 Ga0207676_10004509 Ga0207676_100045099 151
476 3300026095 Ga0207676_10237638 Ga0207676_102376382 151
477 3300026095 Ga0207676_10495173 Ga0207676_104951732 151
478 3300026118 Ga0207675_100000530 Ga0207675_10000053023 151
479 3300026142 Ga0207698_10057456 Ga0207698_100574563 151
480 3300026142 Ga0207698_10323557 Ga0207698_103235571 151
481 3300028380 Ga0268265_10024384 Ga0268265_100243845 151
482 3300028381 Ga0268264_10001980 Ga0268264_1000198014 151
483 3300028794 Ga0307515_10610861 Ga0307515_106108611 151
484 3300031548 Ga0307408_100884878 Ga0307408_1008848782 151
485 3300037471 Ga0395905_1115185 Ga0395905_1115185_22_480 151
486 3300041997 Ga0439431_0016108 Ga0439431_0016108_139_594 151
487 3300042876 Ga0451577_0984295 Ga0451577_0984295_27_488 151
488 3300044693 Ga0466961_0000383 Ga0466961_0000383_7642_8136 151
489 3300044706 Ga0466964_0233160 Ga0466964_0233160_215_709 151
490 3300045049 Ga0466959_0551113 Ga0466959_0551113_193_687 151
491 3300046522 Ga0495643_0000261 Ga0495643_0000261_41837_42292 151
492 3300046529 Ga0495652_0072702 Ga0495652_0072702_1302_1757 151
493 3300046616 Ga0495668_0032056 Ga0495668_0032056_811_1266 151
494 3300048911 Ga0496108_0220724 Ga0496108_0220724_433_891 151
495 3300048911 Ga0496108_0726060 Ga0496108_0726060_63_542 151
496 3300048912 Ga0496109_0156865 Ga0496109_0156865_588_1046 151
497 3300048915 Ga0496112_1626283 Ga0496112_1626283_19_498 151
498 3300048925 Ga0496122_0037608 Ga0496122_0037608_923_1378 151
499 3300048926 Ga0496123_0085045 Ga0496123_0085045_310_765 151
500 3300048927 Ga0496124_0397733 Ga0496124_0397733_81_536 151
501 3300049460 Ga0495682_0000254 Ga0495682_0000254_25125_25580 151
502 3300049571 Ga0501034_0000003 Ga0501034_0000003_154612_155067 151
503 3300049580 Ga0501046_1138357 Ga0501046_1138357_58_525 151
504 3300049582 Ga0501048_0582599 Ga0501048_0582599_76_543 151
505 3300049588 Ga0501072_0224223 Ga0501072_0224223_463_930 151
506 iso_pu_bacteria 2904483920 2904486920 151
507 iso_pu_bacteria 2919527303 2919528234 151
508 3300001915 JGI24741J21665_1000084 JGI24741J21665_100008417 152
509 3300001979 JGI24740J21852_10000038 JGI24740J21852_1000003823 152
510 3300001979 JGI24740J21852_10000091 JGI24740J21852_1000009118 152
511 3300002705 JGI25156J39149_1000006 JGI25156J39149_100000680 152
512 3300002705 JGI25156J39149_1000135 JGI25156J39149_100013546 152
513 3300002705 JGI25156J39149_1006100 JGI25156J39149_10061002 152
514 3300002705 JGI25156J39149_1006124 JGI25156J39149_10061243 152
515 3300002705 JGI25156J39149_1006256 JGI25156J39149_10062564 152
516 3300002705 JGI25156J39149_1016753 JGI25156J39149_10167532 152
517 3300002705 JGI25156J39149_1026051 JGI25156J39149_10260512 152
518 3300002738 JGI25154J39366_1000389 JGI25154J39366_100038918 152
519 3300002741 JGI25157J39369_1000016 JGI25157J39369_1000016102 152
520 3300003187 JGI25151J46595_10086425 JGI25151J46595_100864252 152
521 3300003214 JGI25165J46597_1000661 JGI25165J46597_100066113 152
522 3300003316 rootH1_10048720 rootH1_100487203 152
523 3300003316 rootH1_10054218 rootH1_100542186 152
524 3300003320 rootH2_10050565 rootH2_100505652 152
525 3300003322 rootL2_10009476 rootL2_1000947610 152
526 3300003322 rootL2_10137787 rootL2_101377878 152
527 3300003323 rootH1_10201936 rootH1_102019362 152
528 3300003354 JGI25160J50197_1000098 JGI25160J50197_100009873 152
529 3300003374 JGI25161J50226_1000037 JGI25161J50226_1000037111 152
530 3300003752 Ga0055539_1000075 Ga0055539_100007517 152
531 3300003756 Ga0055533_1000140 Ga0055533_100014011 152
532 3300003756 Ga0055533_1000933 Ga0055533_10009335 152
533 3300003758 Ga0055532_1000003 Ga0055532_1000003251 152
534 3300003758 Ga0055532_1000056 Ga0055532_1000056129 152
535 3300003758 Ga0055532_1000265 Ga0055532_100026520 152
536 3300003758 Ga0055532_1005641 Ga0055532_10056413 152
537 3300003759 Ga0055525_1000492 Ga0055525_10004926 152
538 3300003759 Ga0055525_1011031 Ga0055525_10110312 152
539 3300003760 Ga0055527_1000006 Ga0055527_1000006205 152
540 3300003760 Ga0055527_1000323 Ga0055527_100032320 152
541 3300003760 Ga0055527_1002493 Ga0055527_10024933 152
542 3300003760 Ga0055527_1005009 Ga0055527_10050092 152
543 3300003761 Ga0055535_1000003 Ga0055535_1000003251 152
544 3300003761 Ga0055535_1000013 Ga0055535_1000013245 152
545 3300003761 Ga0055535_1000134 Ga0055535_100013451 152
546 3300003761 Ga0055535_1000701 Ga0055535_100070120 152
547 3300003762 Ga0055542_1000007 Ga0055542_1000007251 152
548 3300003762 Ga0055542_1000178 Ga0055542_100017851 152
549 3300003762 Ga0055542_1000861 Ga0055542_100086117 152
550 3300003762 Ga0055542_1002118 Ga0055542_10021183 152
551 3300003763 Ga0055529_1000003 Ga0055529_1000003205 152
552 3300003763 Ga0055529_1000074 Ga0055529_100007426 152
553 3300003763 Ga0055529_1000203 Ga0055529_100020351 152
554 3300003771 Ga0055526_1000184 Ga0055526_100018414 152
555 3300003773 Ga0055537_1000006 Ga0055537_1000006115 152
556 3300003775 Ga0055524_1000032 Ga0055524_100003228 152
557 3300003781 Ga0055536_1005877 Ga0055536_10058776 152
558 3300003784 Ga0055534_1004608 Ga0055534_10046084 152
559 3300003790 Ga0055528_1002844 Ga0055528_10028443 152
560 3300003790 Ga0055528_1003256 Ga0055528_10032569 152
561 3300003791 Ga0055530_10000731 Ga0055530_1000073129 152
562 3300003791 Ga0055530_10000890 Ga0055530_100008902 152
563 3300003792 Ga0055540_1000046 Ga0055540_1000046142 152
564 3300003794 Ga0055531_10003007 Ga0055531_100030074 152
565 3300003841 Ga0055541_1000425 Ga0055541_10004253 152
