F490540
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1130 | 327 | 2260 | 166 |
Family's Representative Sequence
| Representative Sequence | 3300050514|nmdc:mga08x19_185444_c1|nmdc:mga08x19_185444_c1_595_1299 |
| Length | 200 |
| Sequence | MVSAVNLASAEAAKWRRSFLYNYESLNVWSCHGPTLERAMAVSGMGGNPALRDIHTQLKNRMDKAVGDFRTSLLSTRTGRASVHMVDSIRVPYYGSEMPLNQIAQVHAPEAQLITVQPFDPSSLAEIEKALRTSDMGFNPQNDGKLIRIPIPPLTEERRKELVKHLHKVLEEHRTAIRNVRRDGNDLIKKALKDKKISQV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 126 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 128 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 129 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 130 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 131 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 205 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 206 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 208 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 210 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 211 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 216 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 217 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 218 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 219 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 220 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 221 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 222 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 223 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 232 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 233 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 238 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 239 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 240 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 243 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 244 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 245 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 246 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 247 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 248 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 249 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 250 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 251 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 252 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 253 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 254 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 255 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 256 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 257 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 258 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 300 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 301 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 302 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 303 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 304 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 307 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 308 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 309 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 310 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 311 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 313 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 314 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 315 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 316 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 317 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.85 |
| Metatranscriptomes | 1.15 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.09 |
| Nodule | 0 |
| Rhizoplane | 4.42 |
| Rhizosphere | 94.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga08x19_185444_c1 | 3300050514 | Unclassified | 1422 |
| 2 | MRS1b_contig_2926443 | 2162886011 | Bacteria | 878 |
| 3 | JGI24752J21851_1004409 | 3300001976 | Bacteria | 1845 |
| 4 | JGI24737J22298_10021840 | 3300001990 | Bacteria | 2036 |
| 5 | JGI24034J26672_10009286 | 3300002239 | Bacteria | 1449 |
| 6 | JGI24751J29686_10000539 | 3300002459 | Bacteria | 10617 |
| 7 | rootH2_10166807 | 3300003320 | Bacteria | 1253 |
| 8 | rootH1_10207098 | 3300003323 | Bacteria | 2296 |
| 9 | Ga0058863_10015630 | 3300004799 | Bacteria | 1580 |
| 10 | Ga0058861_11818347 | 3300004800 | Bacteria | 886 |
| 11 | Ga0058862_12695550 | 3300004803 | Bacteria | 1490 |
| 12 | Ga0065712_10073970 | 3300005290 | Bacteria | 4223 |
| 13 | Ga0065712_10097702 | 3300005290 | Bacteria | 2142 |
| 14 | Ga0065715_10155513 | 3300005293 | Bacteria | 1682 |
| 15 | Ga0065715_10181645 | 3300005293 | Bacteria | 1472 |
| 16 | Ga0070658_10023393 | 3300005327 | Bacteria | 4960 |
| 17 | Ga0070683_100022906 | 3300005329 | Bacteria | 5584 |
| 18 | Ga0070683_100043047 | 3300005329 | Bacteria | 4160 |
| 19 | Ga0070683_100109812 | 3300005329 | Bacteria | 2601 |
| 20 | Ga0070683_100338193 | 3300005329 | Unclassified | 1433 |
| 21 | Ga0070690_100807264 | 3300005330 | Bacteria | 728 |
| 22 | Ga0070670_100006314 | 3300005331 | Bacteria | 10035 |
| 23 | Ga0070670_100215766 | 3300005331 | Bacteria | 1669 |
| 24 | Ga0070670_100264093 | 3300005331 | Bacteria | 1501 |
| 25 | Ga0070677_10001451 | 3300005333 | Bacteria | 7507 |
| 26 | Ga0068869_100026030 | 3300005334 | Bacteria | 4068 |
| 27 | Ga0068869_100031914 | 3300005334 | Bacteria | 3709 |
| 28 | Ga0068869_100226036 | 3300005334 | Bacteria | 1485 |
| 29 | Ga0070666_10016274 | 3300005335 | Bacteria | 4756 |
| 30 | Ga0070666_10211616 | 3300005335 | Bacteria | 1365 |
| 31 | Ga0070680_100010401 | 3300005336 | Bacteria | 7173 |
| 32 | Ga0070680_100018751 | 3300005336 | Bacteria | 5475 |
| 33 | Ga0070680_100070274 | 3300005336 | Unclassified | 2876 |
| 34 | Ga0070680_100427872 | 3300005336 | Unclassified | 1129 |
| 35 | Ga0070680_100880513 | 3300005336 | Bacteria | 772 |
| 36 | Ga0070682_100044123 | 3300005337 | Bacteria | 2760 |
| 37 | Ga0068868_100000808 | 3300005338 | Bacteria | 21230 |
| 38 | Ga0068868_100012242 | 3300005338 | Bacteria | 6267 |
| 39 | Ga0068868_100019290 | 3300005338 | Bacteria | 5109 |
| 40 | Ga0068868_100041359 | 3300005338 | Bacteria | 3591 |
| 41 | Ga0068868_100055888 | 3300005338 | Bacteria | 3116 |
| 42 | Ga0068868_100069378 | 3300005338 | Bacteria | 2809 |
| 43 | Ga0068868_100170325 | 3300005338 | Bacteria | 1802 |
| 44 | Ga0070660_100000311 | 3300005339 | Bacteria | 32366 |
| 45 | Ga0070660_100003019 | 3300005339 | Bacteria | 11586 |
| 46 | Ga0070660_100634285 | 3300005339 | Bacteria | 894 |
| 47 | Ga0070689_100026004 | 3300005340 | Bacteria | 4402 |
| 48 | Ga0070689_100288435 | 3300005340 | Bacteria | 1363 |
| 49 | Ga0070691_10021433 | 3300005341 | Bacteria | 2990 |
| 50 | Ga0070687_100073980 | 3300005343 | Bacteria | 1838 |
| 51 | Ga0070687_100186609 | 3300005343 | Bacteria | 1246 |
| 52 | Ga0070661_100098261 | 3300005344 | Bacteria | 2174 |
| 53 | Ga0070661_101025100 | 3300005344 | Unclassified | 685 |
| 54 | Ga0070668_100232715 | 3300005347 | Bacteria | 1524 |
| 55 | Ga0070669_100159173 | 3300005353 | Unclassified | 1753 |
| 56 | Ga0070669_100773762 | 3300005353 | Bacteria | 814 |
| 57 | Ga0070675_100009309 | 3300005354 | Bacteria | 7638 |
| 58 | Ga0070675_100249752 | 3300005354 | Bacteria | 1552 |
| 59 | Ga0070671_100004796 | 3300005355 | Bacteria | 10751 |
| 60 | Ga0070671_100068392 | 3300005355 | Unclassified | 2962 |
| 61 | Ga0070671_100125778 | 3300005355 | Bacteria | 2158 |
| 62 | Ga0070671_101134108 | 3300005355 | Bacteria | 687 |
| 63 | Ga0070673_100195577 | 3300005364 | Bacteria | 1739 |
| 64 | Ga0070673_101084975 | 3300005364 | Bacteria | 747 |
| 65 | Ga0070688_100000311 | 3300005365 | Bacteria | 24808 |
| 66 | Ga0070659_100005680 | 3300005366 | Bacteria | 8973 |
| 67 | Ga0070659_100025393 | 3300005366 | Bacteria | 4550 |
| 68 | Ga0070659_100071192 | 3300005366 | Bacteria | 2764 |
| 69 | Ga0070709_10003427 | 3300005434 | Bacteria | 8506 |
| 70 | Ga0070709_10003845 | 3300005434 | Bacteria | 8089 |
| 71 | Ga0070709_10055665 | 3300005434 | Bacteria | 2498 |
| 72 | Ga0070709_10145981 | 3300005434 | Bacteria | 1630 |
| 73 | Ga0070709_10226109 | 3300005434 | Bacteria | 1337 |
| 74 | Ga0070709_10320656 | 3300005434 | Bacteria | 1137 |
| 75 | Ga0070709_10508593 | 3300005434 | Bacteria | 916 |
| 76 | Ga0070709_10563513 | 3300005434 | Bacteria | 873 |
| 77 | Ga0070709_10678442 | 3300005434 | Viruses | 800 |
| 78 | Ga0070714_100001016 | 3300005435 | Bacteria | 20051 |
| 79 | Ga0070714_100025849 | 3300005435 | Bacteria | 4849 |
| 80 | Ga0070714_100044070 | 3300005435 | Bacteria | 3776 |
| 81 | Ga0070714_100052502 | 3300005435 | Bacteria | 3477 |
| 82 | Ga0070714_100219435 | 3300005435 | Unclassified | 1747 |
| 83 | Ga0070714_100229763 | 3300005435 | Bacteria | 1708 |
| 84 | Ga0070714_100246563 | 3300005435 | Bacteria | 1650 |
| 85 | Ga0070714_100379295 | 3300005435 | Bacteria | 1333 |
| 86 | Ga0070714_100384918 | 3300005435 | Bacteria | 1323 |
| 87 | Ga0070714_100529095 | 3300005435 | Bacteria | 1127 |
| 88 | Ga0070714_100674479 | 3300005435 | Unclassified | 996 |
| 89 | Ga0070714_101031488 | 3300005435 | Bacteria | 801 |
| 90 | Ga0070714_101033029 | 3300005435 | Bacteria | 800 |
| 91 | Ga0070714_101548597 | 3300005435 | Unclassified | 647 |
| 92 | Ga0070713_100000460 | 3300005436 | Bacteria | 26005 |
| 93 | Ga0070713_100000863 | 3300005436 | Bacteria | 19392 |
| 94 | Ga0070713_100009985 | 3300005436 | Bacteria | 6839 |
| 95 | Ga0070713_100012863 | 3300005436 | Bacteria | 6156 |
| 96 | Ga0070713_100022236 | 3300005436 | Bacteria | 4897 |
| 97 | Ga0070713_100035831 | 3300005436 | Bacteria | 3998 |
| 98 | Ga0070713_100047278 | 3300005436 | Unclassified | 3536 |
| 99 | Ga0070713_100055567 | 3300005436 | Bacteria | 3290 |
| 100 | Ga0070713_100083204 | 3300005436 | Unclassified | 2735 |
| 101 | Ga0070713_100104832 | 3300005436 | Bacteria | 2455 |
| 102 | Ga0070713_100121693 | 3300005436 | Bacteria | 2290 |
| 103 | Ga0070713_100219920 | 3300005436 | Bacteria | 1722 |
| 104 | Ga0070713_100231593 | 3300005436 | Bacteria | 1679 |
| 105 | Ga0070713_100235254 | 3300005436 | Bacteria | 1666 |
| 106 | Ga0070713_100244780 | 3300005436 | Unclassified | 1634 |
| 107 | Ga0070713_100306328 | 3300005436 | Bacteria | 1464 |
| 108 | Ga0070713_100372196 | 3300005436 | Bacteria | 1329 |
| 109 | Ga0070713_100407609 | 3300005436 | Bacteria | 1270 |
| 110 | Ga0070713_100413271 | 3300005436 | Bacteria | 1262 |
| 111 | Ga0070713_100453431 | 3300005436 | Bacteria | 1205 |
| 112 | Ga0070713_100485707 | 3300005436 | Bacteria | 1164 |
| 113 | Ga0070710_10007216 | 3300005437 | Bacteria | 5371 |
| 114 | Ga0070710_10110128 | 3300005437 | Bacteria | 1653 |
| 115 | Ga0070710_10190600 | 3300005437 | Bacteria | 1289 |
| 116 | Ga0070710_10267437 | 3300005437 | Bacteria | 1104 |
| 117 | Ga0070711_100000656 | 3300005439 | Bacteria | 18067 |
| 118 | Ga0070711_100022448 | 3300005439 | Unclassified | 4091 |
| 119 | Ga0070711_100063439 | 3300005439 | Bacteria | 2579 |
| 120 | Ga0070711_100089520 | 3300005439 | Bacteria | 2214 |
| 121 | Ga0070711_100128912 | 3300005439 | Bacteria | 1881 |
| 122 | Ga0070711_100394033 | 3300005439 | Bacteria | 1122 |
| 123 | Ga0070711_100953105 | 3300005439 | Bacteria | 734 |
| 124 | Ga0070708_100002306 | 3300005445 | Bacteria | 14779 |
| 125 | Ga0070708_100022528 | 3300005445 | Bacteria | 5344 |
| 126 | Ga0070708_100038532 | 3300005445 | Bacteria | 4176 |
| 127 | Ga0070708_100074972 | 3300005445 | Bacteria | 3053 |
| 128 | Ga0070708_100120276 | 3300005445 | Unclassified | 2422 |
| 129 | Ga0070708_100487318 | 3300005445 | Bacteria | 1163 |
| 130 | Ga0070708_100845443 | 3300005445 | Unclassified | 860 |
| 131 | Ga0070663_100176318 | 3300005455 | Bacteria | 1655 |
| 132 | Ga0070678_100237862 | 3300005456 | Bacteria | 1521 |
| 133 | Ga0070678_100321402 | 3300005456 | Unclassified | 1322 |
| 134 | Ga0070662_100057613 | 3300005457 | Bacteria | 2823 |
| 135 | Ga0070662_100950663 | 3300005457 | Bacteria | 734 |
| 136 | Ga0070681_10000304 | 3300005458 | Bacteria | 39863 |
| 137 | Ga0070681_10000804 | 3300005458 | Bacteria | 26179 |
| 138 | Ga0070681_10012167 | 3300005458 | Bacteria | 8536 |
| 139 | Ga0070681_10031578 | 3300005458 | Bacteria | 5316 |
| 140 | Ga0070681_10041573 | 3300005458 | Bacteria | 4607 |
| 141 | Ga0070681_10056600 | 3300005458 | Bacteria | 3902 |
| 142 | Ga0070681_10175459 | 3300005458 | Bacteria | 2065 |
| 143 | Ga0070681_10208763 | 3300005458 | Bacteria | 1869 |
| 144 | Ga0070681_10213647 | 3300005458 | Bacteria | 1845 |
| 145 | Ga0070681_10317009 | 3300005458 | Bacteria | 1469 |
| 146 | Ga0070681_10393837 | 3300005458 | Bacteria | 1296 |
| 147 | Ga0070681_10507145 | 3300005458 | Bacteria | 1120 |
| 148 | Ga0070681_10612933 | 3300005458 | Bacteria | 1003 |
| 149 | Ga0068867_100073940 | 3300005459 | Bacteria | 2553 |
| 150 | Ga0068867_100254141 | 3300005459 | Bacteria | 1430 |
| 151 | Ga0068867_100949769 | 3300005459 | Bacteria | 776 |
| 152 | Ga0070706_100001345 | 3300005467 | Bacteria | 26134 |
| 153 | Ga0070706_100001630 | 3300005467 | Bacteria | 23404 |
| 154 | Ga0070706_100005850 | 3300005467 | Bacteria | 11665 |
| 155 | Ga0070706_100006393 | 3300005467 | Bacteria | 11134 |
| 156 | Ga0070706_100020891 | 3300005467 | Bacteria | 6028 |
| 157 | Ga0070706_100342903 | 3300005467 | Bacteria | 1393 |
| 158 | Ga0070707_100001066 | 3300005468 | Bacteria | 27046 |
| 159 | Ga0070707_100003999 | 3300005468 | Bacteria | 13875 |
| 160 | Ga0070707_100021280 | 3300005468 | Bacteria | 6130 |
| 161 | Ga0070707_100028348 | 3300005468 | Bacteria | 5329 |
| 162 | Ga0070707_100158512 | 3300005468 | Bacteria | 2205 |
| 163 | Ga0070707_100164194 | 3300005468 | Bacteria | 2164 |
| 164 | Ga0070707_100288346 | 3300005468 | Unclassified | 1595 |
| 165 | Ga0070707_100338552 | 3300005468 | Bacteria | 1462 |
| 166 | Ga0070707_100596575 | 3300005468 | Bacteria | 1067 |
| 167 | Ga0070698_100000247 | 3300005471 | Bacteria | 54164 |
| 168 | Ga0070698_100001098 | 3300005471 | Bacteria | 29768 |
| 169 | Ga0070698_100020529 | 3300005471 | Bacteria | 6926 |
| 170 | Ga0070698_100105362 | 3300005471 | Bacteria | 2790 |
| 171 | Ga0070698_100709849 | 3300005471 | Bacteria | 948 |
| 172 | Ga0070699_100002044 | 3300005518 | Bacteria | 18236 |
| 173 | Ga0070699_100004004 | 3300005518 | Bacteria | 13020 |
| 174 | Ga0070699_100023250 | 3300005518 | Bacteria | 5339 |
| 175 | Ga0070699_100027660 | 3300005518 | Bacteria | 4890 |
| 176 | Ga0070699_100877918 | 3300005518 | Bacteria | 821 |
| 177 | Ga0070679_100014420 | 3300005530 | Bacteria | 7591 |
| 178 | Ga0070679_100024151 | 3300005530 | Bacteria | 5956 |
| 179 | Ga0070679_100067059 | 3300005530 | Bacteria | 3578 |
| 180 | Ga0070679_100312675 | 3300005530 | Bacteria | 1520 |
| 181 | Ga0070679_100336724 | 3300005530 | Bacteria | 1457 |
| 182 | Ga0070679_100781920 | 3300005530 | Bacteria | 898 |
| 183 | Ga0070684_100001116 | 3300005535 | Bacteria | 19277 |
| 184 | Ga0070684_100003411 | 3300005535 | Bacteria | 11927 |
| 185 | Ga0070684_100063033 | 3300005535 | Bacteria | 3248 |
| 186 | Ga0070684_100076893 | 3300005535 | Bacteria | 2947 |
| 187 | Ga0070684_100484636 | 3300005535 | Bacteria | 1145 |
| 188 | Ga0070684_100516914 | 3300005535 | Bacteria | 1106 |
| 189 | Ga0070697_100000463 | 3300005536 | Bacteria | 31115 |
| 190 | Ga0070697_100000758 | 3300005536 | Bacteria | 24138 |
| 191 | Ga0070697_100004218 | 3300005536 | Bacteria | 11012 |
| 192 | Ga0070697_100005905 | 3300005536 | Bacteria | 9451 |
| 193 | Ga0070697_100011766 | 3300005536 | Bacteria | 6845 |
| 194 | Ga0070697_100016515 | 3300005536 | Bacteria | 5807 |
| 195 | Ga0070697_100017118 | 3300005536 | Bacteria | 5703 |
| 196 | Ga0070697_100229408 | 3300005536 | Bacteria | 1583 |
| 197 | Ga0070697_100875742 | 3300005536 | Bacteria | 796 |
| 198 | Ga0068853_100029743 | 3300005539 | Unclassified | 4608 |
| 199 | Ga0068853_100078145 | 3300005539 | Bacteria | 2891 |
| 200 | Ga0068853_100208413 | 3300005539 | Unclassified | 1781 |
| 201 | Ga0068853_100365811 | 3300005539 | Bacteria | 1344 |
| 202 | Ga0070672_100004674 | 3300005543 | Bacteria | 8978 |
| 203 | Ga0070686_100059757 | 3300005544 | Bacteria | 2457 |
| 204 | Ga0070695_100264147 | 3300005545 | Bacteria | 1258 |
| 205 | Ga0070693_100023182 | 3300005547 | Bacteria | 3314 |
| 206 | Ga0070693_100035108 | 3300005547 | Bacteria | 2778 |
| 207 | Ga0070693_100051789 | 3300005547 | Bacteria | 2352 |
| 208 | Ga0070693_100396859 | 3300005547 | Bacteria | 955 |
| 209 | Ga0070693_100862530 | 3300005547 | Unclassified | 676 |
| 210 | Ga0070665_100007099 | 3300005548 | Bacteria | 11381 |
| 211 | Ga0070665_100259765 | 3300005548 | Bacteria | 1738 |
| 212 | Ga0070665_100429823 | 3300005548 | Bacteria | 1329 |
| 213 | Ga0068855_100000563 | 3300005563 | Bacteria | 45518 |
| 214 | Ga0068855_100004163 | 3300005563 | Bacteria | 17651 |
| 215 | Ga0068855_100011625 | 3300005563 | Bacteria | 10638 |
| 216 | Ga0068855_100012802 | 3300005563 | Bacteria | 10119 |
| 217 | Ga0068855_100043564 | 3300005563 | Bacteria | 5316 |
| 218 | Ga0068855_100049412 | 3300005563 | Unclassified | 4961 |
| 219 | Ga0068855_100059059 | 3300005563 | Bacteria | 4489 |
| 220 | Ga0068855_100139903 | 3300005563 | Bacteria | 2760 |
| 221 | Ga0068855_100235912 | 3300005563 | Bacteria | 2046 |
| 222 | Ga0068855_100252692 | 3300005563 | Bacteria | 1966 |
| 223 | Ga0068855_100410746 | 3300005563 | Bacteria | 1482 |
| 224 | Ga0068855_100418114 | 3300005563 | Unclassified | 1467 |
| 225 | Ga0070664_100000879 | 3300005564 | Bacteria | 23312 |
| 226 | Ga0070664_100027623 | 3300005564 | Bacteria | 4716 |
| 227 | Ga0070664_100188302 | 3300005564 | Bacteria | 1838 |
| 228 | Ga0070664_100467501 | 3300005564 | Bacteria | 1159 |
| 229 | Ga0070664_101167491 | 3300005564 | Bacteria | 726 |
| 230 | Ga0068857_100000022 | 3300005577 | Bacteria | 87864 |
| 231 | Ga0068857_100000880 | 3300005577 | Bacteria | 22656 |
| 232 | Ga0068857_100002691 | 3300005577 | Bacteria | 14592 |
| 233 | Ga0068857_100055123 | 3300005577 | Bacteria | 3528 |
| 234 | Ga0068857_100137570 | 3300005577 | Bacteria | 2206 |
| 235 | Ga0068857_100427623 | 3300005577 | Bacteria | 1235 |
| 236 | Ga0068857_100991849 | 3300005577 | Bacteria | 808 |
| 237 | Ga0068854_100009080 | 3300005578 | Bacteria | 6408 |
| 238 | Ga0068854_100058520 | 3300005578 | Bacteria | 2782 |
| 239 | Ga0068854_100428803 | 3300005578 | Bacteria | 1100 |
| 240 | Ga0068854_100583818 | 3300005578 | Bacteria | 952 |
| 241 | Ga0068856_100000448 | 3300005614 | Bacteria | 45521 |
| 242 | Ga0068856_100002645 | 3300005614 | Bacteria | 18368 |
| 243 | Ga0068856_100023133 | 3300005614 | Bacteria | 6044 |
| 244 | Ga0068856_100025330 | 3300005614 | Bacteria | 5783 |
| 245 | Ga0068856_100029764 | 3300005614 | Bacteria | 5335 |
| 246 | Ga0068856_100053508 | 3300005614 | Bacteria | 3980 |
| 247 | Ga0068856_100172826 | 3300005614 | Bacteria | 2173 |
| 248 | Ga0068856_100189611 | 3300005614 | Bacteria | 2070 |
| 249 | Ga0068856_100228017 | 3300005614 | Bacteria | 1878 |
| 250 | Ga0068856_100266573 | 3300005614 | Unclassified | 1729 |
| 251 | Ga0068856_100768003 | 3300005614 | Bacteria | 984 |
| 252 | Ga0068856_101372361 | 3300005614 | Bacteria | 721 |
| 253 | Ga0070702_100111738 | 3300005615 | Bacteria | 1695 |
| 254 | Ga0070702_100448427 | 3300005615 | Bacteria | 935 |
| 255 | Ga0070702_100570247 | 3300005615 | Bacteria | 843 |
| 256 | Ga0068852_100028082 | 3300005616 | Unclassified | 4599 |
| 257 | Ga0068852_100037467 | 3300005616 | Bacteria | 4066 |
| 258 | Ga0068852_100053376 | 3300005616 | Unclassified | 3479 |
| 259 | Ga0068852_100247218 | 3300005616 | Bacteria | 1707 |
| 260 | Ga0068859_100000885 | 3300005617 | Bacteria | 30517 |
| 261 | Ga0068859_100199301 | 3300005617 | Bacteria | 2086 |
| 262 | Ga0068864_100007383 | 3300005618 | Bacteria | 9047 |
| 263 | Ga0068864_100013662 | 3300005618 | Bacteria | 6732 |
| 264 | Ga0068864_100139812 | 3300005618 | Bacteria | 2183 |
| 265 | Ga0068864_100150760 | 3300005618 | Bacteria | 2106 |
| 266 | Ga0068864_100516958 | 3300005618 | Bacteria | 1150 |
| 267 | Ga0068866_10006754 | 3300005718 | Bacteria | 4785 |
| 268 | Ga0068866_10038191 | 3300005718 | Bacteria | 2363 |
| 269 | Ga0068866_10210292 | 3300005718 | Bacteria | 1167 |
| 270 | Ga0068866_10270163 | 3300005718 | Unclassified | 1049 |
| 271 | Ga0068861_100760985 | 3300005719 | Bacteria | 906 |
| 272 | Ga0068851_10339463 | 3300005834 | Bacteria | 872 |
| 273 | Ga0068851_10518329 | 3300005834 | Unclassified | 717 |
| 274 | Ga0068870_10000641 | 3300005840 | Bacteria | 13340 |
| 275 | Ga0068863_100012164 | 3300005841 | Bacteria | 8311 |
| 276 | Ga0068863_100037948 | 3300005841 | Bacteria | 4585 |
| 277 | Ga0068863_100082470 | 3300005841 | Bacteria | 3047 |
| 278 | Ga0068863_100253000 | 3300005841 | Bacteria | 1702 |
| 279 | Ga0068863_101040830 | 3300005841 | Bacteria | 822 |
| 280 | Ga0068858_100004455 | 3300005842 | Bacteria | 13728 |
| 281 | Ga0068858_100047139 | 3300005842 | Bacteria | 3996 |
| 282 | Ga0068858_100070184 | 3300005842 | Bacteria | 3247 |
| 283 | Ga0068860_100005346 | 3300005843 | Bacteria | 13033 |
| 284 | Ga0068860_100163095 | 3300005843 | Bacteria | 2150 |
| 285 | Ga0068860_100535099 | 3300005843 | Bacteria | 1172 |
| 286 | Ga0068862_100026563 | 3300005844 | Bacteria | 4867 |
| 287 | Ga0081540_1024261 | 3300005983 | Bacteria | 3523 |
| 288 | Ga0070717_10002868 | 3300006028 | Bacteria | 12228 |
| 289 | Ga0070717_10011716 | 3300006028 | Bacteria | 6671 |
| 290 | Ga0070717_10012576 | 3300006028 | Bacteria | 6457 |
| 291 | Ga0070717_10014948 | 3300006028 | Bacteria | 5979 |
| 292 | Ga0070717_10027218 | 3300006028 | Bacteria | 4569 |
| 293 | Ga0070717_10056258 | 3300006028 | Unclassified | 3249 |
| 294 | Ga0070717_10067301 | 3300006028 | Bacteria | 2980 |
| 295 | Ga0070717_10070734 | 3300006028 | Bacteria | 2909 |
| 296 | Ga0070717_10150529 | 3300006028 | Bacteria | 2013 |
| 297 | Ga0070717_10166834 | 3300006028 | Unclassified | 1913 |
| 298 | Ga0070717_10231654 | 3300006028 | Bacteria | 1626 |
| 299 | Ga0070717_10374817 | 3300006028 | Bacteria | 1275 |
| 300 | Ga0070717_10407691 | 3300006028 | Unclassified | 1222 |
| 301 | Ga0070717_10434388 | 3300006028 | Bacteria | 1182 |
| 302 | Ga0070717_10770460 | 3300006028 | Bacteria | 875 |
| 303 | Ga0070715_10003724 | 3300006163 | Bacteria | 4903 |
| 304 | Ga0070715_10006827 | 3300006163 | Bacteria | 3897 |
| 305 | Ga0070715_10061334 | 3300006163 | Bacteria | 1651 |
| 306 | Ga0070715_10103761 | 3300006163 | Bacteria | 1331 |
| 307 | Ga0070716_100000337 | 3300006173 | Bacteria | 18968 |
| 308 | Ga0070716_100005134 | 3300006173 | Bacteria | 6328 |
| 309 | Ga0070716_100076275 | 3300006173 | Bacteria | 1986 |
| 310 | Ga0070716_100101316 | 3300006173 | Bacteria | 1766 |
| 311 | Ga0070716_100881452 | 3300006173 | Unclassified | 699 |
| 312 | Ga0070712_100000117 | 3300006175 | Bacteria | 41403 |
| 313 | Ga0070712_100001060 | 3300006175 | Bacteria | 16615 |
| 314 | Ga0070712_100003616 | 3300006175 | Bacteria | 9531 |
| 315 | Ga0070712_100016517 | 3300006175 | Bacteria | 4770 |
| 316 | Ga0070712_100022864 | 3300006175 | Unclassified | 4122 |
| 317 | Ga0070712_100046445 | 3300006175 | Bacteria | 3002 |
| 318 | Ga0070712_100068359 | 3300006175 | Bacteria | 2531 |
| 319 | Ga0070712_100179972 | 3300006175 | Bacteria | 1647 |
| 320 | Ga0070712_100245775 | 3300006175 | Bacteria | 1427 |
| 321 | Ga0070712_100249283 | 3300006175 | Bacteria | 1418 |
| 322 | Ga0070712_100256615 | 3300006175 | Bacteria | 1399 |
| 323 | Ga0070712_100456631 | 3300006175 | Unclassified | 1065 |
| 324 | Ga0070712_100529470 | 3300006175 | Bacteria | 991 |
| 325 | Ga0070712_100688103 | 3300006175 | Unclassified | 871 |
| 326 | Ga0097621_100000279 | 3300006237 | Bacteria | 34252 |
| 327 | Ga0097621_100000712 | 3300006237 | Bacteria | 23346 |
| 328 | Ga0097621_100002496 | 3300006237 | Bacteria | 12605 |
| 329 | Ga0097621_100282120 | 3300006237 | Bacteria | 1462 |
| 330 | Ga0097621_100785347 | 3300006237 | Bacteria | 881 |
| 331 | Ga0068871_100000304 | 3300006358 | Bacteria | 34254 |
| 332 | Ga0068871_100001868 | 3300006358 | Bacteria | 14246 |
| 333 | Ga0068871_100037189 | 3300006358 | Bacteria | 3881 |
| 334 | Ga0068871_100161874 | 3300006358 | Unclassified | 1914 |
| 335 | Ga0068871_100218018 | 3300006358 | Bacteria | 1652 |
| 336 | Ga0068871_100263372 | 3300006358 | Unclassified | 1504 |
| 337 | Ga0068871_100287775 | 3300006358 | Bacteria | 1439 |
| 338 | Ga0075433_10006367 | 3300006852 | Bacteria | 9334 |
| 339 | Ga0075433_10037506 | 3300006852 | Bacteria | 4182 |
| 340 | Ga0075434_100000005 | 3300006871 | Bacteria | 104425 |
| 341 | Ga0075434_100000969 | 3300006871 | Bacteria | 23145 |
| 342 | Ga0075434_100041426 | 3300006871 | Bacteria | 4563 |
| 343 | Ga0075434_100194236 | 3300006871 | Bacteria | 2050 |
| 344 | Ga0068865_100009244 | 3300006881 | Bacteria | 6103 |
| 345 | Ga0068865_100332053 | 3300006881 | Unclassified | 1226 |
| 346 | Ga0075436_100007285 | 3300006914 | Bacteria | 7566 |
| 347 | Ga0075436_100015313 | 3300006914 | Bacteria | 5254 |
| 348 | Ga0075436_100015445 | 3300006914 | Bacteria | 5228 |
| 349 | Ga0075436_100034652 | 3300006914 | Bacteria | 3481 |
| 350 | Ga0075436_100082200 | 3300006914 | Bacteria | 2234 |
| 351 | Ga0075436_100154951 | 3300006914 | Unclassified | 1613 |
| 352 | Ga0075436_100163032 | 3300006914 | Unclassified | 1572 |
| 353 | Ga0075436_100492305 | 3300006914 | Bacteria | 896 |
| 354 | Ga0097620_100000885 | 3300006931 | Bacteria | 30517 |
| 355 | Ga0097620_100199331 | 3300006931 | Bacteria | 2086 |
| 356 | Ga0075435_100003087 | 3300007076 | Bacteria | 11241 |
| 357 | Ga0075435_100024980 | 3300007076 | Bacteria | 4645 |
| 358 | Ga0075435_100025274 | 3300007076 | Bacteria | 4622 |
| 359 | Ga0075435_100358707 | 3300007076 | Unclassified | 1250 |
| 360 | Ga0075435_100438932 | 3300007076 | Bacteria | 1125 |
| 361 | Ga0099795_10223978 | 3300007788 | Bacteria | 802 |
| 362 | Ga0105240_10002552 | 3300009093 | Bacteria | 29190 |
| 363 | Ga0105240_10007213 | 3300009093 | Bacteria | 16187 |
| 364 | Ga0105240_10059972 | 3300009093 | Bacteria | 4745 |
| 365 | Ga0105240_10087608 | 3300009093 | Unclassified | 3812 |
| 366 | Ga0105240_10164930 | 3300009093 | Bacteria | 2628 |
| 367 | Ga0105240_10216653 | 3300009093 | Bacteria | 2233 |
| 368 | Ga0105240_10447771 | 3300009093 | Bacteria | 1446 |
| 369 | Ga0105240_10659300 | 3300009093 | Bacteria | 1146 |
| 370 | Ga0105240_10686379 | 3300009093 | Unclassified | 1119 |
| 371 | Ga0105240_11160122 | 3300009093 | Bacteria | 820 |
| 372 | Ga0105240_11476431 | 3300009093 | Bacteria | 713 |
| 373 | Ga0105245_10003405 | 3300009098 | Bacteria | 14246 |
| 374 | Ga0105245_10044347 | 3300009098 | Bacteria | 3969 |
| 375 | Ga0105245_10067028 | 3300009098 | Unclassified | 3250 |
| 376 | Ga0105245_10371530 | 3300009098 | Bacteria | 1422 |
| 377 | Ga0105247_10006854 | 3300009101 | Bacteria | 7021 |
| 378 | Ga0114129_10022771 | 3300009147 | Bacteria | 8884 |
| 379 | Ga0114129_10928432 | 3300009147 | Bacteria | 1101 |
| 380 | Ga0114129_11471842 | 3300009147 | Bacteria | 838 |
| 381 | Ga0105241_10002278 | 3300009174 | Bacteria | 14426 |
| 382 | Ga0105241_10014672 | 3300009174 | Bacteria | 5735 |
| 383 | Ga0105241_10047441 | 3300009174 | Bacteria | 3266 |
| 384 | Ga0105241_10103498 | 3300009174 | Bacteria | 2267 |
| 385 | Ga0105241_10227672 | 3300009174 | Unclassified | 1570 |
| 386 | Ga0105241_10228395 | 3300009174 | Bacteria | 1568 |