566 3300003841 Ga0055541_1002842 Ga0055541_10028421 152
567 3300003856 Ga0058692_1008655 Ga0058692_10086552 152
568 3300004625 Ga0055543_1000645 Ga0055543_100064516 152
569 3300005262 Ga0065165_1000821 Ga0065165_100082118 152
570 3300005262 Ga0065165_1022462 Ga0065165_10224623 152
571 3300005262 Ga0065165_1022630 Ga0065165_10226302 152
572 3300005327 Ga0070658_10092842 Ga0070658_100928423 152
573 3300005327 Ga0070658_10247226 Ga0070658_102472262 152
574 3300005328 Ga0070676_10149055 Ga0070676_101490552 152
575 3300005339 Ga0070660_100000029 Ga0070660_10000002980 152
576 3300005339 Ga0070660_100015930 Ga0070660_1000159302 152
577 3300005344 Ga0070661_100001417 Ga0070661_10000141722 152
578 3300005344 Ga0070661_100400221 Ga0070661_1004002213 152
579 3300005355 Ga0070671_100048591 Ga0070671_1000485913 152
580 3300005356 Ga0070674_101228322 Ga0070674_1012283222 152
581 3300005364 Ga0070673_100266969 Ga0070673_1002669693 152
582 3300005366 Ga0070659_100000006 Ga0070659_1000000065 152
583 3300005366 Ga0070659_100000307 Ga0070659_10000030720 152
584 3300005367 Ga0070667_100216118 Ga0070667_1002161182 152
585 3300005367 Ga0070667_100909936 Ga0070667_1009099362 152
586 3300005445 Ga0070708_100027484 Ga0070708_1000274843 152
587 3300005455 Ga0070663_100000002 Ga0070663_100000002243 152
588 3300005455 Ga0070663_100018810 Ga0070663_1000188104 152
589 3300005455 Ga0070663_100288472 Ga0070663_1002884722 152
590 3300005455 Ga0070663_100293494 Ga0070663_1002934942 152
591 3300005455 Ga0070663_100398795 Ga0070663_1003987952 152
592 3300005456 Ga0070678_100359437 Ga0070678_1003594372 152
593 3300005457 Ga0070662_100179746 Ga0070662_1001797462 152
594 3300005457 Ga0070662_100867174 Ga0070662_1008671742 152
595 3300005467 Ga0070706_100008574 Ga0070706_10000857410 152
596 3300005539 Ga0068853_100115482 Ga0068853_1001154823 152
597 3300005539 Ga0068853_101622124 Ga0068853_1016221241 152
598 3300005543 Ga0070672_100013787 Ga0070672_1000137875 152
599 3300005563 Ga0068855_100445628 Ga0068855_1004456283 152
600 3300005563 Ga0068855_100540458 Ga0068855_1005404582 152
601 3300005563 Ga0068855_100830538 Ga0068855_1008305382 152
602 3300005564 Ga0070664_100000004 Ga0070664_100000004244 152
603 3300005577 Ga0068857_100057826 Ga0068857_1000578263 152
604 3300005577 Ga0068857_100389899 Ga0068857_1003898992 152
605 3300005578 Ga0068854_100000007 Ga0068854_10000000775 152
606 3300005578 Ga0068854_101469546 Ga0068854_1014695461 152
607 3300005614 Ga0068856_100000105 Ga0068856_10000010517 152
608 3300005614 Ga0068856_101023881 Ga0068856_1010238812 152
609 3300005616 Ga0068852_100013481 Ga0068852_1000134812 152
610 3300005616 Ga0068852_100068820 Ga0068852_1000688205 152
611 3300005617 Ga0068859_100491199 Ga0068859_1004911992 152
612 3300005719 Ga0068861_101879197 Ga0068861_1018791972 152
613 3300005841 Ga0068863_100048750 Ga0068863_1000487502 152
614 3300005842 Ga0068858_101576166 Ga0068858_1015761662 152
615 3300005843 Ga0068860_100520270 Ga0068860_1005202701 152
616 3300005844 Ga0068862_100135585 Ga0068862_1001355853 152
617 3300006038 Ga0075365_10149154 Ga0075365_101491543 152
618 3300006042 Ga0075368_10204252 Ga0075368_102042522 152
619 3300006048 Ga0075363_100185993 Ga0075363_1001859932 152
620 3300006178 Ga0075367_10418751 Ga0075367_104187511 152
621 3300006195 Ga0075366_10088640 Ga0075366_100886402 152
622 3300006195 Ga0075366_10308888 Ga0075366_103088882 152
623 3300006237 Ga0097621_100363184 Ga0097621_1003631842 152
624 3300006353 Ga0075370_10039542 Ga0075370_100395423 152
625 3300006844 Ga0075428_100027331 Ga0075428_1000273315 152
626 3300006847 Ga0075431_101080908 Ga0075431_1010809082 152
627 3300006871 Ga0075434_100283591 Ga0075434_1002835913 152
628 3300006931 Ga0097620_100491111 Ga0097620_1004911112 152
629 3300007076 Ga0075435_100833826 Ga0075435_1008338262 152
630 3300009036 Ga0105244_10023604 Ga0105244_100236042 152
631 3300009036 Ga0105244_10060514 Ga0105244_100605142 152
632 3300009092 Ga0105250_10030058 Ga0105250_100300582 152
633 3300009093 Ga0105240_10006257 Ga0105240_1000625711 152
634 3300009093 Ga0105240_10060318 Ga0105240_100603182 152
635 3300009093 Ga0105240_10088421 Ga0105240_100884213 152
636 3300009093 Ga0105240_10101797 Ga0105240_101017973 152
637 3300009093 Ga0105240_10284603 Ga0105240_102846032 152
638 3300009093 Ga0105240_11165314 Ga0105240_111653141 152
639 3300009093 Ga0105240_11214318 Ga0105240_112143182 152
640 3300009177 Ga0105248_10005602 Ga0105248_100056029 152
641 3300009177 Ga0105248_10011634 Ga0105248_100116349 152
642 3300009545 Ga0105237_10015527 Ga0105237_100155275 152
643 3300009545 Ga0105237_10017774 Ga0105237_100177743 152
644 3300009551 Ga0105238_10014547 Ga0105238_100145476 152
645 3300009551 Ga0105238_11101693 Ga0105238_111016932 152
646 3300009551 Ga0105238_11375308 Ga0105238_113753081 152
647 3300010375 Ga0105239_10014021 Ga0105239_100140218 152
648 3300010375 Ga0105239_10103451 Ga0105239_101034514 152
649 3300013100 Ga0157373_10004956 Ga0157373_1000495610 152
650 3300013100 Ga0157373_10015931 Ga0157373_100159313 152
651 3300013100 Ga0157373_10711698 Ga0157373_107116982 152
652 3300013102 Ga0157371_10000086 Ga0157371_1000008630 152
653 3300013102 Ga0157371_10000223 Ga0157371_1000022316 152
654 3300013102 Ga0157371_10000986 Ga0157371_1000098629 152
655 3300013102 Ga0157371_10025877 Ga0157371_100258772 152
656 3300013102 Ga0157371_10893380 Ga0157371_108933801 152