| 387 | Ga0105241_10293617 | 3300009174 | Bacteria | 1393 |
| 388 | Ga0105241_10530602 | 3300009174 | Bacteria | 1054 |
| 389 | Ga0105242_10024992 | 3300009176 | Bacteria | 4721 |
| 390 | Ga0105242_10537825 | 3300009176 | Bacteria | 1118 |
| 391 | Ga0105248_10031636 | 3300009177 | Bacteria | 5911 |
| 392 | Ga0105248_10043691 | 3300009177 | Bacteria | 5026 |
| 393 | Ga0105248_10095323 | 3300009177 | Bacteria | 3351 |
| 394 | Ga0105248_10394575 | 3300009177 | Bacteria | 1558 |
| 395 | Ga0105248_10675500 | 3300009177 | Bacteria | 1165 |
| 396 | Ga0105237_10019037 | 3300009545 | Bacteria | 7097 |
| 397 | Ga0105237_10257336 | 3300009545 | Bacteria | 1748 |
| 398 | Ga0105237_10296892 | 3300009545 | Bacteria | 1618 |
| 399 | Ga0105237_10298370 | 3300009545 | Bacteria | 1614 |
| 400 | Ga0105237_10923841 | 3300009545 | Bacteria | 880 |
| 401 | Ga0105237_11421464 | 3300009545 | Bacteria | 700 |
| 402 | Ga0105238_10002919 | 3300009551 | Bacteria | 17068 |
| 403 | Ga0105238_10041603 | 3300009551 | Unclassified | 4654 |
| 404 | Ga0105238_10104051 | 3300009551 | Bacteria | 2820 |
| 405 | Ga0105238_10212205 | 3300009551 | Bacteria | 1912 |
| 406 | Ga0105249_10044335 | 3300009553 | Bacteria | 4045 |
| 407 | Ga0105249_10542083 | 3300009553 | Bacteria | 1213 |
| 408 | Ga0105249_11136323 | 3300009553 | Unclassified | 851 |
| 409 | Ga0099796_10048775 | 3300010159 | Bacteria | 1462 |
| 410 | Ga0105239_10017824 | 3300010375 | Bacteria | 7854 |
| 411 | Ga0105239_10080832 | 3300010375 | Bacteria | 3576 |
| 412 | Ga0105239_10081568 | 3300010375 | Bacteria | 3560 |
| 413 | Ga0105239_10199907 | 3300010375 | Bacteria | 2239 |
| 414 | Ga0105239_10271004 | 3300010375 | Bacteria | 1909 |
| 415 | Ga0105239_11288240 | 3300010375 | Unclassified | 843 |
| 416 | Ga0105246_10003185 | 3300011119 | Bacteria | 9972 |
| 417 | Ga0157373_10067274 | 3300013100 | Bacteria | 2534 |
| 418 | Ga0157373_10113101 | 3300013100 | Bacteria | 1908 |
| 419 | Ga0157373_10259488 | 3300013100 | Bacteria | 1230 |
| 420 | Ga0157373_10326479 | 3300013100 | Unclassified | 1092 |
| 421 | Ga0157371_10172086 | 3300013102 | Bacteria | 1548 |
| 422 | Ga0157370_10033829 | 3300013104 | Bacteria | 4982 |
| 423 | Ga0157370_10094369 | 3300013104 | Bacteria | 2807 |
| 424 | Ga0157370_10105410 | 3300013104 | Bacteria | 2639 |
| 425 | Ga0157369_10000243 | 3300013105 | Bacteria | 75602 |
| 426 | Ga0157369_10002120 | 3300013105 | Bacteria | 23917 |
| 427 | Ga0157369_10009538 | 3300013105 | Bacteria | 11100 |
| 428 | Ga0157369_10019842 | 3300013105 | Bacteria | 7522 |
| 429 | Ga0157369_10045930 | 3300013105 | Bacteria | 4748 |
| 430 | Ga0157369_10050031 | 3300013105 | Bacteria | 4528 |
| 431 | Ga0157369_10074211 | 3300013105 | Bacteria | 3648 |
| 432 | Ga0157369_10076892 | 3300013105 | Bacteria | 3578 |
| 433 | Ga0157369_10094000 | 3300013105 | Bacteria | 3201 |
| 434 | Ga0157369_10236466 | 3300013105 | Bacteria | 1909 |
| 435 | Ga0157369_10241931 | 3300013105 | Bacteria | 1885 |
| 436 | Ga0157369_10385930 | 3300013105 | Bacteria | 1453 |
| 437 | Ga0157369_10609448 | 3300013105 | Bacteria | 1127 |
| 438 | Ga0157374_10001216 | 3300013296 | Bacteria | 22009 |
| 439 | Ga0157374_10001860 | 3300013296 | Bacteria | 17768 |
| 440 | Ga0157374_10011248 | 3300013296 | Bacteria | 7740 |
| 441 | Ga0157374_10024826 | 3300013296 | Bacteria | 5376 |
| 442 | Ga0157374_10234055 | 3300013296 | Bacteria | 1805 |
| 443 | Ga0157374_10435143 | 3300013296 | Bacteria | 1312 |
| 444 | Ga0157374_10445337 | 3300013296 | Unclassified | 1296 |
| 445 | Ga0157374_10543456 | 3300013296 | Bacteria | 1169 |
| 446 | Ga0157374_10665714 | 3300013296 | Unclassified | 1053 |
| 447 | Ga0157374_10788276 | 3300013296 | Bacteria | 966 |
| 448 | Ga0157378_10000325 | 3300013297 | Bacteria | 47034 |
| 449 | Ga0157378_10000925 | 3300013297 | Bacteria | 27033 |
| 450 | Ga0157378_10001581 | 3300013297 | Bacteria | 20568 |
| 451 | Ga0163162_10027862 | 3300013306 | Bacteria | 5588 |
| 452 | Ga0163162_10082571 | 3300013306 | Bacteria | 3286 |
| 453 | Ga0157372_10004045 | 3300013307 | Bacteria | 15713 |
| 454 | Ga0157372_10005315 | 3300013307 | Bacteria | 13677 |
| 455 | Ga0157372_10015124 | 3300013307 | Bacteria | 8260 |
| 456 | Ga0157372_10015924 | 3300013307 | Bacteria | 8063 |
| 457 | Ga0157372_10037114 | 3300013307 | Bacteria | 5372 |
| 458 | Ga0157372_10073579 | 3300013307 | Bacteria | 3852 |
| 459 | Ga0157372_10492405 | 3300013307 | Unclassified | 1429 |
| 460 | Ga0157372_11241877 | 3300013307 | Bacteria | 860 |
| 461 | Ga0157372_11325405 | 3300013307 | Bacteria | 831 |
| 462 | Ga0157372_11515255 | 3300013307 | Bacteria | 772 |
| 463 | Ga0157375_10738840 | 3300013308 | Bacteria | 1136 |
| 464 | Ga0157375_11552976 | 3300013308 | Bacteria | 782 |
| 465 | Ga0163163_10001425 | 3300014325 | Bacteria | 20233 |
| 466 | Ga0163163_10018723 | 3300014325 | Bacteria | 6489 |
| 467 | Ga0163163_10107681 | 3300014325 | Bacteria | 2814 |
| 468 | Ga0163163_10679059 | 3300014325 | Bacteria | 1093 |
| 469 | Ga0163163_10946111 | 3300014325 | Bacteria | 925 |
| 470 | Ga0163163_11077830 | 3300014325 | Bacteria | 866 |
| 471 | Ga0157380_10100323 | 3300014326 | Bacteria | 2410 |
| 472 | Ga0182008_10006237 | 3300014497 | Bacteria | 6699 |
| 473 | Ga0182008_10051708 | 3300014497 | Bacteria | 2038 |
| 474 | Ga0182008_10209395 | 3300014497 | Bacteria | 994 |
| 475 | Ga0157377_10000286 | 3300014745 | Bacteria | 24143 |
| 476 | Ga0157379_10001394 | 3300014968 | Bacteria | 19786 |
| 477 | Ga0157379_10906224 | 3300014968 | Bacteria | 837 |
| 478 | Ga0157376_10001475 | 3300014969 | Bacteria | 15497 |
| 479 | Ga0157376_10015440 | 3300014969 | Bacteria | 5769 |
| 480 | Ga0182006_1159862 | 3300015261 | Unclassified | 759 |
| 481 | Ga0182007_10004788 | 3300015262 | Bacteria | 6077 |
| 482 | Ga0182005_1008641 | 3300015265 | Bacteria | 2992 |
| 483 | Ga0163161_10001313 | 3300017792 | Bacteria | 18509 |
| 484 | Ga0197907_10220925 | 3300020069 | Unclassified | 1583 |
| 485 | Ga0206350_10573770 | 3300020080 | Bacteria | 715 |
| 486 | Ga0213874_10040258 | 3300021377 | Bacteria | 1395 |
| 487 | Ga0213874_10040613 | 3300021377 | Bacteria | 1390 |
| 488 | Ga0213874_10054554 | 3300021377 | Bacteria | 1236 |
| 489 | Ga0224712_10305312 | 3300022467 | Bacteria | 745 |
| 490 | Ga0224569_101258 | 3300022732 | Bacteria | 2147 |
| 491 | Ga0224571_101242 | 3300022734 | Unclassified | 1585 |
| 492 | Ga0224572_1003199 | 3300024225 | Bacteria | 2741 |
| 493 | Ga0224572_1008880 | 3300024225 | Bacteria | 1866 |
| 494 | Ga0224572_1013734 | 3300024225 | Bacteria | 1544 |
| 495 | Ga0224572_1031482 | 3300024225 | Unclassified | 1011 |
| 496 | Ga0228598_1000263 | 3300024227 | Bacteria | 10085 |
| 497 | Ga0228598_1002110 | 3300024227 | Bacteria | 4347 |
| 498 | Ga0228598_1003378 | 3300024227 | Bacteria | 3435 |
| 499 | Ga0207426_1074058 | 3300025302 | Bacteria | 941 |
| 500 | Ga0207697_10002666 | 3300025315 | Bacteria | 9135 |
| 501 | Ga0207697_10207581 | 3300025315 | Bacteria | 863 |
| 502 | Ga0207656_10100183 | 3300025321 | Bacteria | 1327 |
| 503 | Ga0207682_10002185 | 3300025893 | Bacteria | 8842 |
| 504 | Ga0207692_10010027 | 3300025898 | Bacteria | 3975 |
| 505 | Ga0207692_10015954 | 3300025898 | Bacteria | 3315 |
| 506 | Ga0207692_10047958 | 3300025898 | Bacteria | 2148 |
| 507 | Ga0207692_10058174 | 3300025898 | Bacteria | 1990 |
| 508 | Ga0207692_10111873 | 3300025898 | Bacteria | 1516 |
| 509 | Ga0207692_10115646 | 3300025898 | Bacteria | 1495 |
| 510 | Ga0207692_10149360 | 3300025898 | Bacteria | 1337 |
| 511 | Ga0207692_10228683 | 3300025898 | Unclassified | 1106 |
| 512 | Ga0207642_10155439 | 3300025899 | Bacteria | 1222 |
| 513 | Ga0207642_10344192 | 3300025899 | Bacteria | 877 |
| 514 | Ga0207710_10185767 | 3300025900 | Bacteria | 1022 |
| 515 | Ga0207688_10005547 | 3300025901 | Bacteria | 6863 |
| 516 | Ga0207688_10417374 | 3300025901 | Bacteria | 834 |
| 517 | Ga0207680_10053144 | 3300025903 | Bacteria | 2431 |
| 518 | Ga0207680_10060920 | 3300025903 | Bacteria | 2299 |
| 519 | Ga0207647_10004334 | 3300025904 | Bacteria | 10521 |
| 520 | Ga0207647_10013289 | 3300025904 | Bacteria | 5714 |
| 521 | Ga0207647_10051423 | 3300025904 | Bacteria | 2547 |
| 522 | Ga0207685_10005994 | 3300025905 | Bacteria | 3268 |
| 523 | Ga0207685_10025564 | 3300025905 | Bacteria | 2040 |
| 524 | Ga0207699_10001626 | 3300025906 | Bacteria | 10649 |
| 525 | Ga0207699_10007448 | 3300025906 | Bacteria | 5355 |
| 526 | Ga0207699_10088650 | 3300025906 | Bacteria | 1937 |
| 527 | Ga0207699_10092673 | 3300025906 | Bacteria | 1900 |
| 528 | Ga0207699_10213230 | 3300025906 | Bacteria | 1314 |
| 529 | Ga0207699_10425255 | 3300025906 | Bacteria | 949 |
| 530 | Ga0207699_10437583 | 3300025906 | Bacteria | 936 |
| 531 | Ga0207699_10489705 | 3300025906 | Bacteria | 886 |
| 532 | Ga0207699_10492797 | 3300025906 | Unclassified | 884 |
| 533 | Ga0207699_10543877 | 3300025906 | Bacteria | 842 |
| 534 | Ga0207699_10552193 | 3300025906 | Bacteria | 836 |
| 535 | Ga0207645_10000781 | 3300025907 | Bacteria | 26560 |
| 536 | Ga0207643_10001078 | 3300025908 | Bacteria | 16138 |
| 537 | Ga0207705_10079407 | 3300025909 | Bacteria | 2389 |
| 538 | Ga0207705_10200191 | 3300025909 | Unclassified | 1513 |
| 539 | Ga0207684_10000081 | 3300025910 | Bacteria | 178619 |
| 540 | Ga0207684_10000762 | 3300025910 | Bacteria | 37545 |
| 541 | Ga0207684_10007088 | 3300025910 | Bacteria | 10134 |
| 542 | Ga0207684_10014384 | 3300025910 | Bacteria | 6824 |
| 543 | Ga0207684_10079249 | 3300025910 | Bacteria | 2794 |
| 544 | Ga0207684_10087488 | 3300025910 | Bacteria | 2655 |
| 545 | Ga0207684_10267387 | 3300025910 | Bacteria | 1475 |
| 546 | Ga0207684_10624608 | 3300025910 | Bacteria | 919 |
| 547 | Ga0207654_10077294 | 3300025911 | Bacteria | 1995 |
| 548 | Ga0207654_10715517 | 3300025911 | Bacteria | 720 |
| 549 | Ga0207707_10001814 | 3300025912 | Bacteria | 19598 |
| 550 | Ga0207707_10002624 | 3300025912 | Bacteria | 16096 |
| 551 | Ga0207707_10004912 | 3300025912 | Bacteria | 11754 |
| 552 | Ga0207707_10011466 | 3300025912 | Bacteria | 7719 |
| 553 | Ga0207707_10012005 | 3300025912 | Bacteria | 7530 |
| 554 | Ga0207707_10024968 | 3300025912 | Bacteria | 5229 |
| 555 | Ga0207707_10044157 | 3300025912 | Bacteria | 3887 |
| 556 | Ga0207707_10048740 | 3300025912 | Bacteria | 3690 |
| 557 | Ga0207707_10090931 | 3300025912 | Bacteria | 2667 |
| 558 | Ga0207707_10096339 | 3300025912 | Bacteria | 2586 |
| 559 | Ga0207707_10153392 | 3300025912 | Bacteria | 2014 |
| 560 | Ga0207707_10265629 | 3300025912 | Bacteria | 1488 |
| 561 | Ga0207695_10001570 | 3300025913 | Bacteria | 37221 |
| 562 | Ga0207695_10020694 | 3300025913 | Bacteria | 7528 |
| 563 | Ga0207695_10023851 | 3300025913 | Bacteria | 6904 |
| 564 | Ga0207695_10081445 | 3300025913 | Bacteria | 3276 |
| 565 | Ga0207695_10085477 | 3300025913 | Bacteria | 3183 |
| 566 | Ga0207695_10126032 | 3300025913 | Bacteria | 2523 |
| 567 | Ga0207695_10220829 | 3300025913 | Bacteria | 1802 |
| 568 | Ga0207695_11000864 | 3300025913 | Bacteria | 716 |
| 569 | Ga0207671_10186478 | 3300025914 | Bacteria | 1616 |
| 570 | Ga0207671_10424299 | 3300025914 | Bacteria | 1058 |
| 571 | Ga0207693_10000019 | 3300025915 | Bacteria | 138082 |
| 572 | Ga0207693_10000158 | 3300025915 | Bacteria | 63123 |
| 573 | Ga0207693_10004951 | 3300025915 | Bacteria | 11192 |
| 574 | Ga0207693_10005955 | 3300025915 | Bacteria | 10118 |
| 575 | Ga0207693_10010174 | 3300025915 | Bacteria | 7639 |
| 576 | Ga0207693_10016464 | 3300025915 | Bacteria | 5908 |
| 577 | Ga0207693_10017284 | 3300025915 | Bacteria | 5753 |
| 578 | Ga0207693_10026910 | 3300025915 | Bacteria | 4550 |
| 579 | Ga0207693_10056311 | 3300025915 | Bacteria | 3083 |
| 580 | Ga0207693_10162560 | 3300025915 | Bacteria | 1757 |
| 581 | Ga0207693_10184687 | 3300025915 | Bacteria | 1641 |
| 582 | Ga0207693_10237810 | 3300025915 | Bacteria | 1430 |
| 583 | Ga0207693_10423031 | 3300025915 | Bacteria | 1041 |
| 584 | Ga0207693_10806600 | 3300025915 | Bacteria | 723 |
| 585 | Ga0207663_10000394 | 3300025916 | Bacteria | 18953 |
| 586 | Ga0207663_10003222 | 3300025916 | Bacteria | 7950 |
| 587 | Ga0207663_10032413 | 3300025916 | Bacteria | 3102 |
| 588 | Ga0207663_10064412 | 3300025916 | Bacteria | 2339 |
| 589 | Ga0207663_10123226 | 3300025916 | Bacteria | 1778 |
| 590 | Ga0207663_10146699 | 3300025916 | Bacteria | 1650 |
| 591 | Ga0207663_10197602 | 3300025916 | Bacteria | 1448 |
| 592 | Ga0207663_10453994 | 3300025916 | Bacteria | 989 |
| 593 | Ga0207660_10004717 | 3300025917 | Bacteria | 8876 |
| 594 | Ga0207660_10030153 | 3300025917 | Unclassified | 3727 |
| 595 | Ga0207660_10099605 | 3300025917 | Bacteria | 2169 |
| 596 | Ga0207660_10472762 | 3300025917 | Unclassified | 1015 |
| 597 | Ga0207660_10812024 | 3300025917 | Bacteria | 763 |
| 598 | Ga0207662_10004934 | 3300025918 | Bacteria | 7054 |
| 599 | Ga0207657_10000311 | 3300025919 | Bacteria | 51649 |
| 600 | Ga0207657_10001224 | 3300025919 | Bacteria | 27379 |
| 601 | Ga0207657_10013003 | 3300025919 | Bacteria | 8180 |
| 602 | Ga0207649_10002645 | 3300025920 | Bacteria | 9951 |
| 603 | Ga0207649_10285714 | 3300025920 | Bacteria | 1201 |
| 604 | Ga0207649_10379415 | 3300025920 | Bacteria | 1053 |
| 605 | Ga0207649_10398888 | 3300025920 | Bacteria | 1029 |
| 606 | Ga0207649_10910217 | 3300025920 | Unclassified | 690 |
| 607 | Ga0207652_10008939 | 3300025921 | Bacteria | 8072 |
| 608 | Ga0207652_10066816 | 3300025921 | Bacteria | 3117 |
| 609 | Ga0207652_10322451 | 3300025921 | Bacteria | 1395 |
| 610 | Ga0207652_10510132 | 3300025921 | Bacteria | 1082 |
| 611 | Ga0207652_10539200 | 3300025921 | Bacteria | 1049 |
| 612 | Ga0207646_10000334 | 3300025922 | Bacteria | 63767 |
| 613 | Ga0207646_10004011 | 3300025922 | Bacteria | 16291 |
| 614 | Ga0207646_10005419 | 3300025922 | Bacteria | 13420 |