657 3300013104 Ga0157370_10000074 Ga0157370_1000007418 152
658 3300013104 Ga0157370_10059009 Ga0157370_100590095 152
659 3300013104 Ga0157370_10113281 Ga0157370_101132812 152
660 3300013104 Ga0157370_11509944 Ga0157370_115099441 152
661 3300013105 Ga0157369_10000383 Ga0157369_1000038322 152
662 3300013105 Ga0157369_10001440 Ga0157369_1000144029 152
663 3300013105 Ga0157369_10001863 Ga0157369_100018633 152
664 3300013105 Ga0157369_10039961 Ga0157369_100399614 152
665 3300013105 Ga0157369_10138605 Ga0157369_101386053 152
666 3300013105 Ga0157369_10147744 Ga0157369_101477444 152
667 3300013105 Ga0157369_10165598 Ga0157369_101655982 152
668 3300013296 Ga0157374_10000116 Ga0157374_1000011653 152
669 3300013297 Ga0157378_10465018 Ga0157378_104650182 152
670 3300013306 Ga0163162_10005148 Ga0163162_1000514810 152
671 3300013306 Ga0163162_10043604 Ga0163162_100436045 152
672 3300013307 Ga0157372_10000085 Ga0157372_1000008580 152
673 3300013307 Ga0157372_10012524 Ga0157372_100125242 152
674 3300013307 Ga0157372_10516180 Ga0157372_105161803 152
675 3300013308 Ga0157375_10007536 Ga0157375_1000753613 152
676 3300014968 Ga0157379_10074906 Ga0157379_100749062 152
677 3300015261 Ga0182006_1000317 Ga0182006_100031721 152
678 3300015261 Ga0182006_1004530 Ga0182006_10045305 152
679 3300015261 Ga0182006_1006004 Ga0182006_10060046 152
680 3300015261 Ga0182006_1007384 Ga0182006_10073842 152
681 3300015261 Ga0182006_1018543 Ga0182006_10185432 152
682 3300015261 Ga0182006_1204321 Ga0182006_12043212 152
683 3300015262 Ga0182007_10012055 Ga0182007_100120552 152
684 3300015262 Ga0182007_10038048 Ga0182007_100380482 152
685 3300015265 Ga0182005_1103388 Ga0182005_11033881 152
686 3300015683 Ga0183362_10002 Ga0183362_100021077 152
687 3300017792 Ga0163161_11784556 Ga0163161_117845561 152
688 3300020610 Ga0154015_1180002 Ga0154015_118000220 152
689 3300021361 Ga0213872_10003058 Ga0213872_100030583 152
690 3300025206 Ga0209435_100010 Ga0209435_10001090 152
691 3300025206 Ga0209435_101521 Ga0209435_1015213 152
692 3300025208 Ga0209436_104404 Ga0209436_1044042 152
693 3300025224 Ga0209784_100008 Ga0209784_100008443 152
694 3300025224 Ga0209784_100829 Ga0209784_1008294 152
695 3300025224 Ga0209784_101133 Ga0209784_1011332 152
696 3300025225 Ga0209566_100006 Ga0209566_100006443 152
697 3300025225 Ga0209566_100354 Ga0209566_10035411 152
698 3300025225 Ga0209566_100567 Ga0209566_1005677 152
699 3300025225 Ga0209566_104658 Ga0209566_1046581 152
700 3300025226 Ga0209674_100025 Ga0209674_100025241 152
701 3300025226 Ga0209674_100070 Ga0209674_10007090 152
702 3300025226 Ga0209674_100093 Ga0209674_100093135 152
703 3300025226 Ga0209674_100120 Ga0209674_10012088 152
704 3300025226 Ga0209674_101148 Ga0209674_1011486 152
705 3300025228 Ga0209672_100002 Ga0209672_1000021145 152
706 3300025228 Ga0209672_100044 Ga0209672_100044216 152
707 3300025228 Ga0209672_100075 Ga0209672_100075125 152
708 3300025228 Ga0209672_100413 Ga0209672_10041314 152
709 3300025229 Ga0209147_100003 Ga0209147_1000031145 152
710 3300025229 Ga0209147_100005 Ga0209147_100005450 152
711 3300025229 Ga0209147_100039 Ga0209147_100039216 152
712 3300025229 Ga0209147_100119 Ga0209147_10011940 152
713 3300025229 Ga0209147_100176 Ga0209147_10017659 152
714 3300025230 Ga0209563_100016 Ga0209563_100016443 152
715 3300025230 Ga0209563_101301 Ga0209563_1013017 152
716 3300025230 Ga0209563_102708 Ga0209563_1027084 152
717 3300025231 Ga0207427_100777 Ga0207427_1007775 152
718 3300025242 Ga0209258_100005 Ga0209258_100005787 152
719 3300025242 Ga0209258_100007 Ga0209258_100007450 152
720 3300025242 Ga0209258_100062 Ga0209258_100062216 152
721 3300025242 Ga0209258_100153 Ga0209258_100153125 152
722 3300025245 Ga0207425_1000908 Ga0207425_100090810 152
723 3300025245 Ga0207425_1010792 Ga0207425_10107922 152
724 3300025246 Ga0209646_1000001 Ga0209646_10000012052 152
725 3300025246 Ga0209646_1000016 Ga0209646_1000016324 152
726 3300025246 Ga0209646_1002708 Ga0209646_10027083 152
727 3300025250 Ga0209026_1000001 Ga0209026_1000001708 152
728 3300025250 Ga0209026_1001651 Ga0209026_10016515 152
729 3300025253 Ga0209677_100008 Ga0209677_100008250 152
730 3300025254 Ga0209148_1000006 Ga0209148_10000061145 152
731 3300025254 Ga0209148_1000051 Ga0209148_100005146 152
732 3300025254 Ga0209148_1000075 Ga0209148_1000075216 152
733 3300025254 Ga0209148_1000728 Ga0209148_10007288 152
734 3300025254 Ga0209148_1003409 Ga0209148_10034095 152
735 3300025256 Ga0209759_1000001 Ga0209759_10000011683 152
736 3300025256 Ga0209759_1000002 Ga0209759_1000002247 152
737 3300025256 Ga0209759_1000014 Ga0209759_1000014209 152
738 3300025256 Ga0209759_1000039 Ga0209759_100003924 152
739 3300025256 Ga0209759_1001110 Ga0209759_10011104 152
740 3300025256 Ga0209759_1002345 Ga0209759_10023458 152
741 3300025256 Ga0209759_1006058 Ga0209759_10060582 152
742 3300025256 Ga0209759_1019604 Ga0209759_10196042 152
743 3300025258 Ga0209129_1019612 Ga0209129_10196123 152
744 3300025261 Ga0209233_1000018 Ga0209233_1000018208 152
745 3300025261 Ga0209233_1051508 Ga0209233_10515082 152
746 3300025263 Ga0209565_1000016 Ga0209565_1000016248 152
747 3300025272 Ga0209455_1000003 Ga0209455_10000031145 152
748 3300025272 Ga0209455_1000011 Ga0209455_1000011375 152
749 3300025272 Ga0209455_1000067 Ga0209455_1000067216 152
750 3300025272 Ga0209455_1000221 Ga0209455_100022159 152
751 3300025273 Ga0209673_1000073 Ga0209673_100007329 152
752 3300025273 Ga0209673_1001044 Ga0209673_100104415 152