| 615 | Ga0207646_10008546 | 3300025922 | Bacteria | 10244 |
| 616 | Ga0207646_10014759 | 3300025922 | Bacteria | 7403 |
| 617 | Ga0207646_10025466 | 3300025922 | Bacteria | 5412 |
| 618 | Ga0207646_10089627 | 3300025922 | Bacteria | 2753 |
| 619 | Ga0207646_10620516 | 3300025922 | Bacteria | 970 |
| 620 | Ga0207646_10682214 | 3300025922 | Bacteria | 919 |
| 621 | Ga0207681_10063854 | 3300025923 | Bacteria | 2540 |
| 622 | Ga0207681_10893518 | 3300025923 | Bacteria | 744 |
| 623 | Ga0207694_10000896 | 3300025924 | Bacteria | 26371 |
| 624 | Ga0207694_10026092 | 3300025924 | Unclassified | 4443 |
| 625 | Ga0207694_10090793 | 3300025924 | Bacteria | 2410 |
| 626 | Ga0207694_10124758 | 3300025924 | Unclassified | 2059 |
| 627 | Ga0207694_10350570 | 3300025924 | Bacteria | 1222 |
| 628 | Ga0207694_10641146 | 3300025924 | Bacteria | 895 |
| 629 | Ga0207650_10000063 | 3300025925 | Bacteria | 146432 |
| 630 | Ga0207650_10040526 | 3300025925 | Bacteria | 3409 |
| 631 | Ga0207650_10200591 | 3300025925 | Bacteria | 1598 |
| 632 | Ga0207650_10270125 | 3300025925 | Unclassified | 1382 |
| 633 | Ga0207659_10198885 | 3300025926 | Unclassified | 1599 |
| 634 | Ga0207659_10486190 | 3300025926 | Bacteria | 1043 |
| 635 | Ga0207687_10001952 | 3300025927 | Bacteria | 14189 |
| 636 | Ga0207687_10041927 | 3300025927 | Unclassified | 3146 |
| 637 | Ga0207687_10158728 | 3300025927 | Bacteria | 1733 |
| 638 | Ga0207700_10000129 | 3300025928 | Bacteria | 44957 |
| 639 | Ga0207700_10000233 | 3300025928 | Bacteria | 33328 |
| 640 | Ga0207700_10000348 | 3300025928 | Bacteria | 27120 |
| 641 | Ga0207700_10027210 | 3300025928 | Unclassified | 4001 |
| 642 | Ga0207700_10042188 | 3300025928 | Bacteria | 3343 |
| 643 | Ga0207700_10073121 | 3300025928 | Bacteria | 2646 |
| 644 | Ga0207700_10084711 | 3300025928 | Bacteria | 2486 |
| 645 | Ga0207700_10087348 | 3300025928 | Bacteria | 2452 |
| 646 | Ga0207700_10110841 | 3300025928 | Unclassified | 2208 |
| 647 | Ga0207700_10136524 | 3300025928 | Bacteria | 2010 |
| 648 | Ga0207700_10221476 | 3300025928 | Bacteria | 1604 |
| 649 | Ga0207700_10230801 | 3300025928 | Bacteria | 1573 |
| 650 | Ga0207700_10279530 | 3300025928 | Bacteria | 1435 |
| 651 | Ga0207700_10438623 | 3300025928 | Bacteria | 1149 |
| 652 | Ga0207700_10497961 | 3300025928 | Bacteria | 1078 |
| 653 | Ga0207700_10628283 | 3300025928 | Bacteria | 957 |
| 654 | Ga0207700_10675797 | 3300025928 | Unclassified | 921 |
| 655 | Ga0207700_10791731 | 3300025928 | Bacteria | 848 |
| 656 | Ga0207700_10950828 | 3300025928 | Unclassified | 769 |
| 657 | Ga0207664_10000284 | 3300025929 | Bacteria | 38480 |
| 658 | Ga0207664_10022822 | 3300025929 | Bacteria | 4680 |
| 659 | Ga0207664_10065466 | 3300025929 | Unclassified | 2910 |
| 660 | Ga0207664_10104533 | 3300025929 | Bacteria | 2345 |
| 661 | Ga0207664_10196730 | 3300025929 | Bacteria | 1738 |
| 662 | Ga0207664_10278299 | 3300025929 | Bacteria | 1468 |
| 663 | Ga0207664_10290809 | 3300025929 | Bacteria | 1436 |
| 664 | Ga0207664_10357885 | 3300025929 | Unclassified | 1293 |
| 665 | Ga0207664_10417528 | 3300025929 | Bacteria | 1195 |
| 666 | Ga0207664_10770535 | 3300025929 | Bacteria | 865 |
| 667 | Ga0207644_10004369 | 3300025931 | Bacteria | 9169 |
| 668 | Ga0207644_10037893 | 3300025931 | Bacteria | 3393 |
| 669 | Ga0207644_10165591 | 3300025931 | Bacteria | 1722 |
| 670 | Ga0207644_10803086 | 3300025931 | Bacteria | 787 |
| 671 | Ga0207644_10897068 | 3300025931 | Bacteria | 743 |
| 672 | Ga0207690_10507293 | 3300025932 | Bacteria | 976 |
| 673 | Ga0207690_10900353 | 3300025932 | Bacteria | 734 |
| 674 | Ga0207706_10001937 | 3300025933 | Bacteria | 20312 |
| 675 | Ga0207706_10119693 | 3300025933 | Bacteria | 2315 |
| 676 | Ga0207670_10099607 | 3300025936 | Bacteria | 2073 |
| 677 | Ga0207670_10422801 | 3300025936 | Bacteria | 1069 |
| 678 | Ga0207704_10271304 | 3300025938 | Unclassified | 1285 |
| 679 | Ga0207665_10000109 | 3300025939 | Bacteria | 53830 |
| 680 | Ga0207665_10013403 | 3300025939 | Bacteria | 5390 |
| 681 | Ga0207665_10016509 | 3300025939 | Bacteria | 4849 |
| 682 | Ga0207665_10086268 | 3300025939 | Bacteria | 2167 |
| 683 | Ga0207665_10122953 | 3300025939 | Bacteria | 1835 |
| 684 | Ga0207665_10124518 | 3300025939 | Bacteria | 1824 |
| 685 | Ga0207665_10129107 | 3300025939 | Bacteria | 1792 |
| 686 | Ga0207665_10201787 | 3300025939 | Bacteria | 1449 |
| 687 | Ga0207665_10438103 | 3300025939 | Bacteria | 1001 |
| 688 | Ga0207665_10739481 | 3300025939 | Unclassified | 775 |
| 689 | Ga0207665_10958087 | 3300025939 | Unclassified | 680 |
| 690 | Ga0207691_10001123 | 3300025940 | Bacteria | 26596 |
| 691 | Ga0207711_10043977 | 3300025941 | Bacteria | 3811 |
| 692 | Ga0207711_10115246 | 3300025941 | Bacteria | 2394 |
| 693 | Ga0207711_10135993 | 3300025941 | Bacteria | 2207 |
| 694 | Ga0207711_10542172 | 3300025941 | Bacteria | 1085 |
| 695 | Ga0207689_10001298 | 3300025942 | Bacteria | 24081 |
| 696 | Ga0207689_10130321 | 3300025942 | Unclassified | 2070 |
| 697 | Ga0207689_10483165 | 3300025942 | Bacteria | 1037 |
| 698 | Ga0207661_10000156 | 3300025944 | Bacteria | 43880 |
| 699 | Ga0207661_10024048 | 3300025944 | Bacteria | 4610 |
| 700 | Ga0207661_10053000 | 3300025944 | Bacteria | 3244 |
| 701 | Ga0207661_10749830 | 3300025944 | Unclassified | 899 |
| 702 | Ga0207679_10000588 | 3300025945 | Bacteria | 24327 |
| 703 | Ga0207679_10001790 | 3300025945 | Bacteria | 13372 |
| 704 | Ga0207667_10000188 | 3300025949 | Bacteria | 90598 |
| 705 | Ga0207667_10000302 | 3300025949 | Bacteria | 68245 |
| 706 | Ga0207667_10009252 | 3300025949 | Bacteria | 11632 |
| 707 | Ga0207667_10013037 | 3300025949 | Bacteria | 9542 |
| 708 | Ga0207667_10027559 | 3300025949 | Bacteria | 6181 |
| 709 | Ga0207667_10034008 | 3300025949 | Bacteria | 5476 |
| 710 | Ga0207667_10081567 | 3300025949 | Bacteria | 3350 |
| 711 | Ga0207667_10175356 | 3300025949 | Bacteria | 2203 |
| 712 | Ga0207667_10352037 | 3300025949 | Bacteria | 1502 |
| 713 | Ga0207667_10435883 | 3300025949 | Bacteria | 1333 |
| 714 | Ga0207667_10524281 | 3300025949 | Unclassified | 1200 |
| 715 | Ga0207667_10529480 | 3300025949 | Bacteria | 1193 |
| 716 | Ga0207667_10811916 | 3300025949 | Bacteria | 931 |
| 717 | Ga0207667_10817611 | 3300025949 | Bacteria | 928 |
| 718 | Ga0207667_11027943 | 3300025949 | Bacteria | 810 |
| 719 | Ga0207651_10072540 | 3300025960 | Bacteria | 2444 |
| 720 | Ga0207651_10082588 | 3300025960 | Bacteria | 2320 |
| 721 | Ga0207651_10966899 | 3300025960 | Bacteria | 760 |
| 722 | Ga0207712_10100024 | 3300025961 | Bacteria | 2154 |
| 723 | Ga0207668_10069067 | 3300025972 | Bacteria | 2514 |
| 724 | Ga0207640_10006509 | 3300025981 | Bacteria | 6415 |
| 725 | Ga0207640_10014840 | 3300025981 | Bacteria | 4494 |
| 726 | Ga0207640_10070946 | 3300025981 | Bacteria | 2345 |
| 727 | Ga0207640_10171438 | 3300025981 | Bacteria | 1617 |
| 728 | Ga0207658_10320430 | 3300025986 | Bacteria | 1342 |
| 729 | Ga0207658_10320467 | 3300025986 | Bacteria | 1341 |
| 730 | Ga0207658_11403314 | 3300025986 | Bacteria | 639 |
| 731 | Ga0207677_10012203 | 3300026023 | Unclassified | 4929 |
| 732 | Ga0207677_10018172 | 3300026023 | Bacteria | 4214 |
| 733 | Ga0207677_10082030 | 3300026023 | Bacteria | 2316 |
| 734 | Ga0207677_10098027 | 3300026023 | Bacteria | 2149 |
| 735 | Ga0207677_10570310 | 3300026023 | Bacteria | 989 |
| 736 | Ga0207703_10001842 | 3300026035 | Bacteria | 18897 |
| 737 | Ga0207703_10049928 | 3300026035 | Bacteria | 3384 |
| 738 | Ga0207703_10137491 | 3300026035 | Unclassified | 2117 |
| 739 | Ga0207703_10274595 | 3300026035 | Unclassified | 1528 |
| 740 | Ga0207639_10117177 | 3300026041 | Bacteria | 2182 |
| 741 | Ga0207639_10208331 | 3300026041 | Bacteria | 1681 |
| 742 | Ga0207639_10255343 | 3300026041 | Bacteria | 1530 |
| 743 | Ga0207639_10458632 | 3300026041 | Unclassified | 1158 |
| 744 | Ga0207678_10000443 | 3300026067 | Bacteria | 37711 |
| 745 | Ga0207702_10000120 | 3300026078 | Bacteria | 91853 |
| 746 | Ga0207702_10001675 | 3300026078 | Bacteria | 21899 |
| 747 | Ga0207702_10009760 | 3300026078 | Bacteria | 8058 |
| 748 | Ga0207702_10036655 | 3300026078 | Unclassified | 4102 |
| 749 | Ga0207702_10062637 | 3300026078 | Unclassified | 3177 |
| 750 | Ga0207702_10083250 | 3300026078 | Bacteria | 2783 |
| 751 | Ga0207702_10327015 | 3300026078 | Bacteria | 1461 |
| 752 | Ga0207702_10521314 | 3300026078 | Bacteria | 1160 |
| 753 | Ga0207702_10527538 | 3300026078 | Unclassified | 1153 |
| 754 | Ga0207641_10000131 | 3300026088 | Bacteria | 110151 |
| 755 | Ga0207641_10016212 | 3300026088 | Bacteria | 6103 |
| 756 | Ga0207641_10072350 | 3300026088 | Bacteria | 2969 |
| 757 | Ga0207641_10317002 | 3300026088 | Bacteria | 1477 |
| 758 | Ga0207641_10895527 | 3300026088 | Bacteria | 881 |
| 759 | Ga0207648_10000403 | 3300026089 | Bacteria | 48140 |
| 760 | Ga0207648_10091189 | 3300026089 | Bacteria | 2664 |
| 761 | Ga0207676_10000517 | 3300026095 | Bacteria | 32477 |
| 762 | Ga0207676_10002843 | 3300026095 | Bacteria | 12326 |
| 763 | Ga0207676_10012744 | 3300026095 | Bacteria | 6032 |
| 764 | Ga0207676_10017081 | 3300026095 | Bacteria | 5257 |
| 765 | Ga0207676_10729253 | 3300026095 | Unclassified | 962 |
| 766 | Ga0207676_10936319 | 3300026095 | Bacteria | 851 |
| 767 | Ga0207674_10000056 | 3300026116 | Bacteria | 113265 |
| 768 | Ga0207674_10000201 | 3300026116 | Bacteria | 74066 |
| 769 | Ga0207674_10010860 | 3300026116 | Bacteria | 10264 |
| 770 | Ga0207683_10000848 | 3300026121 | Bacteria | 28069 |
| 771 | Ga0207683_10217698 | 3300026121 | Bacteria | 1739 |
| 772 | Ga0207683_10301977 | 3300026121 | Bacteria | 1465 |
| 773 | Ga0207683_10622655 | 3300026121 | Bacteria | 999 |
| 774 | Ga0207698_10041264 | 3300026142 | Unclassified | 3437 |
| 775 | Ga0207698_10071903 | 3300026142 | Bacteria | 2747 |
| 776 | Ga0207698_10269322 | 3300026142 | Bacteria | 1569 |
| 777 | Ga0268266_10002994 | 3300028379 | Bacteria | 17410 |
| 778 | Ga0268266_10024815 | 3300028379 | Bacteria | 5101 |
| 779 | Ga0268266_10031914 | 3300028379 | Bacteria | 4475 |
| 780 | Ga0268265_10001656 | 3300028380 | Bacteria | 18220 |
| 781 | Ga0268264_10003976 | 3300028381 | Bacteria | 12651 |
| 782 | Ga0268264_10129387 | 3300028381 | Bacteria | 2236 |
| 783 | Ga0268264_10502990 | 3300028381 | Bacteria | 1182 |
| 784 | Ga0265336_10002308 | 3300028666 | Bacteria | 7955 |
| 785 | Ga0265336_10006115 | 3300028666 | Bacteria | 4365 |
| 786 | Ga0265338_10008619 | 3300028800 | Bacteria | 12334 |
| 787 | Ga0265338_10045200 | 3300028800 | Unclassified | 4053 |
| 788 | Ga0265338_10049670 | 3300028800 | Unclassified | 3799 |
| 789 | Ga0265338_10079931 | 3300028800 | Bacteria | 2749 |
| 790 | Ga0265338_10122311 | 3300028800 | Bacteria | 2071 |
| 791 | Ga0265338_10504030 | 3300028800 | Unclassified | 852 |
| 792 | Ga0265324_10071311 | 3300029957 | Bacteria | 1184 |
| 793 | Ga0265324_10151339 | 3300029957 | Bacteria | 788 |
| 794 | Ga0265762_1000263 | 3300030760 | Bacteria | 8735 |
| 795 | Ga0265762_1031420 | 3300030760 | Bacteria | 1009 |
| 796 | Ga0265765_1003039 | 3300030879 | Bacteria | 1663 |
| 797 | Ga0265760_10003581 | 3300031090 | Bacteria | 4507 |
| 798 | Ga0265760_10013154 | 3300031090 | Bacteria | 2368 |
| 799 | Ga0265330_10000216 | 3300031235 | Bacteria | 44839 |
| 800 | Ga0265330_10107139 | 3300031235 | Bacteria | 1195 |
| 801 | Ga0265328_10002261 | 3300031239 | Bacteria | 8684 |
| 802 | Ga0265325_10000249 | 3300031241 | Bacteria | 38332 |
| 803 | Ga0265325_10001092 | 3300031241 | Bacteria | 19505 |
| 804 | Ga0265325_10002613 | 3300031241 | Bacteria | 12063 |
| 805 | Ga0265325_10004469 | 3300031241 | Bacteria | 8832 |
| 806 | Ga0265325_10027277 | 3300031241 | Bacteria | 3087 |
| 807 | Ga0265325_10115609 | 3300031241 | Bacteria | 1299 |
| 808 | Ga0265329_10006633 | 3300031242 | Unclassified | 4578 |
| 809 | Ga0265340_10001240 | 3300031247 | Bacteria | 14627 |
| 810 | Ga0265340_10005066 | 3300031247 | Bacteria | 7326 |
| 811 | Ga0265340_10011713 | 3300031247 | Bacteria | 4653 |
| 812 | Ga0265340_10058024 | 3300031247 | Bacteria | 1859 |
| 813 | Ga0265340_10283011 | 3300031247 | Bacteria | 736 |
| 814 | Ga0265339_10002285 | 3300031249 | Bacteria | 13823 |
| 815 | Ga0265339_10007283 | 3300031249 | Bacteria | 7168 |
| 816 | Ga0265339_10007957 | 3300031249 | Bacteria | 6799 |
| 817 | Ga0265339_10018564 | 3300031249 | Bacteria | 4096 |
| 818 | Ga0265339_10062462 | 3300031249 | Bacteria | 2002 |
| 819 | Ga0265339_10081517 | 3300031249 | Unclassified | 1710 |
| 820 | Ga0265339_10087663 | 3300031249 | Bacteria | 1636 |
| 821 | Ga0265339_10091987 | 3300031249 | Unclassified | 1588 |
| 822 | Ga0265339_10106662 | 3300031249 | Unclassified | 1453 |
| 823 | Ga0265339_10166709 | 3300031249 | Bacteria | 1105 |
| 824 | Ga0265316_10006447 | 3300031344 | Bacteria | 11208 |
| 825 | Ga0265316_10012816 | 3300031344 | Bacteria | 7490 |
| 826 | Ga0265316_10014051 | 3300031344 | Bacteria | 7070 |
| 827 | Ga0265316_10018325 | 3300031344 | Bacteria | 6018 |
| 828 | Ga0265316_10033744 | 3300031344 | Bacteria | 4165 |
| 829 | Ga0265316_10061602 | 3300031344 | Unclassified | 2913 |
| 830 | Ga0265316_10075358 | 3300031344 | Bacteria | 2595 |
| 831 | Ga0265316_10138143 | 3300031344 | Bacteria | 1832 |
| 832 | Ga0265316_10212805 | 3300031344 | Bacteria | 1429 |
| 833 | Ga0307408_100606656 | 3300031548 | Bacteria | 973 |
| 834 | Ga0265313_10028796 | 3300031595 | Unclassified | 2881 |
| 835 | Ga0265313_10061217 | 3300031595 | Unclassified | 1762 |
| 836 | Ga0265313_10187707 | 3300031595 | Bacteria | 866 |
| 837 | Ga0265314_10000239 | 3300031711 | Bacteria | 80839 |
| 838 | Ga0265314_10024977 | 3300031711 | Bacteria | 4517 |
| 839 | Ga0265314_10026822 | 3300031711 | Bacteria | 4323 |