753 3300025284 Ga0209130_1000141 Ga0209130_100014119 152
754 3300025284 Ga0209130_1000210 Ga0209130_100021029 152
755 3300025284 Ga0209130_1012453 Ga0209130_10124532 152
756 3300025291 Ga0209675_1000356 Ga0209675_100035614 152
757 3300025292 Ga0209676_1000165 Ga0209676_100016529 152
758 3300025295 Ga0209564_1000165 Ga0209564_1000165137 152
759 3300025295 Ga0209564_1005057 Ga0209564_100505712 152
760 3300025295 Ga0209564_1010599 Ga0209564_10105992 152
761 3300025298 Ga0209050_1000084 Ga0209050_1000084225 152
762 3300025298 Ga0209050_1014814 Ga0209050_10148142 152
763 3300025299 Ga0209256_1000110 Ga0209256_100011029 152
764 3300025302 Ga0207426_1000103 Ga0207426_1000103128 152
765 3300025302 Ga0207426_1000145 Ga0207426_100014516 152
766 3300025302 Ga0207426_1002451 Ga0207426_10024515 152
767 3300025303 Ga0209051_1000058 Ga0209051_1000058225 152
768 3300025304 Ga0209257_1000092 Ga0209257_1000092225 152
769 3300025711 Ga0207696_1054182 Ga0207696_10541822 152
770 3300025728 Ga0207655_1023574 Ga0207655_10235741 152
771 3300025728 Ga0207655_1030654 Ga0207655_10306543 152
772 3300025735 Ga0207713_1052813 Ga0207713_10528133 152
773 3300025904 Ga0207647_10009559 Ga0207647_100095595 152
774 3300025904 Ga0207647_10011061 Ga0207647_100110614 152
775 3300025904 Ga0207647_10042812 Ga0207647_100428122 152
776 3300025904 Ga0207647_10501517 Ga0207647_105015172 152
777 3300025907 Ga0207645_10143331 Ga0207645_101433312 152
778 3300025909 Ga0207705_10107081 Ga0207705_101070812 152
779 3300025909 Ga0207705_10202607 Ga0207705_102026073 152
780 3300025910 Ga0207684_10609822 Ga0207684_106098222 152
781 3300025913 Ga0207695_10003008 Ga0207695_100030088 152
782 3300025913 Ga0207695_10003114 Ga0207695_100031148 152
783 3300025913 Ga0207695_10014899 Ga0207695_100148993 152
784 3300025913 Ga0207695_10032225 Ga0207695_100322254 152
785 3300025913 Ga0207695_10159983 Ga0207695_101599831 152
786 3300025913 Ga0207695_10595466 Ga0207695_105954662 152
787 3300025913 Ga0207695_10614241 Ga0207695_106142412 152
788 3300025913 Ga0207695_10892025 Ga0207695_108920252 152
789 3300025914 Ga0207671_10043088 Ga0207671_100430884 152
790 3300025914 Ga0207671_10065133 Ga0207671_100651334 152
791 3300025919 Ga0207657_10000072 Ga0207657_1000007211 152
792 3300025919 Ga0207657_10000389 Ga0207657_1000038922 152
793 3300025919 Ga0207657_10319697 Ga0207657_103196972 152
794 3300025920 Ga0207649_10001426 Ga0207649_1000142616 152
795 3300025922 Ga0207646_10715054 Ga0207646_107150541 152
796 3300025922 Ga0207646_11175496 Ga0207646_111754961 152
797 3300025923 Ga0207681_10139559 Ga0207681_101395593 152
798 3300025924 Ga0207694_10047952 Ga0207694_100479522 152
799 3300025924 Ga0207694_10795689 Ga0207694_107956891 152
800 3300025924 Ga0207694_10951144 Ga0207694_109511442 152
801 3300025931 Ga0207644_10351277 Ga0207644_103512771 152
802 3300025932 Ga0207690_10000019 Ga0207690_10000019209 152
803 3300025932 Ga0207690_10000722 Ga0207690_1000072221 152
804 3300025933 Ga0207706_10311127 Ga0207706_103111273 152
805 3300025937 Ga0207669_10312672 Ga0207669_103126722 152
806 3300025940 Ga0207691_10071487 Ga0207691_100714873 152
807 3300025941 Ga0207711_10012168 Ga0207711_100121687 152
808 3300025945 Ga0207679_10000002 Ga0207679_10000002276 152
809 3300025949 Ga0207667_10038803 Ga0207667_100388034 152
810 3300025949 Ga0207667_10866813 Ga0207667_108668132 152
811 3300025972 Ga0207668_10016062 Ga0207668_100160624 152
812 3300025981 Ga0207640_10000101 Ga0207640_1000010142 152
813 3300025986 Ga0207658_10112736 Ga0207658_101127364 152
814 3300025986 Ga0207658_10661784 Ga0207658_106617842 152
815 3300026035 Ga0207703_10876535 Ga0207703_108765352 152
816 3300026041 Ga0207639_10427501 Ga0207639_104275012 152
817 3300026067 Ga0207678_10000003 Ga0207678_10000003245 152
818 3300026067 Ga0207678_10030675 Ga0207678_100306755 152
819 3300026067 Ga0207678_10095757 Ga0207678_100957573 152
820 3300026078 Ga0207702_10000010 Ga0207702_10000010195 152
821 3300026078 Ga0207702_10581841 Ga0207702_105818412 152
822 3300026078 Ga0207702_10957693 Ga0207702_109576931 152
823 3300026088 Ga0207641_10420959 Ga0207641_104209593 152
824 3300026116 Ga0207674_10029272 Ga0207674_100292723 152
825 3300026116 Ga0207674_10616490 Ga0207674_106164902 152
826 3300026118 Ga0207675_100282899 Ga0207675_1002828994 152
827 3300026142 Ga0207698_10144329 Ga0207698_101443292 152
828 3300026142 Ga0207698_10313260 Ga0207698_103132602 152
829 3300027312 Ga0209371_1000095 Ga0209371_100009522 152
830 3300027312 Ga0209371_1000211 Ga0209371_100021121 152
831 3300027312 Ga0209371_1011309 Ga0209371_10113094 152
832 3300027866 Ga0209813_10147751 Ga0209813_101477512 152
833 3300030500 Ga0268256_1000116 Ga0268256_100011697 152
834 3300030500 Ga0268256_1000319 Ga0268256_100031921 152
835 3300030500 Ga0268256_1012649 Ga0268256_10126492 152
836 3300031548 Ga0307408_100010117 Ga0307408_1000101175 152
837 3300031548 Ga0307408_100010914 Ga0307408_1000109146 152
838 3300031731 Ga0307405_10001796 Ga0307405_100017962 152
839 3300031731 Ga0307405_10180755 Ga0307405_101807552 152
840 3300031824 Ga0307413_10193441 Ga0307413_101934412 152
841 3300031824 Ga0307413_10867135 Ga0307413_108671352 152
842 3300031852 Ga0307410_10033029 Ga0307410_100330293 152
843 3300031901 Ga0307406_10004428 Ga0307406_100044282 152
844 3300031903 Ga0307407_10090915 Ga0307407_100909152 152
845 3300031911 Ga0307412_10047156 Ga0307412_100471563 152
846 3300031911 Ga0307412_10460129 Ga0307412_104601292 152
847 3300031995 Ga0307409_100016120 Ga0307409_1000161202 152
848 3300032002 Ga0307416_100010204 Ga0307416_1000102047 152
849 3300032002 Ga0307416_100351229 Ga0307416_1003512292 152
850 3300032004 Ga0307414_10043576 Ga0307414_100435762 152
851 3300032005 Ga0307411_10001196 Ga0307411_100011969 152
852 3300032126 Ga0307415_100008780 Ga0307415_1000087805 152
853 3300037312 Ga0395899_0000035 Ga0395899_0000035_37263_37721 152
854 3300037312 Ga0395899_0097458 Ga0395899_0097458_1538_1996 152
855 3300037312 Ga0395899_0309102 Ga0395899_0309102_555_1013 152
856 3300037418 Ga0395900_0000113 Ga0395900_0000113_37263_37721 152
857 3300037418 Ga0395900_0003027 Ga0395900_0003027_3716_4174 152
858 3300037418 Ga0395900_0017077 Ga0395900_0017077_2798_3256 152
859 3300037418 Ga0395900_0039514 Ga0395900_0039514_1384_1842 152
860 3300037418 Ga0395900_0078296 Ga0395900_0078296_597_1055 152
861 3300037418 Ga0395900_0087484 Ga0395900_0087484_1421_1879 152
862 3300037418 Ga0395900_0402185 Ga0395900_0402185_204_662 152
863 3300037466 Ga0395898_0000254 Ga0395898_0000254_55924_56382 152
864 3300037466 Ga0395898_0000444 Ga0395898_0000444_34087_34545 152
865 3300037466 Ga0395898_0002993 Ga0395898_0002993_10420_10878 152
866 3300037466 Ga0395898_0188758 Ga0395898_0188758_171_629 152
867 3300037466 Ga0395898_0377900 Ga0395898_0377900_344_802 152
868 3300037471 Ga0395905_0197938 Ga0395905_0197938_1399_1863 152
869 3300038443 Ga0395901_0000009 Ga0395901_0000009_184596_185054 152
870 3300038443 Ga0395901_0000302 Ga0395901_0000302_3031_3489 152
871 3300038443 Ga0395901_0026100 Ga0395901_0026100_2702_3160 152
872 3300038443 Ga0395901_0032650 Ga0395901_0032650_2073_2531 152
873 3300038443 Ga0395901_0144831 Ga0395901_0144831_156_614 152
874 3300038443 Ga0395901_0308651 Ga0395901_0308651_741_1199 152
875 3300039447 Ga0436361_0834992 Ga0436361_0834992_1125_1610 152
876 3300041406 Ga0439439_0008993 Ga0439439_0008993_1681_2148 152
877 3300041411 Ga0439466_0107144 Ga0439466_0107144_212_679 152
878 3300042005 Ga0439448_0170772 Ga0439448_0170772_154_612 152
879 3300042007 Ga0439449_0000091 Ga0439449_0000091_6531_6998 152
880 3300042010 Ga0439452_043402 Ga0439452_043402_491_949 152
881 3300042015 Ga0439462_0001751 Ga0439462_0001751_166_633 152
882 3300042015 Ga0439462_0063207 Ga0439462_0063207_255_722 152
883 3300042129 Ga0450891_009863 Ga0450891_009863_47_514 152
884 3300042134 Ga0450898_049360 Ga0450898_049360_138_614 152
885 3300042138 Ga0450903_011050 Ga0450903_011050_355_822 152
886 3300042156 Ga0439446_0004975 Ga0439446_0004975_2765_3232 152
887 3300042157 Ga0439458_0089039 Ga0439458_0089039_47_505 152
888 3300042157 Ga0439458_0172519 Ga0439458_0172519_102_569 152
889 3300042435 Ga0439434_0074192 Ga0439434_0074192_132_599 152
890 3300042436 Ga0439435_0033244 Ga0439435_0033244_384_851 152
891 3300042438 Ga0439459_0174293 Ga0439459_0174293_89_556 152
892 3300042439 Ga0439464_0007334 Ga0439464_0007334_2352_2810 152
893 3300042439 Ga0439464_0251902 Ga0439464_0251902_20_478 152
894 3300044650 Ga0466986_0231794 Ga0466986_0231794_386_850 152
895 3300044656 Ga0466969_0001266 Ga0466969_0001266_12624_13082 152
896 3300044656 Ga0466969_0058166 Ga0466969_0058166_377_835 152
897 3300044656 Ga0466969_0257838 Ga0466969_0257838_321_779 152
898 3300044658 Ga0466972_0001179 Ga0466972_0001179_1664_2122 152
899 3300044672 Ga0466982_0564883 Ga0466982_0564883_14_472 152
900 3300044683 Ga0466965_0047726 Ga0466965_0047726_170_628 152
901 3300044684 Ga0466966_0000043 Ga0466966_0000043_34750_35208 152
902 3300044684 Ga0466966_0000309 Ga0466966_0000309_22572_23033 152
903 3300044684 Ga0466966_0029640 Ga0466966_0029640_198_659 152
904 3300044684 Ga0466966_0069877 Ga0466966_0069877_1333_1791 152
905 3300044684 Ga0466966_0209084 Ga0466966_0209084_339_797 152
906 3300044693 Ga0466961_0000026 Ga0466961_0000026_24825_25283 152
907 3300044693 Ga0466961_0001377 Ga0466961_0001377_7978_8436 152
908 3300044693 Ga0466961_0014187 Ga0466961_0014187_4486_4944 152
909 3300044693 Ga0466961_0126232 Ga0466961_0126232_1073_1531 152
910 3300044694 Ga0466963_0000484 Ga0466963_0000484_590_1048 152
911 3300044694 Ga0466963_0031544 Ga0466963_0031544_2784_3242 152
912 3300044719 Ga0466971_0005125 Ga0466971_0005125_4065_4526 152
913 3300044719 Ga0466971_0008279 Ga0466971_0008279_469_927 152
914 3300044719 Ga0466971_0020938 Ga0466971_0020938_1461_1919 152
915 3300044719 Ga0466971_0023300 Ga0466971_0023300_1092_1550 152
916 3300044765 Ga0466970_0000060 Ga0466970_0000060_23240_23698 152
917 3300044765 Ga0466970_0006300 Ga0466970_0006300_4821_5282 152
918 3300044765 Ga0466970_0156797 Ga0466970_0156797_204_662 152
919 3300044842 Ga0466957_0003198 Ga0466957_0003198_6104_6565 152
920 3300044842 Ga0466957_0006531 Ga0466957_0006531_3156_3614 152
921 3300044842 Ga0466957_0044637 Ga0466957_0044637_584_1042 152
922 3300045049 Ga0466959_0000129 Ga0466959_0000129_24549_25007 152
923 3300045049 Ga0466959_0013198 Ga0466959_0013198_710_1168 152
924 3300045049 Ga0466959_0013429 Ga0466959_0013429_4410_4868 152
925 3300045049 Ga0466959_0114717 Ga0466959_0114717_873_1331 152
926 3300045836 Ga0466958_0003437 Ga0466958_0003437_4399_4857 152
927 3300045836 Ga0466958_0030082 Ga0466958_0030082_2056_2514 152
928 3300045836 Ga0466958_0228778 Ga0466958_0228778_89_550 152
929 3300045976 Ga0466967_0002547 Ga0466967_0002547_9989_10447 152
930 3300045976 Ga0466967_0103605 Ga0466967_0103605_1896_2363 152