| 840 | Ga0265342_10089547 | 3300031712 | Bacteria | 1766 |
| 841 | Ga0265342_10101518 | 3300031712 | Bacteria | 1638 |
| 842 | Ga0265342_10126090 | 3300031712 | Bacteria | 1437 |
| 843 | Ga0265342_10135676 | 3300031712 | Unclassified | 1375 |
| 844 | Ga0265342_10312068 | 3300031712 | Bacteria | 826 |
| 845 | Ga0307405_10396682 | 3300031731 | Bacteria | 1079 |
| 846 | Ga0307410_10841835 | 3300031852 | Bacteria | 783 |
| 847 | Ga0307407_10061760 | 3300031903 | Bacteria | 2192 |
| 848 | Ga0307409_100000830 | 3300031995 | Bacteria | 14219 |
| 849 | Ga0307409_100178699 | 3300031995 | Bacteria | 1876 |
| 850 | Ga0307416_100096091 | 3300032002 | Bacteria | 2561 |
| 851 | Ga0307411_10126790 | 3300032005 | Bacteria | 1858 |
| 852 | Ga0307415_100057830 | 3300032126 | Bacteria | 2667 |
| 853 | Ga0307415_101287575 | 3300032126 | Unclassified | 692 |
| 854 | Ga0373938_0088007 | 3300034957 | Unclassified | 765 |
| 855 | Ga0373926_0010000 | 3300035083 | Bacteria | 3175 |
| 856 | Ga0373926_0020347 | 3300035083 | Bacteria | 2292 |
| 857 | Ga0373926_0105118 | 3300035083 | Unclassified | 1058 |
| 858 | Ga0373934_0004411 | 3300035086 | Bacteria | 5197 |
| 859 | Ga0373934_0160448 | 3300035086 | Unclassified | 922 |
| 860 | Ga0373944_0109097 | 3300035089 | Unclassified | 943 |
| 861 | Ga0373923_0034945 | 3300035111 | Bacteria | 2043 |
| 862 | Ga0373923_0048753 | 3300035111 | Bacteria | 1769 |
| 863 | Ga0373936_0001435 | 3300035113 | Bacteria | 8671 |
| 864 | Ga0373936_0033081 | 3300035113 | Bacteria | 2048 |
| 865 | Ga0373936_0132501 | 3300035113 | Unclassified | 1072 |
| 866 | Ga0373936_0280289 | 3300035113 | Bacteria | 749 |
| 867 | Ga0373945_0001479 | 3300035116 | Bacteria | 7184 |
| 868 | Ga0373945_0069093 | 3300035116 | Bacteria | 1334 |
| 869 | Ga0373945_0099123 | 3300035116 | Bacteria | 1138 |
| 870 | Ga0373945_0207116 | 3300035116 | Unclassified | 816 |
| 871 | Ga0373953_0087301 | 3300035117 | Bacteria | 1302 |
| 872 | Ga0373954_0008005 | 3300035118 | Bacteria | 4631 |
| 873 | Ga0373954_0312806 | 3300035118 | Bacteria | 775 |
| 874 | Ga0373956_0185992 | 3300035119 | Unclassified | 983 |
| 875 | Ga0373956_0258463 | 3300035119 | Bacteria | 828 |
| 876 | Ga0373957_0052285 | 3300035120 | Bacteria | 1564 |
| 877 | Ga0373943_0000141 | 3300035170 | Bacteria | 27422 |
| 878 | Ga0373943_0002710 | 3300035170 | Bacteria | 8042 |
| 879 | Ga0373943_0029568 | 3300035170 | Bacteria | 2589 |
| 880 | Ga0373943_0239179 | 3300035170 | Bacteria | 1017 |
| 881 | Ga0373943_0306472 | 3300035170 | Unclassified | 903 |
| 882 | Ga0373946_0157980 | 3300035171 | Bacteria | 1062 |
| 883 | Ga0373955_0030154 | 3300035172 | Bacteria | 2828 |
| 884 | Ga0373955_0069620 | 3300035172 | Bacteria | 1964 |
| 885 | Ga0373955_0154660 | 3300035172 | Bacteria | 1351 |
| 886 | Ga0373924_0000021 | 3300035410 | Bacteria | 39808 |
| 887 | Ga0373924_0008113 | 3300035410 | Bacteria | 3804 |
| 888 | Ga0373935_0002090 | 3300035692 | Bacteria | 11335 |
| 889 | Ga0373935_0018584 | 3300035692 | Bacteria | 4231 |
| 890 | Ga0373935_0271557 | 3300035692 | Bacteria | 1192 |
| 891 | Ga0373935_0404909 | 3300035692 | Unclassified | 980 |
| 892 | Ga0373927_0003981 | 3300035695 | Bacteria | 10449 |
| 893 | Ga0373927_0005726 | 3300035695 | Bacteria | 8534 |
| 894 | Ga0373927_0010171 | 3300035695 | Bacteria | 6290 |
| 895 | Ga0373927_0096655 | 3300035695 | Bacteria | 1920 |
| 896 | Ga0373927_0309430 | 3300035695 | Bacteria | 1040 |
| 897 | Ga0373927_0327525 | 3300035695 | Bacteria | 1009 |
| 898 | Ga0373927_0357412 | 3300035695 | Unclassified | 963 |
| 899 | Ga0373933_0062465 | 3300035724 | Bacteria | 2249 |
| 900 | Ga0373933_0078091 | 3300035724 | Bacteria | 2025 |
| 901 | Ga0373933_0087060 | 3300035724 | Bacteria | 1923 |
| 902 | Ga0373933_0650431 | 3300035724 | Unclassified | 693 |
| 903 | Ga0373947_0001591 | 3300035725 | Bacteria | 13923 |
| 904 | Ga0373947_0002655 | 3300035725 | Bacteria | 10745 |
| 905 | Ga0373947_0023446 | 3300035725 | Bacteria | 3590 |
| 906 | Ga0373947_0120009 | 3300035725 | Bacteria | 1669 |
| 907 | Ga0373947_0259633 | 3300035725 | Bacteria | 1151 |
| 908 | Ga0373947_0307181 | 3300035725 | Bacteria | 1058 |
| 909 | Ga0373937_0000090 | 3300036401 | Bacteria | 84561 |
| 910 | Ga0373937_0012656 | 3300036401 | Bacteria | 7425 |
| 911 | Ga0373937_0037458 | 3300036401 | Bacteria | 4420 |
| 912 | Ga0373937_0084735 | 3300036401 | Bacteria | 2932 |
| 913 | Ga0373937_0178364 | 3300036401 | Bacteria | 1995 |
| 914 | Ga0373937_0220053 | 3300036401 | Bacteria | 1787 |
| 915 | Ga0373937_0253273 | 3300036401 | Bacteria | 1660 |
| 916 | Ga0373937_0799166 | 3300036401 | Unclassified | 891 |
| 917 | Ga0373925_0002098 | 3300037068 | Bacteria | 16357 |
| 918 | Ga0373925_0003638 | 3300037068 | Bacteria | 11879 |
| 919 | Ga0373925_0024365 | 3300037068 | Bacteria | 4419 |
| 920 | Ga0373925_0031436 | 3300037068 | Bacteria | 3901 |
| 921 | Ga0373925_0065788 | 3300037068 | Bacteria | 2731 |
| 922 | Ga0373925_0244951 | 3300037068 | Bacteria | 1436 |
| 923 | Ga0373925_0995700 | 3300037068 | Bacteria | 690 |
| 924 | Ga0373925_1061151 | 3300037068 | Bacteria | 667 |
| 925 | Ga0395900_0754843 | 3300037418 | Bacteria | 903 |
| 926 | Ga0395900_1085604 | 3300037418 | Bacteria | 718 |
| 927 | Ga0395898_0145777 | 3300037466 | Bacteria | 2266 |
| 928 | Ga0395905_0152499 | 3300037471 | Bacteria | 2174 |
| 929 | Ga0395905_0447297 | 3300037471 | Bacteria | 1190 |
| 930 | Ga0395905_1177096 | 3300037471 | Bacteria | 670 |
| 931 | Ga0436364_1537985 | 3300037853 | Bacteria | 2479 |
| 932 | Ga0436365_0369277 | 3300039437 | Bacteria | 2132 |
| 933 | Ga0436365_0589729 | 3300039437 | Unclassified | 1759 |
| 934 | Ga0436365_1128997 | 3300039437 | Bacteria | 3599 |
| 935 | Ga0436363_0075211 | 3300039450 | Bacteria | 7880 |
| 936 | Ga0436363_0405112 | 3300039450 | Bacteria | 2388 |
| 937 | Ga0436363_0631224 | 3300039450 | Bacteria | 2351 |
| 938 | Ga0436363_1002749 | 3300039450 | Bacteria | 1658 |
| 939 | Ga0436363_1108521 | 3300039450 | Unclassified | 750 |
| 940 | Ga0436363_1316118 | 3300039450 | Unclassified | 1263 |
| 941 | Ga0436363_1636503 | 3300039450 | Bacteria | 1630 |
| 942 | Ga0436362_0059665 | 3300039453 | Bacteria | 1143 |
| 943 | Ga0436362_0893348 | 3300039453 | Bacteria | 766 |
| 944 | Ga0453683_0038993 | 3300044673 | Bacteria | 2986 |
| 945 | Ga0466965_0281811 | 3300044683 | Bacteria | 898 |
| 946 | Ga0466966_0074360 | 3300044684 | Bacteria | 2124 |
| 947 | Ga0466966_0145684 | 3300044684 | Bacteria | 1446 |
| 948 | Ga0466963_0001401 | 3300044694 | Bacteria | 12935 |
| 949 | Ga0466963_0054616 | 3300044694 | Bacteria | 2655 |
| 950 | Ga0466963_0130099 | 3300044694 | Bacteria | 1738 |
| 951 | Ga0466963_0629341 | 3300044694 | Unclassified | 757 |
| 952 | Ga0453684_0672333 | 3300044712 | Bacteria | 1128 |
| 953 | Ga0466957_0000027 | 3300044842 | Bacteria | 53351 |
| 954 | Ga0466957_0204542 | 3300044842 | Bacteria | 1298 |
| 955 | Ga0466959_0027847 | 3300045049 | Bacteria | 4192 |
| 956 | Ga0451576_0559213 | 3300045051 | Unclassified | 1202 |
| 957 | Ga0451576_1068463 | 3300045051 | Bacteria | 845 |
| 958 | Ga0451576_1209917 | 3300045051 | Bacteria | 789 |
| 959 | Ga0466958_0018139 | 3300045836 | Bacteria | 4079 |
| 960 | Ga0466958_0148741 | 3300045836 | Bacteria | 1477 |
| 961 | Ga0466958_0189949 | 3300045836 | Bacteria | 1305 |
| 962 | Ga0466958_0319408 | 3300045836 | Unclassified | 998 |
| 963 | Ga0466958_0579904 | 3300045836 | Bacteria | 729 |
| 964 | Ga0466967_0001298 | 3300045976 | Bacteria | 14250 |
| 965 | Ga0466967_0007522 | 3300045976 | Bacteria | 7869 |
| 966 | Ga0466967_0070250 | 3300045976 | Bacteria | 3132 |
| 967 | Ga0466967_0119616 | 3300045976 | Unclassified | 2431 |
| 968 | Ga0466967_0150997 | 3300045976 | Unclassified | 2171 |
| 969 | Ga0466967_0208456 | 3300045976 | Bacteria | 1853 |
| 970 | Ga0466967_0352802 | 3300045976 | Bacteria | 1424 |
| 971 | Ga0466967_0435095 | 3300045976 | Bacteria | 1280 |
| 972 | Ga0466967_1212748 | 3300045976 | Bacteria | 752 |
| 973 | Ga0495629_0153744 | 3300046459 | Bacteria | 1599 |
| 974 | Ga0495629_0198735 | 3300046459 | Bacteria | 1386 |
| 975 | Ga0495651_0180618 | 3300046462 | Bacteria | 1494 |
| 976 | Ga0495580_0001084 | 3300046472 | Bacteria | 23894 |
| 977 | Ga0495580_0001209 | 3300046472 | Bacteria | 22740 |
| 978 | Ga0495580_0002030 | 3300046472 | Bacteria | 17811 |
| 979 | Ga0495580_0013824 | 3300046472 | Bacteria | 6146 |
| 980 | Ga0495580_0022266 | 3300046472 | Bacteria | 4665 |
| 981 | Ga0495580_0071927 | 3300046472 | Bacteria | 2416 |
| 982 | Ga0495580_0238748 | 3300046472 | Bacteria | 1246 |
| 983 | Ga0495580_0323558 | 3300046472 | Bacteria | 1048 |
| 984 | Ga0495580_0689260 | 3300046472 | Bacteria | 669 |
| 985 | Ga0495582_0001249 | 3300046473 | Bacteria | 14283 |
| 986 | Ga0495582_0005964 | 3300046473 | Bacteria | 6792 |
| 987 | Ga0495582_0162835 | 3300046473 | Bacteria | 1269 |
| 988 | Ga0495582_0243630 | 3300046473 | Bacteria | 1030 |
| 989 | Ga0495639_0088124 | 3300046475 | Bacteria | 1453 |
| 990 | Ga0495639_0188868 | 3300046475 | Bacteria | 1005 |
| 991 | Ga0495639_0263263 | 3300046475 | Bacteria | 854 |
| 992 | Ga0495662_0250245 | 3300046476 | Unclassified | 873 |
| 993 | Ga0495664_0045558 | 3300046477 | Bacteria | 2601 |
| 994 | Ga0495664_0124142 | 3300046477 | Bacteria | 1561 |
| 995 | Ga0495594_0011591 | 3300046499 | Bacteria | 4584 |
| 996 | Ga0495606_0225889 | 3300046507 | Bacteria | 1052 |
| 997 | Ga0495606_0263913 | 3300046507 | Bacteria | 949 |
| 998 | Ga0495608_0140966 | 3300046511 | Bacteria | 1538 |
| 999 | Ga0495608_0326312 | 3300046511 | Bacteria | 948 |
| 1000 | Ga0495630_0127662 | 3300046517 | Bacteria | 1930 |
| 1001 | Ga0495643_0022688 | 3300046522 | Bacteria | 3577 |
| 1002 | Ga0495665_0005328 | 3300046531 | Bacteria | 6930 |
| 1003 | Ga0495665_0021444 | 3300046531 | Bacteria | 3471 |
| 1004 | Ga0495665_0052401 | 3300046531 | Unclassified | 2160 |
| 1005 | Ga0495665_0067337 | 3300046531 | Bacteria | 1889 |
| 1006 | Ga0495665_0087833 | 3300046531 | Bacteria | 1634 |
| 1007 | Ga0495665_0250377 | 3300046531 | Unclassified | 912 |
| 1008 | Ga0495622_0076036 | 3300046557 | Bacteria | 1548 |
| 1009 | Ga0495667_0227907 | 3300046559 | Bacteria | 1188 |
| 1010 | Ga0495656_0060580 | 3300046615 | Bacteria | 1650 |
| 1011 | Ga0495668_0246029 | 3300046616 | Bacteria | 979 |
| 1012 | Ga0495625_0025076 | 3300046660 | Bacteria | 4527 |
| 1013 | Ga0495635_0141449 | 3300046663 | Bacteria | 1639 |
| 1014 | Ga0495659_0002349 | 3300046664 | Bacteria | 6109 |
| 1015 | Ga0495588_0291694 | 3300046674 | Bacteria | 859 |
| 1016 | Ga0495588_0437694 | 3300046674 | Bacteria | 686 |
| 1017 | Ga0495657_0247375 | 3300046675 | Bacteria | 1074 |
| 1018 | Ga0495657_0305658 | 3300046675 | Unclassified | 948 |
| 1019 | Ga0495657_0317654 | 3300046675 | Bacteria | 926 |
| 1020 | Ga0495599_0290322 | 3300046678 | Bacteria | 989 |
| 1021 | Ga0495623_0056265 | 3300046679 | Bacteria | 2476 |
| 1022 | Ga0495623_0135734 | 3300046679 | Bacteria | 1468 |
| 1023 | Ga0495623_0298431 | 3300046679 | Unclassified | 891 |
| 1024 | Ga0495623_0416915 | 3300046679 | Unclassified | 720 |
| 1025 | Ga0495658_0170604 | 3300046683 | Bacteria | 1346 |
| 1026 | Ga0495658_0296412 | 3300046683 | Bacteria | 1022 |
| 1027 | Ga0495669_0035537 | 3300046684 | Bacteria | 2200 |
| 1028 | Ga0495669_0225250 | 3300046684 | Unclassified | 899 |
| 1029 | Ga0495669_0384719 | 3300046684 | Bacteria | 679 |
| 1030 | Ga0495613_0002395 | 3300046689 | Bacteria | 14200 |
| 1031 | Ga0495613_0767043 | 3300046689 | Bacteria | 631 |
| 1032 | Ga0495649_0012383 | 3300046694 | Bacteria | 4965 |
| 1033 | Ga0495581_0101977 | 3300047315 | Bacteria | 1667 |
| 1034 | Ga0495636_0111760 | 3300047318 | Bacteria | 1203 |
| 1035 | Ga0495674_0457238 | 3300047319 | Bacteria | 1025 |
| 1036 | Ga0495674_0663367 | 3300047319 | Bacteria | 821 |
| 1037 | Ga0495676_0229278 | 3300047321 | Bacteria | 1276 |
| 1038 | Ga0495683_0038696 | 3300047323 | Bacteria | 2414 |
| 1039 | Ga0495675_0045855 | 3300047444 | Unclassified | 2784 |
| 1040 | Ga0495675_0125230 | 3300047444 | Bacteria | 1599 |
| 1041 | Ga0495684_0124046 | 3300047471 | Bacteria | 1944 |
| 1042 | Ga0495593_0193732 | 3300047673 | Bacteria | 1022 |
| 1043 | Ga0495602_0252774 | 3300048088 | Bacteria | 1312 |
| 1044 | Ga0495602_0348465 | 3300048088 | Unclassified | 1069 |
| 1045 | Ga0495614_0010578 | 3300048089 | Bacteria | 4068 |
| 1046 | Ga0496100_0150797 | 3300048903 | Bacteria | 1658 |
| 1047 | Ga0496101_0747996 | 3300048904 | Bacteria | 771 |
| 1048 | Ga0496101_0929613 | 3300048904 | Unclassified | 684 |
| 1049 | Ga0496102_0032273 | 3300048905 | Bacteria | 4705 |
| 1050 | Ga0496102_0201211 | 3300048905 | Bacteria | 1877 |
| 1051 | Ga0496102_0356990 | 3300048905 | Unclassified | 1376 |
| 1052 | Ga0496102_0416269 | 3300048905 | Bacteria | 1262 |
| 1053 | Ga0496103_0456048 | 3300048906 | Bacteria | 820 |
| 1054 | Ga0496104_0054494 | 3300048907 | Bacteria | 3780 |
| 1055 | Ga0496104_0073409 | 3300048907 | Bacteria | 3255 |
| 1056 | Ga0496104_0075975 | 3300048907 | Unclassified | 3199 |
| 1057 | Ga0496104_0161770 | 3300048907 | Bacteria | 2147 |
| 1058 | Ga0496104_0243639 | 3300048907 | Bacteria | 1710 |
| 1059 | Ga0496104_0314795 | 3300048907 | Bacteria | 1478 |
| 1060 | Ga0496104_0774529 | 3300048907 | Bacteria | 866 |
| 1061 | Ga0496104_1285055 | 3300048907 | Unclassified | 635 |
| 1062 | Ga0496105_0729509 | 3300048908 | Bacteria | 758 |
| 1063 | Ga0496106_0124154 | 3300048909 | Bacteria | 2020 |
| 1064 | Ga0496106_0219808 | 3300048909 | Bacteria | 1515 |
| 1065 | Ga0496108_0000038 | 3300048911 | Bacteria | 149482 |
| 1066 | Ga0496109_0000082 | 3300048912 | Bacteria | 99164 |
| 1067 | Ga0496109_0099379 | 3300048912 | Bacteria | 2699 |
| 1068 | Ga0496109_0164501 | 3300048912 | Bacteria | 2079 |