931 3300045976 Ga0466967_0730741 Ga0466967_0730741_313_783 152
932 3300046454 Ga0495592_0087784 Ga0495592_0087784_252_719 152
933 3300046455 Ga0495603_0006343 Ga0495603_0006343_4961_5419 152
934 3300046455 Ga0495603_0041414 Ga0495603_0041414_1471_1929 152
935 3300046455 Ga0495603_0313690 Ga0495603_0313690_426_884 152
936 3300046457 Ga0495590_0001136 Ga0495590_0001136_4063_4521 152
937 3300046458 Ga0495591_121300 Ga0495591_121300_127_585 152
938 3300046459 Ga0495629_0000517 Ga0495629_0000517_1688_2146 152
939 3300046459 Ga0495629_0000586 Ga0495629_0000586_26699_27157 152
940 3300046459 Ga0495629_0001679 Ga0495629_0001679_3646_4104 152
941 3300046459 Ga0495629_0060857 Ga0495629_0060857_72_539 152
942 3300046459 Ga0495629_0552036 Ga0495629_0552036_146_604 152
943 3300046460 Ga0495638_0006568 Ga0495638_0006568_7604_8062 152
944 3300046461 Ga0495641_0012345 Ga0495641_0012345_2847_3305 152
945 3300046462 Ga0495651_0013214 Ga0495651_0013214_1699_2157 152
946 3300046463 Ga0495653_0032148 Ga0495653_0032148_2376_2834 152
947 3300046463 Ga0495653_0064837 Ga0495653_0064837_787_1245 152
948 3300046463 Ga0495653_0110614 Ga0495653_0110614_42_509 152
949 3300046463 Ga0495653_0145368 Ga0495653_0145368_148_606 152
950 3300046463 Ga0495653_0154177 Ga0495653_0154177_260_718 152
951 3300046471 Ga0495650_0011835 Ga0495650_0011835_3797_4255 152
952 3300046471 Ga0495650_0060376 Ga0495650_0060376_771_1229 152
953 3300046472 Ga0495580_0000142 Ga0495580_0000142_420_878 152
954 3300046472 Ga0495580_0000495 Ga0495580_0000495_1816_2274 152
955 3300046472 Ga0495580_0034264 Ga0495580_0034264_2104_2562 152
956 3300046472 Ga0495580_0099569 Ga0495580_0099569_898_1356 152
957 3300046472 Ga0495580_0141534 Ga0495580_0141534_1116_1574 152
958 3300046472 Ga0495580_0201356 Ga0495580_0201356_713_1171 152
959 3300046472 Ga0495580_0245885 Ga0495580_0245885_566_1024 152
960 3300046472 Ga0495580_0290474 Ga0495580_0290474_628_1086 152
961 3300046473 Ga0495582_0015769 Ga0495582_0015769_3494_3961 152
962 3300046473 Ga0495582_0019877 Ga0495582_0019877_1891_2349 152
963 3300046473 Ga0495582_0114894 Ga0495582_0114894_339_797 152
964 3300046476 Ga0495662_0048379 Ga0495662_0048379_792_1250 152
965 3300046477 Ga0495664_0000149 Ga0495664_0000149_6917_7375 152
966 3300046477 Ga0495664_0006570 Ga0495664_0006570_4973_5440 152
967 3300046477 Ga0495664_0013453 Ga0495664_0013453_1933_2391 152
968 3300046477 Ga0495664_0624366 Ga0495664_0624366_128_586 152
969 3300046500 Ga0495596_0030259 Ga0495596_0030259_1287_1745 152
970 3300046501 Ga0495607_0325571 Ga0495607_0325571_107_565 152
971 3300046506 Ga0495583_0002966 Ga0495583_0002966_6528_6986 152
972 3300046506 Ga0495583_0040051 Ga0495583_0040051_340_798 152
973 3300046507 Ga0495606_0008201 Ga0495606_0008201_7011_7469 152
974 3300046507 Ga0495606_0062041 Ga0495606_0062041_1747_2214 152
975 3300046514 Ga0495618_0012638 Ga0495618_0012638_3167_3625 152
976 3300046514 Ga0495618_0075319 Ga0495618_0075319_309_776 152
977 3300046516 Ga0495628_0019740 Ga0495628_0019740_62_520 152
978 3300046516 Ga0495628_0032491 Ga0495628_0032491_2336_2794 152
979 3300046516 Ga0495628_0047551 Ga0495628_0047551_375_833 152
980 3300046516 Ga0495628_0122346 Ga0495628_0122346_1305_1763 152
981 3300046516 Ga0495628_0162264 Ga0495628_0162264_840_1298 152
982 3300046516 Ga0495628_0288253 Ga0495628_0288253_709_1176 152
983 3300046516 Ga0495628_0535227 Ga0495628_0535227_29_496 152
984 3300046517 Ga0495630_0020639 Ga0495630_0020639_3814_4272 152
985 3300046517 Ga0495630_0028929 Ga0495630_0028929_529_996 152
986 3300046517 Ga0495630_0083495 Ga0495630_0083495_1829_2287 152
987 3300046524 Ga0495648_0003737 Ga0495648_0003737_5920_6378 152
988 3300046524 Ga0495648_0007144 Ga0495648_0007144_6004_6462 152
989 3300046524 Ga0495648_0007593 Ga0495648_0007593_5163_5621 152
990 3300046524 Ga0495648_0094444 Ga0495648_0094444_196_654 152
991 3300046526 Ga0495666_0001598 Ga0495666_0001598_5719_6177 152
992 3300046526 Ga0495666_0075413 Ga0495666_0075413_906_1364 152
993 3300046528 Ga0495642_0007805 Ga0495642_0007805_227_685 152
994 3300046529 Ga0495652_0008580 Ga0495652_0008580_7502_7960 152
995 3300046529 Ga0495652_0010563 Ga0495652_0010563_1974_2432 152
996 3300046529 Ga0495652_0039526 Ga0495652_0039526_2102_2560 152
997 3300046529 Ga0495652_0513060 Ga0495652_0513060_71_538 152
998 3300046531 Ga0495665_0006558 Ga0495665_0006558_1180_1638 152
999 3300046531 Ga0495665_0096230 Ga0495665_0096230_306_764 152
1000 3300046531 Ga0495665_0225943 Ga0495665_0225943_396_854 152
1001 3300046531 Ga0495665_0440500 Ga0495665_0440500_24_482 152
1002 3300046531 Ga0495665_0524614 Ga0495665_0524614_116_583 152
1003 3300046533 Ga0495640_0009773 Ga0495640_0009773_6499_6966 152
1004 3300046533 Ga0495640_0031297 Ga0495640_0031297_2656_3114 152
1005 3300046535 Ga0495586_0034012 Ga0495586_0034012_1099_1557 152
1006 3300046535 Ga0495586_0196004 Ga0495586_0196004_284_742 152
1007 3300046536 Ga0495587_0001137 Ga0495587_0001137_11530_11988 152
1008 3300046543 Ga0495645_0005083 Ga0495645_0005083_4680_5138 152
1009 3300046543 Ga0495645_0023662 Ga0495645_0023662_3291_3749 152
1010 3300046543 Ga0495645_0307709 Ga0495645_0307709_65_523 152
1011 3300046543 Ga0495645_0510483 Ga0495645_0510483_63_521 152
1012 3300046642 Ga0495634_0002825 Ga0495634_0002825_6791_7249 152
1013 3300046642 Ga0495634_0076659 Ga0495634_0076659_1192_1659 152
1014 3300046663 Ga0495635_0000635 Ga0495635_0000635_1544_2002 152