| 1069 | Ga0496109_0684208 | 3300048912 | Bacteria | 963 |
| 1070 | Ga0496109_1068779 | 3300048912 | Bacteria | 744 |
| 1071 | Ga0496110_0000195 | 3300048913 | Bacteria | 38261 |
| 1072 | Ga0496110_0077168 | 3300048913 | Bacteria | 2963 |
| 1073 | Ga0496110_0225750 | 3300048913 | Bacteria | 1703 |
| 1074 | Ga0496110_0542211 | 3300048913 | Unclassified | 1057 |
| 1075 | Ga0496111_0002758 | 3300048914 | Bacteria | 10684 |
| 1076 | Ga0496111_0008810 | 3300048914 | Bacteria | 6702 |
| 1077 | Ga0496112_0000032 | 3300048915 | Bacteria | 116962 |
| 1078 | Ga0496112_0001293 | 3300048915 | Bacteria | 19017 |
| 1079 | Ga0496112_0032363 | 3300048915 | Bacteria | 5078 |
| 1080 | Ga0496112_0057628 | 3300048915 | Bacteria | 3825 |
| 1081 | Ga0496112_0062423 | 3300048915 | Bacteria | 3675 |
| 1082 | Ga0496112_0067290 | 3300048915 | Bacteria | 3535 |
| 1083 | Ga0496112_0145945 | 3300048915 | Unclassified | 2334 |
| 1084 | Ga0496112_0151886 | 3300048915 | Bacteria | 2283 |
| 1085 | Ga0496112_0313995 | 3300048915 | Unclassified | 1512 |
| 1086 | Ga0496112_0499326 | 3300048915 | Unclassified | 1152 |
| 1087 | Ga0496112_0800059 | 3300048915 | Bacteria | 868 |
| 1088 | Ga0496113_0000094 | 3300048916 | Bacteria | 38512 |
| 1089 | Ga0496113_0036480 | 3300048916 | Unclassified | 3602 |
| 1090 | Ga0496113_0038073 | 3300048916 | Bacteria | 3534 |
| 1091 | Ga0496115_0009730 | 3300048918 | Bacteria | 7159 |
| 1092 | Ga0496115_0019473 | 3300048918 | Bacteria | 5222 |
| 1093 | Ga0496115_0163263 | 3300048918 | Bacteria | 1842 |
| 1094 | Ga0496115_0204328 | 3300048918 | Unclassified | 1632 |
| 1095 | Ga0496115_0599531 | 3300048918 | Unclassified | 876 |
| 1096 | Ga0495682_0010495 | 3300049460 | Bacteria | 3586 |
| 1097 | Ga0501293_007088 | 3300049516 | Bacteria | 924 |
| 1098 | Ga0501299_070855 | 3300049522 | Bacteria | 756 |
| 1099 | Ga0501300_006705 | 3300049523 | Bacteria | 1692 |
| 1100 | Ga0501233_020731 | 3300049668 | Bacteria | 1405 |
| 1101 | Ga0501271_040855 | 3300049768 | Bacteria | 604 |
| 1102 | nmdc:mga05p37_196867_c1 | 3300050507 | Bacteria | 2443 |
| 1103 | nmdc:mga0n895_1076829_c1 | 3300050512 | Bacteria | 782 |
| 1104 | nmdc:mga0n895_2935_c1 | 3300050512 | Bacteria | 13530 |
| 1105 | nmdc:mga0n895_31_c1 | 3300050512 | Bacteria | 81579 |
| 1106 | nmdc:mga0n895_40130_c1 | 3300050512 | Bacteria | 4546 |
| 1107 | nmdc:mga0n895_602194_c1 | 3300050512 | Bacteria | 1101 |
| 1108 | nmdc:mga0rr50_138451_c1 | 3300050513 | Bacteria | 1956 |
| 1109 | nmdc:mga0rr50_1416_c1 | 3300050513 | Bacteria | 13144 |
| 1110 | nmdc:mga0rr50_292208_c1 | 3300050513 | Bacteria | 1362 |
| 1111 | nmdc:mga0rr50_355538_c1 | 3300050513 | Unclassified | 1232 |
| 1112 | nmdc:mga0rr50_437849_c1 | 3300050513 | Unclassified | 1107 |
| 1113 | nmdc:mga0rr50_451970_c1 | 3300050513 | Bacteria | 1089 |
| 1114 | nmdc:mga0rr50_777501_c1 | 3300050513 | Unclassified | 817 |
| 1115 | nmdc:mga08x19_1455_c1 | 3300050514 | Bacteria | 14656 |
| 1116 | nmdc:mga08x19_16655_c2 | 3300050514 | Bacteria | 4167 |
| 1117 | nmdc:mga08x19_200950_c1 | 3300050514 | Bacteria | 1366 |
| 1118 | nmdc:mga08x19_284573_c1 | 3300050514 | Bacteria | 1146 |
| 1119 | nmdc:mga08x19_5358_c1 | 3300050514 | Bacteria | 7584 |
| 1120 | nmdc:mga08x19_65722_c1 | 3300050514 | Bacteria | 2356 |
| 1121 | nmdc:mga0a205_1702_c1 | 3300050515 | Bacteria | 18992 |
| 1122 | nmdc:mga0a205_562_c1 | 3300050515 | Bacteria | 29493 |
| 1123 | Ga0495601_0171732 | 3300053077 | Unclassified | 1417 |
| 1124 | Ga0495601_0504176 | 3300053077 | Unclassified | 781 |
| 1125 | Ga0495612_0158105 | 3300053078 | Bacteria | 989 |
| 1126 | Ga0501084_0166535 | 3300054114 | Bacteria | 1860 |
| 1127 | Ga0587069_036659 | 3300059642 | Bacteria | 819 |
| 1128 | Ga0587107_023162 | 3300059652 | Bacteria | 885 |
| 1129 | Ga0501082_0035560 | 3300060353 | Bacteria | 4294 |
| 1130 | Ga0466962_0111067 | 3300061719 | Bacteria | 1320 |
| 1131 | nmdc:mga08x19_185444_c1 | |||
| 1132 | MRS1b_contig_2926443 | |||
| 1133 | JGI24752J21851_1004409 | |||
| 1134 | JGI24737J22298_10021840 | |||
| 1135 | JGI24034J26672_10009286 | |||
| 1136 | JGI24751J29686_10000539 | |||
| 1137 | rootH2_10166807 | |||
| 1138 | rootH1_10207098 | |||
| 1139 | Ga0058863_10015630 | |||
| 1140 | Ga0058861_11818347 | |||
| 1141 | Ga0058862_12695550 | |||
| 1142 | Ga0065712_10073970 | |||
| 1143 | Ga0065712_10097702 | |||
| 1144 | Ga0065715_10155513 | |||
| 1145 | Ga0065715_10181645 | |||
| 1146 | Ga0070658_10023393 | |||
| 1147 | Ga0070683_100022906 | |||
| 1148 | Ga0070683_100043047 | |||
| 1149 | Ga0070683_100109812 | |||
| 1150 | Ga0070683_100338193 | |||
| 1151 | Ga0070690_100807264 | |||
| 1152 | Ga0070670_100006314 | |||
| 1153 | Ga0070670_100215766 | |||
| 1154 | Ga0070670_100264093 | |||
| 1155 | Ga0070677_10001451 | |||
| 1156 | Ga0068869_100026030 | |||
| 1157 | Ga0068869_100031914 | |||
| 1158 | Ga0068869_100226036 | |||
| 1159 | Ga0070666_10016274 | |||
| 1160 | Ga0070666_10211616 | |||
| 1161 | Ga0070680_100010401 | |||
| 1162 | Ga0070680_100018751 | |||
| 1163 | Ga0070680_100070274 | |||
| 1164 | Ga0070680_100427872 | |||
| 1165 | Ga0070680_100880513 | |||
| 1166 | Ga0070682_100044123 | |||
| 1167 | Ga0068868_100000808 | |||
| 1168 | Ga0068868_100012242 | |||
| 1169 | Ga0068868_100019290 | |||
| 1170 | Ga0068868_100041359 | |||
| 1171 | Ga0068868_100055888 | |||
| 1172 | Ga0068868_100069378 | |||
| 1173 | Ga0068868_100170325 | |||
| 1174 | Ga0070660_100000311 | |||
| 1175 | Ga0070660_100003019 | |||
| 1176 | Ga0070660_100634285 | |||
| 1177 | Ga0070689_100026004 | |||
| 1178 | Ga0070689_100288435 | |||
| 1179 | Ga0070691_10021433 | |||
| 1180 | Ga0070687_100073980 | |||
| 1181 | Ga0070687_100186609 | |||
| 1182 | Ga0070661_100098261 | |||
| 1183 | Ga0070661_101025100 | |||
| 1184 | Ga0070668_100232715 | |||
| 1185 | Ga0070669_100159173 | |||
| 1186 | Ga0070669_100773762 | |||
| 1187 | Ga0070675_100009309 | |||
| 1188 | Ga0070675_100249752 | |||
| 1189 | Ga0070671_100004796 | |||
| 1190 | Ga0070671_100068392 | |||
| 1191 | Ga0070671_100125778 | |||
| 1192 | Ga0070671_101134108 | |||
| 1193 | Ga0070673_100195577 | |||
| 1194 | Ga0070673_101084975 | |||
| 1195 | Ga0070688_100000311 | |||
| 1196 | Ga0070659_100005680 | |||
| 1197 | Ga0070659_100025393 | |||
| 1198 | Ga0070659_100071192 | |||
| 1199 | Ga0070709_10003427 | |||
| 1200 | Ga0070709_10003845 | |||
| 1201 | Ga0070709_10055665 | |||
| 1202 | Ga0070709_10145981 | |||
| 1203 | Ga0070709_10226109 | |||
| 1204 | Ga0070709_10320656 | |||
| 1205 | Ga0070709_10508593 | |||
| 1206 | Ga0070709_10563513 | |||
| 1207 | Ga0070709_10678442 | |||
| 1208 | Ga0070714_100001016 | |||
| 1209 | Ga0070714_100025849 | |||
| 1210 | Ga0070714_100044070 | |||
| 1211 | Ga0070714_100052502 | |||
| 1212 | Ga0070714_100219435 | |||
| 1213 | Ga0070714_100229763 | |||
| 1214 | Ga0070714_100246563 | |||
| 1215 | Ga0070714_100379295 | |||
| 1216 | Ga0070714_100384918 | |||
| 1217 | Ga0070714_100529095 | |||
| 1218 | Ga0070714_100674479 | |||
| 1219 | Ga0070714_101031488 | |||
| 1220 | Ga0070714_101033029 | |||
| 1221 | Ga0070714_101548597 | |||
| 1222 | Ga0070713_100000460 | |||
| 1223 | Ga0070713_100000863 | |||
| 1224 | Ga0070713_100009985 | |||
| 1225 | Ga0070713_100012863 | |||
| 1226 | Ga0070713_100022236 | |||
| 1227 | Ga0070713_100035831 | |||
| 1228 | Ga0070713_100047278 | |||
| 1229 | Ga0070713_100055567 | |||
| 1230 | Ga0070713_100083204 | |||
| 1231 | Ga0070713_100104832 | |||
| 1232 | Ga0070713_100121693 | |||
| 1233 | Ga0070713_100219920 | |||
| 1234 | Ga0070713_100231593 | |||
| 1235 | Ga0070713_100235254 | |||
| 1236 | Ga0070713_100244780 | |||
| 1237 | Ga0070713_100306328 | |||
| 1238 | Ga0070713_100372196 | |||
| 1239 | Ga0070713_100407609 | |||
| 1240 | Ga0070713_100413271 | |||
| 1241 | Ga0070713_100453431 | |||
| 1242 | Ga0070713_100485707 | |||
| 1243 | Ga0070710_10007216 | |||
| 1244 | Ga0070710_10110128 | |||
| 1245 | Ga0070710_10190600 | |||
| 1246 | Ga0070710_10267437 | |||
| 1247 | Ga0070711_100000656 | |||
| 1248 | Ga0070711_100022448 | |||
| 1249 | Ga0070711_100063439 | |||
| 1250 | Ga0070711_100089520 | |||
| 1251 | Ga0070711_100128912 | |||
| 1252 | Ga0070711_100394033 | |||
| 1253 | Ga0070711_100953105 | |||
| 1254 | Ga0070708_100002306 | |||
| 1255 | Ga0070708_100022528 | |||
| 1256 | Ga0070708_100038532 | |||
| 1257 | Ga0070708_100074972 | |||
| 1258 | Ga0070708_100120276 | |||
| 1259 | Ga0070708_100487318 | |||
| 1260 | Ga0070708_100845443 | |||
| 1261 | Ga0070663_100176318 | |||
| 1262 | Ga0070678_100237862 | |||
| 1263 | Ga0070678_100321402 | |||
| 1264 | Ga0070662_100057613 | |||
| 1265 | Ga0070662_100950663 | |||
| 1266 | Ga0070681_10000304 | |||
| 1267 | Ga0070681_10000804 | |||
| 1268 | Ga0070681_10012167 | |||
| 1269 | Ga0070681_10031578 | |||
| 1270 | Ga0070681_10041573 | |||
| 1271 | Ga0070681_10056600 | |||
| 1272 | Ga0070681_10175459 | |||
| 1273 | Ga0070681_10208763 | |||
| 1274 | Ga0070681_10213647 | |||
| 1275 | Ga0070681_10317009 | |||
| 1276 | Ga0070681_10393837 | |||
| 1277 | Ga0070681_10507145 | |||
| 1278 | Ga0070681_10612933 | |||
| 1279 | Ga0068867_100073940 | |||
| 1280 | Ga0068867_100254141 | |||
| 1281 | Ga0068867_100949769 | |||
| 1282 | Ga0070706_100001345 | |||
| 1283 | Ga0070706_100001630 | |||
| 1284 | Ga0070706_100005850 | |||
| 1285 | Ga0070706_100006393 | |||
| 1286 | Ga0070706_100020891 | |||
| 1287 | Ga0070706_100342903 | |||
| 1288 | Ga0070707_100001066 | |||
| 1289 | Ga0070707_100003999 | |||
| 1290 | Ga0070707_100021280 | |||
| 1291 | Ga0070707_100028348 | |||
| 1292 | Ga0070707_100158512 | |||
| 1293 | Ga0070707_100164194 | |||
| 1294 | Ga0070707_100288346 | |||
| 1295 | Ga0070707_100338552 | |||
| 1296 | Ga0070707_100596575 | |||
| 1297 | Ga0070698_100000247 | |||
| 1298 | Ga0070698_100001098 | |||
| 1299 | Ga0070698_100020529 | |||
| 1300 | Ga0070698_100105362 | |||
| 1301 | Ga0070698_100709849 | |||
| 1302 | Ga0070699_100002044 | |||
| 1303 | Ga0070699_100004004 | |||
| 1304 | Ga0070699_100023250 | |||
| 1305 | Ga0070699_100027660 | |||
| 1306 | Ga0070699_100877918 | |||
| 1307 | Ga0070679_100014420 | |||
| 1308 | Ga0070679_100024151 | |||
| 1309 | Ga0070679_100067059 | |||
| 1310 | Ga0070679_100312675 | |||
| 1311 | Ga0070679_100336724 | |||
| 1312 | Ga0070679_100781920 | |||
| 1313 | Ga0070684_100001116 | |||
| 1314 | Ga0070684_100003411 | |||
| 1315 | Ga0070684_100063033 | |||
| 1316 | Ga0070684_100076893 | |||
| 1317 | Ga0070684_100484636 | |||
| 1318 | Ga0070684_100516914 | |||
| 1319 | Ga0070697_100000463 | |||
| 1320 | Ga0070697_100000758 | |||
| 1321 | Ga0070697_100004218 | |||
| 1322 | Ga0070697_100005905 | |||
| 1323 | Ga0070697_100011766 | |||
| 1324 | Ga0070697_100016515 | |||
| 1325 | Ga0070697_100017118 | |||
| 1326 | Ga0070697_100229408 | |||
| 1327 | Ga0070697_100875742 | |||
| 1328 | Ga0068853_100029743 | |||
| 1329 | Ga0068853_100078145 | |||
| 1330 | Ga0068853_100208413 | |||
| 1331 | Ga0068853_100365811 | |||
| 1332 | Ga0070672_100004674 | |||
| 1333 | Ga0070686_100059757 | |||
| 1334 | Ga0070695_100264147 | |||
| 1335 | Ga0070693_100023182 | |||
| 1336 | Ga0070693_100035108 | |||
| 1337 | Ga0070693_100051789 | |||
| 1338 | Ga0070693_100396859 | |||
| 1339 | Ga0070693_100862530 | |||
| 1340 | Ga0070665_100007099 | |||
| 1341 | Ga0070665_100259765 | |||
| 1342 | Ga0070665_100429823 | |||
| 1343 | Ga0068855_100000563 | |||
| 1344 | Ga0068855_100004163 | |||
| 1345 | Ga0068855_100011625 | |||
| 1346 | Ga0068855_100012802 | |||
| 1347 | Ga0068855_100043564 | |||
| 1348 | Ga0068855_100049412 | |||
| 1349 | Ga0068855_100059059 | |||
| 1350 | Ga0068855_100139903 | |||
| 1351 | Ga0068855_100235912 | |||
| 1352 | Ga0068855_100252692 | |||
| 1353 | Ga0068855_100410746 | |||
| 1354 | Ga0068855_100418114 | |||
| 1355 | Ga0070664_100000879 | |||
| 1356 | Ga0070664_100027623 | |||
| 1357 | Ga0070664_100188302 | |||
| 1358 | Ga0070664_100467501 | |||
| 1359 | Ga0070664_101167491 | |||
| 1360 | Ga0068857_100000022 | |||
| 1361 | Ga0068857_100000880 | |||
| 1362 | Ga0068857_100002691 | |||
| 1363 | Ga0068857_100055123 | |||
| 1364 | Ga0068857_100137570 | |||
| 1365 | Ga0068857_100427623 | |||
| 1366 | Ga0068857_100991849 | |||
| 1367 | Ga0068854_100009080 | |||
| 1368 | Ga0068854_100058520 | |||
| 1369 | Ga0068854_100428803 | |||
| 1370 | Ga0068854_100583818 | |||
| 1371 | Ga0068856_100000448 | |||
| 1372 | Ga0068856_100002645 | |||
| 1373 | Ga0068856_100023133 | |||
| 1374 | Ga0068856_100025330 | |||
| 1375 | Ga0068856_100029764 | |||
| 1376 | Ga0068856_100053508 | |||
| 1377 | Ga0068856_100172826 | |||
| 1378 | Ga0068856_100189611 | |||
| 1379 | Ga0068856_100228017 | |||
| 1380 | Ga0068856_100266573 | |||
| 1381 | Ga0068856_100768003 | |||
| 1382 | Ga0068856_101372361 | |||
| 1383 | Ga0070702_100111738 | |||
| 1384 | Ga0070702_100448427 | |||
| 1385 | Ga0070702_100570247 | |||
| 1386 | Ga0068852_100028082 | |||
| 1387 | Ga0068852_100037467 | |||
| 1388 | Ga0068852_100053376 | |||
| 1389 | Ga0068852_100247218 | |||
| 1390 | Ga0068859_100000885 | |||
| 1391 | Ga0068859_100199301 | |||
| 1392 | Ga0068864_100007383 | |||
| 1393 | Ga0068864_100013662 | |||
| 1394 | Ga0068864_100139812 | |||
| 1395 | Ga0068864_100150760 | |||
| 1396 | Ga0068864_100516958 | |||
| 1397 | Ga0068866_10006754 | |||
| 1398 | Ga0068866_10038191 | |||
| 1399 | Ga0068866_10210292 | |||
| 1400 | Ga0068866_10270163 | |||
| 1401 | Ga0068861_100760985 | |||
| 1402 | Ga0068851_10339463 | |||
| 1403 | Ga0068851_10518329 | |||
| 1404 | Ga0068870_10000641 | |||
| 1405 | Ga0068863_100012164 | |||
| 1406 | Ga0068863_100037948 | |||
| 1407 | Ga0068863_100082470 | |||
| 1408 | Ga0068863_100253000 | |||
| 1409 | Ga0068863_101040830 | |||
| 1410 | Ga0068858_100004455 | |||
| 1411 | Ga0068858_100047139 | |||
| 1412 | Ga0068858_100070184 | |||
| 1413 | Ga0068860_100005346 | |||
| 1414 | Ga0068860_100163095 | |||
| 1415 | Ga0068860_100535099 | |||
| 1416 | Ga0068862_100026563 | |||
| 1417 | Ga0081540_1024261 | |||
| 1418 | Ga0070717_10002868 | |||
| 1419 | Ga0070717_10011716 | |||
| 1420 | Ga0070717_10012576 | |||
| 1421 | Ga0070717_10014948 | |||
| 1422 | Ga0070717_10027218 | |||
| 1423 | Ga0070717_10056258 | |||
| 1424 | Ga0070717_10067301 | |||
| 1425 | Ga0070717_10070734 | |||
| 1426 | Ga0070717_10150529 | |||
| 1427 | Ga0070717_10166834 | |||
| 1428 | Ga0070717_10231654 | |||
| 1429 | Ga0070717_10374817 | |||
| 1430 | Ga0070717_10407691 | |||
| 1431 | Ga0070717_10434388 | |||
| 1432 | Ga0070717_10770460 | |||
| 1433 | Ga0070715_10003724 | |||
| 1434 | Ga0070715_10006827 | |||
| 1435 | Ga0070715_10061334 | |||
| 1436 | Ga0070715_10103761 | |||
| 1437 | Ga0070716_100000337 | |||
| 1438 | Ga0070716_100005134 | |||
| 1439 | Ga0070716_100076275 | |||
| 1440 | Ga0070716_100101316 | |||
| 1441 | Ga0070716_100881452 | |||
| 1442 | Ga0070712_100000117 | |||
| 1443 | Ga0070712_100001060 | |||
| 1444 | Ga0070712_100003616 | |||
| 1445 | Ga0070712_100016517 | |||
| 1446 | Ga0070712_100022864 | |||
| 1447 | Ga0070712_100046445 | |||
| 1448 | Ga0070712_100068359 | |||
| 1449 | Ga0070712_100179972 | |||
| 1450 | Ga0070712_100245775 | |||
| 1451 | Ga0070712_100249283 | |||
| 1452 | Ga0070712_100256615 | |||
| 1453 | Ga0070712_100456631 | |||
| 1454 | Ga0070712_100529470 | |||
| 1455 | Ga0070712_100688103 | |||
| 1456 | Ga0097621_100000279 | |||
| 1457 | Ga0097621_100000712 | |||
| 1458 | Ga0097621_100002496 | |||
| 1459 | Ga0097621_100282120 | |||
| 1460 | Ga0097621_100785347 | |||
| 1461 | Ga0068871_100000304 | |||
| 1462 | Ga0068871_100001868 | |||
| 1463 | Ga0068871_100037189 | |||
| 1464 | Ga0068871_100161874 | |||
| 1465 | Ga0068871_100218018 | |||
| 1466 | Ga0068871_100263372 | |||
| 1467 | Ga0068871_100287775 | |||
| 1468 | Ga0075433_10006367 | |||
| 1469 | Ga0075433_10037506 | |||
| 1470 | Ga0075434_100000005 | |||
| 1471 | Ga0075434_100000969 | |||
| 1472 | Ga0075434_100041426 | |||
| 1473 | Ga0075434_100194236 | |||
| 1474 | Ga0068865_100009244 | |||
| 1475 | Ga0068865_100332053 | |||
| 1476 | Ga0075436_100007285 | |||
| 1477 | Ga0075436_100015313 | |||
| 1478 | Ga0075436_100015445 | |||
| 1479 | Ga0075436_100034652 | |||
| 1480 | Ga0075436_100082200 | |||
| 1481 | Ga0075436_100154951 | |||
| 1482 | Ga0075436_100163032 | |||
| 1483 | Ga0075436_100492305 | |||
| 1484 | Ga0097620_100000885 | |||
| 1485 | Ga0097620_100199331 | |||
| 1486 | Ga0075435_100003087 | |||
| 1487 | Ga0075435_100024980 | |||
| 1488 | Ga0075435_100025274 | |||
| 1489 | Ga0075435_100358707 | |||
| 1490 | Ga0075435_100438932 | |||
| 1491 | Ga0099795_10223978 | |||
| 1492 | Ga0105240_10002552 | |||
| 1493 | Ga0105240_10007213 | |||
| 1494 | Ga0105240_10059972 | |||
| 1495 | Ga0105240_10087608 | |||
| 1496 | Ga0105240_10164930 | |||
| 1497 | Ga0105240_10216653 | |||
| 1498 | Ga0105240_10447771 | |||
| 1499 | Ga0105240_10659300 | |||
| 1500 | Ga0105240_10686379 | |||
| 1501 | Ga0105240_11160122 | |||
| 1502 | Ga0105240_11476431 | |||
| 1503 | Ga0105245_10003405 | |||
| 1504 | Ga0105245_10044347 | |||
| 1505 | Ga0105245_10067028 | |||
| 1506 | Ga0105245_10371530 | |||
| 1507 | Ga0105247_10006854 | |||
| 1508 | Ga0114129_10022771 | |||
| 1509 | Ga0114129_10928432 | |||
| 1510 | Ga0114129_11471842 | |||
| 1511 | Ga0105241_10002278 | |||
| 1512 | Ga0105241_10014672 | |||
| 1513 | Ga0105241_10047441 | |||
| 1514 | Ga0105241_10103498 | |||
| 1515 | Ga0105241_10227672 | |||
| 1516 | Ga0105241_10228395 | |||
| 1517 | Ga0105241_10293617 | |||
| 1518 | Ga0105241_10530602 | |||
| 1519 | Ga0105242_10024992 | |||
| 1520 | Ga0105242_10537825 | |||
| 1521 | Ga0105248_10031636 | |||
| 1522 | Ga0105248_10043691 | |||
| 1523 | Ga0105248_10095323 | |||
| 1524 | Ga0105248_10394575 | |||
| 1525 | Ga0105248_10675500 | |||
| 1526 | Ga0105237_10019037 | |||
| 1527 | Ga0105237_10257336 | |||
| 1528 | Ga0105237_10296892 | |||
| 1529 | Ga0105237_10298370 | |||
| 1530 | Ga0105237_10923841 | |||
| 1531 | Ga0105237_11421464 | |||
| 1532 | Ga0105238_10002919 | |||
| 1533 | Ga0105238_10041603 | |||
| 1534 | Ga0105238_10104051 | |||
| 1535 | Ga0105238_10212205 | |||
| 1536 | Ga0105249_10044335 | |||
| 1537 | Ga0105249_10542083 | |||
| 1538 | Ga0105249_11136323 | |||
| 1539 | Ga0099796_10048775 | |||
| 1540 | Ga0105239_10017824 | |||
| 1541 | Ga0105239_10080832 | |||
| 1542 | Ga0105239_10081568 | |||
| 1543 | Ga0105239_10199907 | |||
| 1544 | Ga0105239_10271004 | |||
| 1545 | Ga0105239_11288240 | |||
| 1546 | Ga0105246_10003185 | |||
| 1547 | Ga0157373_10067274 | |||
| 1548 | Ga0157373_10113101 | |||
| 1549 | Ga0157373_10259488 | |||
| 1550 | Ga0157373_10326479 | |||
| 1551 | Ga0157371_10172086 | |||
| 1552 | Ga0157370_10033829 | |||
| 1553 | Ga0157370_10094369 | |||
| 1554 | Ga0157370_10105410 | |||
| 1555 | Ga0157369_10000243 | |||
| 1556 | Ga0157369_10002120 | |||
| 1557 | Ga0157369_10009538 | |||
| 1558 | Ga0157369_10019842 | |||
| 1559 | Ga0157369_10045930 | |||
| 1560 | Ga0157369_10050031 | |||
| 1561 | Ga0157369_10074211 | |||
| 1562 | Ga0157369_10076892 | |||
| 1563 | Ga0157369_10094000 | |||
| 1564 | Ga0157369_10236466 | |||
| 1565 | Ga0157369_10241931 | |||
| 1566 | Ga0157369_10385930 | |||
| 1567 | Ga0157369_10609448 | |||
| 1568 | Ga0157374_10001216 | |||
| 1569 | Ga0157374_10001860 | |||
| 1570 | Ga0157374_10011248 | |||
| 1571 | Ga0157374_10024826 | |||
| 1572 | Ga0157374_10234055 | |||
| 1573 | Ga0157374_10435143 | |||
| 1574 | Ga0157374_10445337 | |||
| 1575 | Ga0157374_10543456 | |||
| 1576 | Ga0157374_10665714 | |||
| 1577 | Ga0157374_10788276 | |||
| 1578 | Ga0157378_10000325 | |||
| 1579 | Ga0157378_10000925 | |||
| 1580 | Ga0157378_10001581 | |||
| 1581 | Ga0163162_10027862 | |||
| 1582 | Ga0163162_10082571 | |||
| 1583 | Ga0157372_10004045 | |||
| 1584 | Ga0157372_10005315 | |||
| 1585 | Ga0157372_10015124 | |||
| 1586 | Ga0157372_10015924 | |||
| 1587 | Ga0157372_10037114 | |||
| 1588 | Ga0157372_10073579 | |||
| 1589 | Ga0157372_10492405 | |||
| 1590 | Ga0157372_11241877 | |||
| 1591 | Ga0157372_11325405 | |||
| 1592 | Ga0157372_11515255 | |||
| 1593 | Ga0157375_10738840 | |||
| 1594 | Ga0157375_11552976 | |||
| 1595 | Ga0163163_10001425 | |||
| 1596 | Ga0163163_10018723 | |||
| 1597 | Ga0163163_10107681 | |||
| 1598 | Ga0163163_10679059 | |||
| 1599 | Ga0163163_10946111 | |||
| 1600 | Ga0163163_11077830 | |||
| 1601 | Ga0157380_10100323 | |||
| 1602 | Ga0182008_10006237 | |||
| 1603 | Ga0182008_10051708 | |||
| 1604 | Ga0182008_10209395 | |||
| 1605 | Ga0157377_10000286 | |||
| 1606 | Ga0157379_10001394 | |||
| 1607 | Ga0157379_10906224 | |||
| 1608 | Ga0157376_10001475 | |||
| 1609 | Ga0157376_10015440 | |||
| 1610 | Ga0182006_1159862 | |||
| 1611 | Ga0182007_10004788 | |||
| 1612 | Ga0182005_1008641 | |||
| 1613 | Ga0163161_10001313 | |||
| 1614 | Ga0197907_10220925 | |||
| 1615 | Ga0206350_10573770 | |||
| 1616 | Ga0213874_10040258 | |||
| 1617 | Ga0213874_10040613 | |||
| 1618 | Ga0213874_10054554 | |||
| 1619 | Ga0224712_10305312 | |||
| 1620 | Ga0224569_101258 | |||
| 1621 | Ga0224571_101242 | |||
| 1622 | Ga0224572_1003199 | |||
| 1623 | Ga0224572_1008880 | |||
| 1624 | Ga0224572_1013734 | |||
| 1625 | Ga0224572_1031482 | |||
| 1626 | Ga0228598_1000263 | |||
| 1627 | Ga0228598_1002110 | |||
| 1628 | Ga0228598_1003378 | |||
| 1629 | Ga0207426_1074058 | |||
| 1630 | Ga0207697_10002666 | |||
| 1631 | Ga0207697_10207581 | |||
| 1632 | Ga0207656_10100183 | |||
| 1633 | Ga0207682_10002185 | |||
| 1634 | Ga0207692_10010027 | |||
| 1635 | Ga0207692_10015954 | |||
| 1636 | Ga0207692_10047958 | |||
| 1637 | Ga0207692_10058174 | |||
| 1638 | Ga0207692_10111873 | |||
| 1639 | Ga0207692_10115646 | |||
| 1640 | Ga0207692_10149360 | |||
| 1641 | Ga0207692_10228683 | |||
| 1642 | Ga0207642_10155439 | |||
| 1643 | Ga0207642_10344192 | |||
| 1644 | Ga0207710_10185767 | |||
| 1645 | Ga0207688_10005547 | |||
| 1646 | Ga0207688_10417374 | |||
| 1647 | Ga0207680_10053144 | |||
| 1648 | Ga0207680_10060920 | |||
| 1649 | Ga0207647_10004334 | |||
| 1650 | Ga0207647_10013289 | |||
| 1651 | Ga0207647_10051423 | |||
| 1652 | Ga0207685_10005994 | |||
| 1653 | Ga0207685_10025564 | |||
| 1654 | Ga0207699_10001626 | |||
| 1655 | Ga0207699_10007448 | |||
| 1656 | Ga0207699_10088650 | |||
| 1657 | Ga0207699_10092673 | |||
| 1658 | Ga0207699_10213230 | |||
| 1659 | Ga0207699_10425255 | |||
| 1660 | Ga0207699_10437583 | |||
| 1661 | Ga0207699_10489705 | |||
| 1662 | Ga0207699_10492797 | |||
| 1663 | Ga0207699_10543877 | |||
| 1664 | Ga0207699_10552193 | |||
| 1665 | Ga0207645_10000781 | |||
| 1666 | Ga0207643_10001078 | |||
| 1667 | Ga0207705_10079407 | |||
| 1668 | Ga0207705_10200191 | |||
| 1669 | Ga0207684_10000081 | |||
| 1670 | Ga0207684_10000762 | |||
| 1671 | Ga0207684_10007088 | |||
| 1672 | Ga0207684_10014384 | |||
| 1673 | Ga0207684_10079249 | |||
| 1674 | Ga0207684_10087488 | |||
| 1675 | Ga0207684_10267387 | |||
| 1676 | Ga0207684_10624608 | |||
| 1677 | Ga0207654_10077294 | |||
| 1678 | Ga0207654_10715517 | |||
| 1679 | Ga0207707_10001814 | |||
| 1680 | Ga0207707_10002624 | |||
| 1681 | Ga0207707_10004912 | |||
| 1682 | Ga0207707_10011466 | |||
| 1683 | Ga0207707_10012005 | |||
| 1684 | Ga0207707_10024968 | |||
| 1685 | Ga0207707_10044157 | |||
| 1686 | Ga0207707_10048740 | |||
| 1687 | Ga0207707_10090931 | |||
| 1688 | Ga0207707_10096339 | |||
| 1689 | Ga0207707_10153392 | |||
| 1690 | Ga0207707_10265629 | |||
| 1691 | Ga0207695_10001570 | |||
| 1692 | Ga0207695_10020694 | |||
| 1693 | Ga0207695_10023851 | |||
| 1694 | Ga0207695_10081445 | |||
| 1695 | Ga0207695_10085477 | |||
| 1696 | Ga0207695_10126032 | |||
| 1697 | Ga0207695_10220829 | |||
| 1698 | Ga0207695_11000864 | |||
| 1699 | Ga0207671_10186478 | |||
| 1700 | Ga0207671_10424299 | |||
| 1701 | Ga0207693_10000019 | |||
| 1702 | Ga0207693_10000158 | |||
| 1703 | Ga0207693_10004951 | |||
| 1704 | Ga0207693_10005955 | |||
| 1705 | Ga0207693_10010174 | |||
| 1706 | Ga0207693_10016464 | |||
| 1707 | Ga0207693_10017284 | |||
| 1708 | Ga0207693_10026910 | |||
| 1709 | Ga0207693_10056311 | |||
| 1710 | Ga0207693_10162560 | |||
| 1711 | Ga0207693_10184687 | |||
| 1712 | Ga0207693_10237810 | |||
| 1713 | Ga0207693_10423031 | |||
| 1714 | Ga0207693_10806600 | |||
| 1715 | Ga0207663_10000394 | |||
| 1716 | Ga0207663_10003222 | |||
| 1717 | Ga0207663_10032413 | |||
| 1718 | Ga0207663_10064412 | |||
| 1719 | Ga0207663_10123226 | |||
| 1720 | Ga0207663_10146699 | |||
| 1721 | Ga0207663_10197602 | |||
| 1722 | Ga0207663_10453994 | |||
| 1723 | Ga0207660_10004717 | |||
| 1724 | Ga0207660_10030153 | |||
| 1725 | Ga0207660_10099605 | |||
| 1726 | Ga0207660_10472762 | |||
| 1727 | Ga0207660_10812024 | |||
| 1728 | Ga0207662_10004934 | |||
| 1729 | Ga0207657_10000311 | |||
| 1730 | Ga0207657_10001224 | |||
| 1731 | Ga0207657_10013003 | |||
| 1732 | Ga0207649_10002645 | |||
| 1733 | Ga0207649_10285714 | |||
| 1734 | Ga0207649_10379415 | |||
| 1735 | Ga0207649_10398888 | |||
| 1736 | Ga0207649_10910217 | |||
| 1737 | Ga0207652_10008939 | |||
| 1738 | Ga0207652_10066816 | |||
| 1739 | Ga0207652_10322451 | |||
| 1740 | Ga0207652_10510132 | |||
| 1741 | Ga0207652_10539200 | |||
| 1742 | Ga0207646_10000334 | |||
| 1743 | Ga0207646_10004011 | |||
| 1744 | Ga0207646_10005419 | |||
| 1745 | Ga0207646_10008546 | |||
| 1746 | Ga0207646_10014759 | |||
| 1747 | Ga0207646_10025466 | |||
| 1748 | Ga0207646_10089627 | |||
| 1749 | Ga0207646_10620516 | |||
| 1750 | Ga0207646_10682214 | |||
| 1751 | Ga0207681_10063854 | |||
| 1752 | Ga0207681_10893518 | |||
| 1753 | Ga0207694_10000896 | |||
| 1754 | Ga0207694_10026092 | |||
| 1755 | Ga0207694_10090793 | |||
| 1756 | Ga0207694_10124758 | |||
| 1757 | Ga0207694_10350570 | |||
| 1758 | Ga0207694_10641146 | |||
| 1759 | Ga0207650_10000063 | |||
| 1760 | Ga0207650_10040526 | |||
| 1761 | Ga0207650_10200591 | |||
| 1762 | Ga0207650_10270125 | |||
| 1763 | Ga0207659_10198885 | |||
| 1764 | Ga0207659_10486190 | |||
| 1765 | Ga0207687_10001952 | |||
| 1766 | Ga0207687_10041927 | |||
| 1767 | Ga0207687_10158728 | |||
| 1768 | Ga0207700_10000129 | |||
| 1769 | Ga0207700_10000233 | |||
| 1770 | Ga0207700_10000348 | |||
| 1771 | Ga0207700_10027210 | |||
| 1772 | Ga0207700_10042188 | |||
| 1773 | Ga0207700_10073121 | |||
| 1774 | Ga0207700_10084711 | |||
| 1775 | Ga0207700_10087348 | |||
| 1776 | Ga0207700_10110841 | |||
| 1777 | Ga0207700_10136524 | |||
| 1778 | Ga0207700_10221476 | |||
| 1779 | Ga0207700_10230801 | |||
| 1780 | Ga0207700_10279530 | |||
| 1781 | Ga0207700_10438623 | |||
| 1782 | Ga0207700_10497961 | |||
| 1783 | Ga0207700_10628283 | |||
| 1784 | Ga0207700_10675797 | |||
| 1785 | Ga0207700_10791731 | |||
| 1786 | Ga0207700_10950828 | |||
| 1787 | Ga0207664_10000284 | |||
| 1788 | Ga0207664_10022822 | |||
| 1789 | Ga0207664_10065466 | |||
| 1790 | Ga0207664_10104533 | |||
| 1791 | Ga0207664_10196730 | |||
| 1792 | Ga0207664_10278299 | |||
| 1793 | Ga0207664_10290809 | |||
| 1794 | Ga0207664_10357885 | |||
| 1795 | Ga0207664_10417528 | |||
| 1796 | Ga0207664_10770535 | |||
| 1797 | Ga0207644_10004369 | |||
| 1798 | Ga0207644_10037893 | |||
| 1799 | Ga0207644_10165591 | |||
| 1800 | Ga0207644_10803086 | |||
| 1801 | Ga0207644_10897068 | |||
| 1802 | Ga0207690_10507293 | |||
| 1803 | Ga0207690_10900353 | |||
| 1804 | Ga0207706_10001937 | |||
| 1805 | Ga0207706_10119693 | |||
| 1806 | Ga0207670_10099607 | |||
| 1807 | Ga0207670_10422801 | |||
| 1808 | Ga0207704_10271304 | |||
| 1809 | Ga0207665_10000109 | |||
| 1810 | Ga0207665_10013403 | |||
| 1811 | Ga0207665_10016509 | |||
| 1812 | Ga0207665_10086268 | |||
| 1813 | Ga0207665_10122953 | |||
| 1814 | Ga0207665_10124518 | |||