1015 3300046663 Ga0495635_0814476 Ga0495635_0814476_18_476 152
1016 3300046663 Ga0495635_0992851 Ga0495635_0992851_42_509 152
1017 3300046674 Ga0495588_0015467 Ga0495588_0015467_1255_1713 152
1018 3300046678 Ga0495599_0010543 Ga0495599_0010543_4581_5039 152
1019 3300046678 Ga0495599_0092709 Ga0495599_0092709_376_834 152
1020 3300046679 Ga0495623_0043618 Ga0495623_0043618_914_1372 152
1021 3300046679 Ga0495623_0095104 Ga0495623_0095104_192_659 152
1022 3300046679 Ga0495623_0132150 Ga0495623_0132150_315_773 152
1023 3300046679 Ga0495623_0599511 Ga0495623_0599511_74_532 152
1024 3300046680 Ga0495646_0002054 Ga0495646_0002054_5957_6415 152
1025 3300046680 Ga0495646_0087347 Ga0495646_0087347_178_645 152
1026 3300046680 Ga0495646_0167769 Ga0495646_0167769_436_894 152
1027 3300046680 Ga0495646_0223546 Ga0495646_0223546_34_492 152
1028 3300046680 Ga0495646_0563475 Ga0495646_0563475_33_491 152
1029 3300046689 Ga0495613_0006353 Ga0495613_0006353_2101_2559 152
1030 3300046690 Ga0495624_0000416 Ga0495624_0000416_2403_2861 152
1031 3300046690 Ga0495624_0011083 Ga0495624_0011083_262_720 152
1032 3300046690 Ga0495624_0031482 Ga0495624_0031482_1292_1750 152
1033 3300046690 Ga0495624_0216162 Ga0495624_0216162_137_604 152
1034 3300046692 Ga0495671_0011589 Ga0495671_0011589_1232_1690 152
1035 3300046694 Ga0495649_0006208 Ga0495649_0006208_1821_2279 152
1036 3300046694 Ga0495649_0008319 Ga0495649_0008319_405_863 152
1037 3300046694 Ga0495649_0038208 Ga0495649_0038208_1589_2056 152
1038 3300046694 Ga0495649_0264115 Ga0495649_0264115_218_685 152
1039 3300047315 Ga0495581_0002468 Ga0495581_0002468_6641_7099 152
1040 3300047315 Ga0495581_0024077 Ga0495581_0024077_1097_1555 152
1041 3300047317 Ga0495604_0011020 Ga0495604_0011020_5829_6287 152
1042 3300047317 Ga0495604_0014111 Ga0495604_0014111_359_826 152
1043 3300047317 Ga0495604_0056243 Ga0495604_0056243_1916_2374 152
1044 3300047317 Ga0495604_0332872 Ga0495604_0332872_390_848 152
1045 3300047319 Ga0495674_0007725 Ga0495674_0007725_5055_5513 152
1046 3300047319 Ga0495674_0010470 Ga0495674_0010470_1340_1798 152
1047 3300047319 Ga0495674_0014141 Ga0495674_0014141_4631_5089 152
1048 3300047319 Ga0495674_0017052 Ga0495674_0017052_3727_4185 152
1049 3300047319 Ga0495674_0116308 Ga0495674_0116308_1646_2104 152
1050 3300047319 Ga0495674_0126356 Ga0495674_0126356_691_1149 152
1051 3300047319 Ga0495674_0818369 Ga0495674_0818369_207_665 152
1052 3300047320 Ga0495672_0006413 Ga0495672_0006413_7670_8128 152
1053 3300047320 Ga0495672_0016206 Ga0495672_0016206_3393_3851 152
1054 3300047320 Ga0495672_0025309 Ga0495672_0025309_452_910 152
1055 3300047320 Ga0495672_0167347 Ga0495672_0167347_479_937 152
1056 3300047321 Ga0495676_0009149 Ga0495676_0009149_4392_4850 152
1057 3300047321 Ga0495676_0212051 Ga0495676_0212051_18_476 152
1058 3300047321 Ga0495676_0257393 Ga0495676_0257393_680_1147 152
1059 3300047322 Ga0495680_0009118 Ga0495680_0009118_5889_6347 152
1060 3300047322 Ga0495680_0098131 Ga0495680_0098131_550_1008 152
1061 3300047322 Ga0495680_0146979 Ga0495680_0146979_787_1245 152
1062 3300047322 Ga0495680_0317619 Ga0495680_0317619_175_642 152
1063 3300047322 Ga0495680_0400765 Ga0495680_0400765_301_759 152
1064 3300047323 Ga0495683_0003326 Ga0495683_0003326_3762_4220 152
1065 3300047323 Ga0495683_0152303 Ga0495683_0152303_558_1016 152
1066 3300047443 Ga0495687_000207 Ga0495687_000207_66160_66627 152
1067 3300047443 Ga0495687_163490 Ga0495687_163490_65_523 152
1068 3300047444 Ga0495675_0007904 Ga0495675_0007904_932_1390 152
1069 3300047444 Ga0495675_0089483 Ga0495675_0089483_152_610 152
1070 3300047444 Ga0495675_0240245 Ga0495675_0240245_558_1025 152
1071 3300047446 Ga0495679_000103 Ga0495679_000103_65718_66176 152
1072 3300047446 Ga0495679_003183 Ga0495679_003183_2409_2867 152
1073 3300047446 Ga0495679_024465 Ga0495679_024465_1283_1741 152
1074 3300047469 Ga0495673_0089393 Ga0495673_0089393_477_935 152
1075 3300047470 Ga0495681_0019317 Ga0495681_0019317_191_649 152
1076 3300047673 Ga0495593_0007253 Ga0495593_0007253_2391_2849 152
1077 3300047673 Ga0495593_0012829 Ga0495593_0012829_602_1060 152
1078 3300047673 Ga0495593_0016859 Ga0495593_0016859_3310_3777 152
1079 3300048088 Ga0495602_0011434 Ga0495602_0011434_4626_5084 152
1080 3300048088 Ga0495602_0245692 Ga0495602_0245692_591_1058 152
1081 3300048088 Ga0495602_0436685 Ga0495602_0436685_372_830 152
1082 3300048088 Ga0495602_0473077 Ga0495602_0473077_329_787 152
1083 3300048089 Ga0495614_0015565 Ga0495614_0015565_1759_2217 152
1084 3300048091 Ga0495626_0005595 Ga0495626_0005595_4390_4848 152
1085 3300048903 Ga0496100_0002550 Ga0496100_0002550_8221_8679 152
1086 3300048904 Ga0496101_0002228 Ga0496101_0002228_89_547 152
1087 3300048904 Ga0496101_0269745 Ga0496101_0269745_847_1305 152
1088 3300048905 Ga0496102_0000247 Ga0496102_0000247_8055_8513 152
1089 3300048905 Ga0496102_0357330 Ga0496102_0357330_413_871 152
1090 3300048905 Ga0496102_0765825 Ga0496102_0765825_126_584 152
1091 3300048906 Ga0496103_0000278 Ga0496103_0000278_43777_44235 152
1092 3300048906 Ga0496103_0674933 Ga0496103_0674933_109_567 152
1093 3300048907 Ga0496104_0012686 Ga0496104_0012686_6709_7167 152
1094 3300048907 Ga0496104_0442682 Ga0496104_0442682_357_815 152
1095 3300048907 Ga0496104_0841253 Ga0496104_0841253_76_540 152
1096 3300048908 Ga0496105_0193414 Ga0496105_0193414_623_1081 152
1097 3300048908 Ga0496105_0333670 Ga0496105_0333670_128_586 152
1098 3300048912 Ga0496109_0253568 Ga0496109_0253568_80_550 152
1099 3300048912 Ga0496109_1580520 Ga0496109_1580520_52_510 152
1100 3300048913 Ga0496110_0855295 Ga0496110_0855295_117_587 152
1101 3300048915 Ga0496112_0969349 Ga0496112_0969349_85_549 152
1102 3300048916 Ga0496113_0247667 Ga0496113_0247667_390_848 152
1103 3300048916 Ga0496113_0877810 Ga0496113_0877810_163_621 152
1104 3300048917 Ga0496114_0049041 Ga0496114_0049041_777_1235 152
1105 3300048917 Ga0496114_0921698 Ga0496114_0921698_147_605 152
1106 3300048919 Ga0496116_0077471 Ga0496116_0077471_100_564 152
1107 3300048919 Ga0496116_0261687 Ga0496116_0261687_82_546 152
1108 3300048920 Ga0496117_0000445 Ga0496117_0000445_8242_8700 152
1109 3300048920 Ga0496117_0028196 Ga0496117_0028196_929_1387 152
1110 3300048920 Ga0496117_0077015 Ga0496117_0077015_257_721 152
1111 3300048921 Ga0496118_0000138 Ga0496118_0000138_51196_51654 152
1112 3300048921 Ga0496118_0088277 Ga0496118_0088277_827_1285 152
1113 3300048921 Ga0496118_0201297 Ga0496118_0201297_24_485 152
1114 3300048921 Ga0496118_0283728 Ga0496118_0283728_244_711 152
1115 3300048921 Ga0496118_0319804 Ga0496118_0319804_163_627 152
1116 3300048924 Ga0496121_0001530 Ga0496121_0001530_477_941 152
1117 3300048924 Ga0496121_0007122 Ga0496121_0007122_603_1061 152
1118 3300048924 Ga0496121_0009428 Ga0496121_0009428_603_1061 152
1119 3300048925 Ga0496122_0096052 Ga0496122_0096052_168_632 152
1120 3300048925 Ga0496122_0125380 Ga0496122_0125380_970_1428 152
1121 3300048926 Ga0496123_0167325 Ga0496123_0167325_213_671 152
1122 3300048929 Ga0496126_0001647 Ga0496126_0001647_29965_30423 152
1123 3300048929 Ga0496126_0198850 Ga0496126_0198850_415_873 152
1124 3300049460 Ga0495682_0003881 Ga0495682_0003881_5607_6065 152
1125 3300049460 Ga0495682_0049284 Ga0495682_0049284_552_1010 152
1126 3300050493 nmdc:mga0k408_18508_c1 nmdc:mga0k408_18508_c1_2483_2968 152
1127 3300050493 nmdc:mga0k408_36108_c1 nmdc:mga0k408_36108_c1_1829_2287 152
1128 3300050493 nmdc:mga0k408_637108_c1 nmdc:mga0k408_637108_c1_82_540 152
1129 3300050495 nmdc:mga04h51_173348_c1 nmdc:mga04h51_173348_c1_219_704 152
1130 3300050496 nmdc:mga07m45_26187_c1 nmdc:mga07m45_26187_c1_113_571 152
1131 3300050510 nmdc:mga06r32_1022248_c1 nmdc:mga06r32_1022248_c1_221_688 152
1132 3300050512 nmdc:mga0n895_445597_c1 nmdc:mga0n895_445597_c1_162_632 152
1133 3300053094 Ga0500566_0142346 Ga0500566_0142346_302_793 152
1134 3300053100 Ga0500660_054333 Ga0500660_054333_477_959 152
1135 3300053136 Ga0500559_0096536 Ga0500559_0096536_644_1123 152
1136 3300059477 Ga0587084_001920 Ga0587084_001920_865_1323 152
1137 3300059477 Ga0587084_003128 Ga0587084_003128_825_1283 152
1138 3300059477 Ga0587084_040228 Ga0587084_040228_278_736 152
1139 3300059505 Ga0587083_0016341 Ga0587083_0016341_687_1145 152
1140 3300059510 Ga0587090_001520 Ga0587090_001520_865_1323 152
1141 3300059510 Ga0587090_002110 Ga0587090_002110_1506_1964 152
1142 3300059510 Ga0587090_007688 Ga0587090_007688_780_1238 152
1143 3300059510 Ga0587090_017945 Ga0587090_017945_90_548 152
1144 3300059513 Ga0587094_019363 Ga0587094_019363_169_627 152
1145 3300059623 Ga0587101_018139 Ga0587101_018139_341_799 152
1146 3300059640 Ga0587067_008178 Ga0587067_008178_224_682 152
1147 3300059641 Ga0587068_008866 Ga0587068_008866_162_620 152
1148 3300059643 Ga0587072_011558 Ga0587072_011558_63_521 152
1149 3300059645 Ga0587076_012201 Ga0587076_012201_149_607 152
1150 3300059651 Ga0587105_001077 Ga0587105_001077_724_1182 152
1151 3300060346 Ga0587111_0012970 Ga0587111_0012970_308_766 152
1152 3300060346 Ga0587111_0020665 Ga0587111_0020665_32_490 152
1153 3300060346 Ga0587111_0024244 Ga0587111_0024244_215_673 152
1154 3300061719 Ga0466962_0001661 Ga0466962_0001661_4664_5125 152
1155 3300061719 Ga0466962_0004649 Ga0466962_0004649_2974_3432 152
1156 3300061719 Ga0466962_0011849 Ga0466962_0011849_3181_3639 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

10

122

0.92

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

11

138

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cpg-assembly1.cif.gz_B r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form 0.8935 7 148
4ffu-assembly2.cif.gz_K crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021 0.8851 4 147
4ffu-assembly2.cif.gz_K crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021 0.879 4 147
4ffu-assembly1.cif.gz_D crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021 0.8785 4 149
3exz-assembly1.cif.gz_A crystal structure of the maoc-like dehydratase from rhodospirillum rubrum. northeast structural genomics consortium target rrr103a. 0.8764 6 149
ID Description Score Start End Superfamily
1z54D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9081 81 144 3.10.129.10
4ffuI00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9031 4 149 3.10.129.10
5cpgB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8935 7 148 3.10.129.10
af_Q9W440_48_153_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8899 81 145 3.10.129.10
af_I6Y9H2_24_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8856 1 148 3.10.129.10
ID Description Score Start End GO Terms
AF-A2WH49-F1-model_v4 deleted 0.9683 1 152
AF-A2WH49-F1-model_v4 deleted 0.9622 1 152
AF-A0A0N0ZBV9-F1-model_v4 deleted 0.9584 1 152
AF-A0A7W9TR50-F1-model_v4 Acyl dehydratase 0.9493 2 152
AF-A0A840Y4M6-F1-model_v4 Acyl dehydratase 0.9476 4 147

Feature Viewer

pLDDT pTM Quality
95.15 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map