| 1815 | Ga0207665_10129107 | |||
| 1816 | Ga0207665_10201787 | |||
| 1817 | Ga0207665_10438103 | |||
| 1818 | Ga0207665_10739481 | |||
| 1819 | Ga0207665_10958087 | |||
| 1820 | Ga0207691_10001123 | |||
| 1821 | Ga0207711_10043977 | |||
| 1822 | Ga0207711_10115246 | |||
| 1823 | Ga0207711_10135993 | |||
| 1824 | Ga0207711_10542172 | |||
| 1825 | Ga0207689_10001298 | |||
| 1826 | Ga0207689_10130321 | |||
| 1827 | Ga0207689_10483165 | |||
| 1828 | Ga0207661_10000156 | |||
| 1829 | Ga0207661_10024048 | |||
| 1830 | Ga0207661_10053000 | |||
| 1831 | Ga0207661_10749830 | |||
| 1832 | Ga0207679_10000588 | |||
| 1833 | Ga0207679_10001790 | |||
| 1834 | Ga0207667_10000188 | |||
| 1835 | Ga0207667_10000302 | |||
| 1836 | Ga0207667_10009252 | |||
| 1837 | Ga0207667_10013037 | |||
| 1838 | Ga0207667_10027559 | |||
| 1839 | Ga0207667_10034008 | |||
| 1840 | Ga0207667_10081567 | |||
| 1841 | Ga0207667_10175356 | |||
| 1842 | Ga0207667_10352037 | |||
| 1843 | Ga0207667_10435883 | |||
| 1844 | Ga0207667_10524281 | |||
| 1845 | Ga0207667_10529480 | |||
| 1846 | Ga0207667_10811916 | |||
| 1847 | Ga0207667_10817611 | |||
| 1848 | Ga0207667_11027943 | |||
| 1849 | Ga0207651_10072540 | |||
| 1850 | Ga0207651_10082588 | |||
| 1851 | Ga0207651_10966899 | |||
| 1852 | Ga0207712_10100024 | |||
| 1853 | Ga0207668_10069067 | |||
| 1854 | Ga0207640_10006509 | |||
| 1855 | Ga0207640_10014840 | |||
| 1856 | Ga0207640_10070946 | |||
| 1857 | Ga0207640_10171438 | |||
| 1858 | Ga0207658_10320430 | |||
| 1859 | Ga0207658_10320467 | |||
| 1860 | Ga0207658_11403314 | |||
| 1861 | Ga0207677_10012203 | |||
| 1862 | Ga0207677_10018172 | |||
| 1863 | Ga0207677_10082030 | |||
| 1864 | Ga0207677_10098027 | |||
| 1865 | Ga0207677_10570310 | |||
| 1866 | Ga0207703_10001842 | |||
| 1867 | Ga0207703_10049928 | |||
| 1868 | Ga0207703_10137491 | |||
| 1869 | Ga0207703_10274595 | |||
| 1870 | Ga0207639_10117177 | |||
| 1871 | Ga0207639_10208331 | |||
| 1872 | Ga0207639_10255343 | |||
| 1873 | Ga0207639_10458632 | |||
| 1874 | Ga0207678_10000443 | |||
| 1875 | Ga0207702_10000120 | |||
| 1876 | Ga0207702_10001675 | |||
| 1877 | Ga0207702_10009760 | |||
| 1878 | Ga0207702_10036655 | |||
| 1879 | Ga0207702_10062637 | |||
| 1880 | Ga0207702_10083250 | |||
| 1881 | Ga0207702_10327015 | |||
| 1882 | Ga0207702_10521314 | |||
| 1883 | Ga0207702_10527538 | |||
| 1884 | Ga0207641_10000131 | |||
| 1885 | Ga0207641_10016212 | |||
| 1886 | Ga0207641_10072350 | |||
| 1887 | Ga0207641_10317002 | |||
| 1888 | Ga0207641_10895527 | |||
| 1889 | Ga0207648_10000403 | |||
| 1890 | Ga0207648_10091189 | |||
| 1891 | Ga0207676_10000517 | |||
| 1892 | Ga0207676_10002843 | |||
| 1893 | Ga0207676_10012744 | |||
| 1894 | Ga0207676_10017081 | |||
| 1895 | Ga0207676_10729253 | |||
| 1896 | Ga0207676_10936319 | |||
| 1897 | Ga0207674_10000056 | |||
| 1898 | Ga0207674_10000201 | |||
| 1899 | Ga0207674_10010860 | |||
| 1900 | Ga0207683_10000848 | |||
| 1901 | Ga0207683_10217698 | |||
| 1902 | Ga0207683_10301977 | |||
| 1903 | Ga0207683_10622655 | |||
| 1904 | Ga0207698_10041264 | |||
| 1905 | Ga0207698_10071903 | |||
| 1906 | Ga0207698_10269322 | |||
| 1907 | Ga0268266_10002994 | |||
| 1908 | Ga0268266_10024815 | |||
| 1909 | Ga0268266_10031914 | |||
| 1910 | Ga0268265_10001656 | |||
| 1911 | Ga0268264_10003976 | |||
| 1912 | Ga0268264_10129387 | |||
| 1913 | Ga0268264_10502990 | |||
| 1914 | Ga0265336_10002308 | |||
| 1915 | Ga0265336_10006115 | |||
| 1916 | Ga0265338_10008619 | |||
| 1917 | Ga0265338_10045200 | |||
| 1918 | Ga0265338_10049670 | |||
| 1919 | Ga0265338_10079931 | |||
| 1920 | Ga0265338_10122311 | |||
| 1921 | Ga0265338_10504030 | |||
| 1922 | Ga0265324_10071311 | |||
| 1923 | Ga0265324_10151339 | |||
| 1924 | Ga0265762_1000263 | |||
| 1925 | Ga0265762_1031420 | |||
| 1926 | Ga0265765_1003039 | |||
| 1927 | Ga0265760_10003581 | |||
| 1928 | Ga0265760_10013154 | |||
| 1929 | Ga0265330_10000216 | |||
| 1930 | Ga0265330_10107139 | |||
| 1931 | Ga0265328_10002261 | |||
| 1932 | Ga0265325_10000249 | |||
| 1933 | Ga0265325_10001092 | |||
| 1934 | Ga0265325_10002613 | |||
| 1935 | Ga0265325_10004469 | |||
| 1936 | Ga0265325_10027277 | |||
| 1937 | Ga0265325_10115609 | |||
| 1938 | Ga0265329_10006633 | |||
| 1939 | Ga0265340_10001240 | |||
| 1940 | Ga0265340_10005066 | |||
| 1941 | Ga0265340_10011713 | |||
| 1942 | Ga0265340_10058024 | |||
| 1943 | Ga0265340_10283011 | |||
| 1944 | Ga0265339_10002285 | |||
| 1945 | Ga0265339_10007283 | |||
| 1946 | Ga0265339_10007957 | |||
| 1947 | Ga0265339_10018564 | |||
| 1948 | Ga0265339_10062462 | |||
| 1949 | Ga0265339_10081517 | |||
| 1950 | Ga0265339_10087663 | |||
| 1951 | Ga0265339_10091987 | |||
| 1952 | Ga0265339_10106662 | |||
| 1953 | Ga0265339_10166709 | |||
| 1954 | Ga0265316_10006447 | |||
| 1955 | Ga0265316_10012816 | |||
| 1956 | Ga0265316_10014051 | |||
| 1957 | Ga0265316_10018325 | |||
| 1958 | Ga0265316_10033744 | |||
| 1959 | Ga0265316_10061602 | |||
| 1960 | Ga0265316_10075358 | |||
| 1961 | Ga0265316_10138143 | |||
| 1962 | Ga0265316_10212805 | |||
| 1963 | Ga0307408_100606656 | |||
| 1964 | Ga0265313_10028796 | |||
| 1965 | Ga0265313_10061217 | |||
| 1966 | Ga0265313_10187707 | |||
| 1967 | Ga0265314_10000239 | |||
| 1968 | Ga0265314_10024977 | |||
| 1969 | Ga0265314_10026822 | |||
| 1970 | Ga0265342_10089547 | |||
| 1971 | Ga0265342_10101518 | |||
| 1972 | Ga0265342_10126090 | |||
| 1973 | Ga0265342_10135676 | |||
| 1974 | Ga0265342_10312068 | |||
| 1975 | Ga0307405_10396682 | |||
| 1976 | Ga0307410_10841835 | |||
| 1977 | Ga0307407_10061760 | |||
| 1978 | Ga0307409_100000830 | |||
| 1979 | Ga0307409_100178699 | |||
| 1980 | Ga0307416_100096091 | |||
| 1981 | Ga0307411_10126790 | |||
| 1982 | Ga0307415_100057830 | |||
| 1983 | Ga0307415_101287575 | |||
| 1984 | Ga0373938_0088007 | |||
| 1985 | Ga0373926_0010000 | |||
| 1986 | Ga0373926_0020347 | |||
| 1987 | Ga0373926_0105118 | |||
| 1988 | Ga0373934_0004411 | |||
| 1989 | Ga0373934_0160448 | |||
| 1990 | Ga0373944_0109097 | |||
| 1991 | Ga0373923_0034945 | |||
| 1992 | Ga0373923_0048753 | |||
| 1993 | Ga0373936_0001435 | |||
| 1994 | Ga0373936_0033081 | |||
| 1995 | Ga0373936_0132501 | |||
| 1996 | Ga0373936_0280289 | |||
| 1997 | Ga0373945_0001479 | |||
| 1998 | Ga0373945_0069093 | |||
| 1999 | Ga0373945_0099123 | |||
| 2000 | Ga0373945_0207116 | |||
| 2001 | Ga0373953_0087301 | |||
| 2002 | Ga0373954_0008005 | |||
| 2003 | Ga0373954_0312806 | |||
| 2004 | Ga0373956_0185992 | |||
| 2005 | Ga0373956_0258463 | |||
| 2006 | Ga0373957_0052285 | |||
| 2007 | Ga0373943_0000141 | |||
| 2008 | Ga0373943_0002710 | |||
| 2009 | Ga0373943_0029568 | |||
| 2010 | Ga0373943_0239179 | |||
| 2011 | Ga0373943_0306472 | |||
| 2012 | Ga0373946_0157980 | |||
| 2013 | Ga0373955_0030154 | |||
| 2014 | Ga0373955_0069620 | |||
| 2015 | Ga0373955_0154660 | |||
| 2016 | Ga0373924_0000021 | |||
| 2017 | Ga0373924_0008113 | |||
| 2018 | Ga0373935_0002090 | |||
| 2019 | Ga0373935_0018584 | |||
| 2020 | Ga0373935_0271557 | |||
| 2021 | Ga0373935_0404909 | |||
| 2022 | Ga0373927_0003981 | |||
| 2023 | Ga0373927_0005726 | |||
| 2024 | Ga0373927_0010171 | |||
| 2025 | Ga0373927_0096655 | |||
| 2026 | Ga0373927_0309430 | |||
| 2027 | Ga0373927_0327525 | |||
| 2028 | Ga0373927_0357412 | |||
| 2029 | Ga0373933_0062465 | |||
| 2030 | Ga0373933_0078091 | |||
| 2031 | Ga0373933_0087060 | |||
| 2032 | Ga0373933_0650431 | |||
| 2033 | Ga0373947_0001591 | |||
| 2034 | Ga0373947_0002655 | |||
| 2035 | Ga0373947_0023446 | |||
| 2036 | Ga0373947_0120009 | |||
| 2037 | Ga0373947_0259633 | |||
| 2038 | Ga0373947_0307181 | |||
| 2039 | Ga0373937_0000090 | |||
| 2040 | Ga0373937_0012656 | |||
| 2041 | Ga0373937_0037458 | |||
| 2042 | Ga0373937_0084735 | |||
| 2043 | Ga0373937_0178364 | |||
| 2044 | Ga0373937_0220053 | |||
| 2045 | Ga0373937_0253273 | |||
| 2046 | Ga0373937_0799166 | |||
| 2047 | Ga0373925_0002098 | |||
| 2048 | Ga0373925_0003638 | |||
| 2049 | Ga0373925_0024365 | |||
| 2050 | Ga0373925_0031436 | |||
| 2051 | Ga0373925_0065788 | |||
| 2052 | Ga0373925_0244951 | |||
| 2053 | Ga0373925_0995700 | |||
| 2054 | Ga0373925_1061151 | |||
| 2055 | Ga0395900_0754843 | |||
| 2056 | Ga0395900_1085604 | |||
| 2057 | Ga0395898_0145777 | |||
| 2058 | Ga0395905_0152499 | |||
| 2059 | Ga0395905_0447297 | |||
| 2060 | Ga0395905_1177096 | |||
| 2061 | Ga0436364_1537985 | |||
| 2062 | Ga0436365_0369277 | |||
| 2063 | Ga0436365_0589729 | |||
| 2064 | Ga0436365_1128997 | |||
| 2065 | Ga0436363_0075211 | |||
| 2066 | Ga0436363_0405112 | |||
| 2067 | Ga0436363_0631224 | |||
| 2068 | Ga0436363_1002749 | |||
| 2069 | Ga0436363_1108521 | |||
| 2070 | Ga0436363_1316118 | |||
| 2071 | Ga0436363_1636503 | |||
| 2072 | Ga0436362_0059665 | |||
| 2073 | Ga0436362_0893348 | |||
| 2074 | Ga0453683_0038993 | |||
| 2075 | Ga0466965_0281811 | |||
| 2076 | Ga0466966_0074360 | |||
| 2077 | Ga0466966_0145684 | |||
| 2078 | Ga0466963_0001401 | |||
| 2079 | Ga0466963_0054616 | |||
| 2080 | Ga0466963_0130099 | |||
| 2081 | Ga0466963_0629341 | |||
| 2082 | Ga0453684_0672333 | |||
| 2083 | Ga0466957_0000027 | |||
| 2084 | Ga0466957_0204542 | |||
| 2085 | Ga0466959_0027847 | |||
| 2086 | Ga0451576_0559213 | |||
| 2087 | Ga0451576_1068463 | |||
| 2088 | Ga0451576_1209917 | |||
| 2089 | Ga0466958_0018139 | |||
| 2090 | Ga0466958_0148741 | |||
| 2091 | Ga0466958_0189949 | |||
| 2092 | Ga0466958_0319408 | |||
| 2093 | Ga0466958_0579904 | |||
| 2094 | Ga0466967_0001298 | |||
| 2095 | Ga0466967_0007522 | |||
| 2096 | Ga0466967_0070250 | |||
| 2097 | Ga0466967_0119616 | |||
| 2098 | Ga0466967_0150997 | |||
| 2099 | Ga0466967_0208456 | |||
| 2100 | Ga0466967_0352802 | |||
| 2101 | Ga0466967_0435095 | |||
| 2102 | Ga0466967_1212748 | |||
| 2103 | Ga0495629_0153744 | |||
| 2104 | Ga0495629_0198735 | |||
| 2105 | Ga0495651_0180618 | |||
| 2106 | Ga0495580_0001084 | |||
| 2107 | Ga0495580_0001209 | |||
| 2108 | Ga0495580_0002030 | |||
| 2109 | Ga0495580_0013824 | |||
| 2110 | Ga0495580_0022266 | |||
| 2111 | Ga0495580_0071927 | |||
| 2112 | Ga0495580_0238748 | |||
| 2113 | Ga0495580_0323558 | |||
| 2114 | Ga0495580_0689260 | |||
| 2115 | Ga0495582_0001249 | |||
| 2116 | Ga0495582_0005964 | |||
| 2117 | Ga0495582_0162835 | |||
| 2118 | Ga0495582_0243630 | |||
| 2119 | Ga0495639_0088124 | |||
| 2120 | Ga0495639_0188868 | |||
| 2121 | Ga0495639_0263263 | |||
| 2122 | Ga0495662_0250245 | |||
| 2123 | Ga0495664_0045558 | |||
| 2124 | Ga0495664_0124142 | |||
| 2125 | Ga0495594_0011591 | |||
| 2126 | Ga0495606_0225889 | |||
| 2127 | Ga0495606_0263913 | |||
| 2128 | Ga0495608_0140966 | |||
| 2129 | Ga0495608_0326312 | |||
| 2130 | Ga0495630_0127662 | |||
| 2131 | Ga0495643_0022688 | |||
| 2132 | Ga0495665_0005328 | |||
| 2133 | Ga0495665_0021444 | |||
| 2134 | Ga0495665_0052401 | |||
| 2135 | Ga0495665_0067337 | |||
| 2136 | Ga0495665_0087833 | |||
| 2137 | Ga0495665_0250377 | |||
| 2138 | Ga0495622_0076036 | |||
| 2139 | Ga0495667_0227907 | |||
| 2140 | Ga0495656_0060580 | |||
| 2141 | Ga0495668_0246029 | |||
| 2142 | Ga0495625_0025076 | |||
| 2143 | Ga0495635_0141449 | |||
| 2144 | Ga0495659_0002349 | |||
| 2145 | Ga0495588_0291694 | |||
| 2146 | Ga0495588_0437694 | |||
| 2147 | Ga0495657_0247375 | |||
| 2148 | Ga0495657_0305658 | |||
| 2149 | Ga0495657_0317654 | |||
| 2150 | Ga0495599_0290322 | |||
| 2151 | Ga0495623_0056265 | |||
| 2152 | Ga0495623_0135734 | |||
| 2153 | Ga0495623_0298431 | |||
| 2154 | Ga0495623_0416915 | |||
| 2155 | Ga0495658_0170604 | |||
| 2156 | Ga0495658_0296412 | |||
| 2157 | Ga0495669_0035537 | |||
| 2158 | Ga0495669_0225250 | |||
| 2159 | Ga0495669_0384719 | |||
| 2160 | Ga0495613_0002395 | |||
| 2161 | Ga0495613_0767043 | |||
| 2162 | Ga0495649_0012383 | |||
| 2163 | Ga0495581_0101977 | |||
| 2164 | Ga0495636_0111760 | |||
| 2165 | Ga0495674_0457238 | |||
| 2166 | Ga0495674_0663367 | |||
| 2167 | Ga0495676_0229278 | |||
| 2168 | Ga0495683_0038696 | |||
| 2169 | Ga0495675_0045855 | |||
| 2170 | Ga0495675_0125230 | |||
| 2171 | Ga0495684_0124046 | |||
| 2172 | Ga0495593_0193732 | |||
| 2173 | Ga0495602_0252774 | |||
| 2174 | Ga0495602_0348465 | |||
| 2175 | Ga0495614_0010578 | |||
| 2176 | Ga0496100_0150797 | |||
| 2177 | Ga0496101_0747996 | |||
| 2178 | Ga0496101_0929613 | |||
| 2179 | Ga0496102_0032273 | |||
| 2180 | Ga0496102_0201211 | |||
| 2181 | Ga0496102_0356990 | |||
| 2182 | Ga0496102_0416269 | |||
| 2183 | Ga0496103_0456048 | |||
| 2184 | Ga0496104_0054494 | |||
| 2185 | Ga0496104_0073409 | |||
| 2186 | Ga0496104_0075975 | |||
| 2187 | Ga0496104_0161770 | |||
| 2188 | Ga0496104_0243639 | |||
| 2189 | Ga0496104_0314795 | |||
| 2190 | Ga0496104_0774529 | |||
| 2191 | Ga0496104_1285055 | |||
| 2192 | Ga0496105_0729509 | |||
| 2193 | Ga0496106_0124154 | |||
| 2194 | Ga0496106_0219808 | |||
| 2195 | Ga0496108_0000038 | |||
| 2196 | Ga0496109_0000082 | |||
| 2197 | Ga0496109_0099379 | |||
| 2198 | Ga0496109_0164501 | |||
| 2199 | Ga0496109_0684208 | |||
| 2200 | Ga0496109_1068779 | |||
| 2201 | Ga0496110_0000195 | |||
| 2202 | Ga0496110_0077168 | |||
| 2203 | Ga0496110_0225750 | |||
| 2204 | Ga0496110_0542211 | |||
| 2205 | Ga0496111_0002758 | |||
| 2206 | Ga0496111_0008810 | |||
| 2207 | Ga0496112_0000032 | |||
| 2208 | Ga0496112_0001293 | |||
| 2209 | Ga0496112_0032363 | |||
| 2210 | Ga0496112_0057628 | |||
| 2211 | Ga0496112_0062423 | |||
| 2212 | Ga0496112_0067290 | |||
| 2213 | Ga0496112_0145945 | |||
| 2214 | Ga0496112_0151886 | |||
| 2215 | Ga0496112_0313995 | |||
| 2216 | Ga0496112_0499326 | |||
| 2217 | Ga0496112_0800059 | |||
| 2218 | Ga0496113_0000094 | |||
| 2219 | Ga0496113_0036480 | |||
| 2220 | Ga0496113_0038073 | |||
| 2221 | Ga0496115_0009730 | |||
| 2222 | Ga0496115_0019473 | |||
| 2223 | Ga0496115_0163263 | |||
| 2224 | Ga0496115_0204328 | |||
| 2225 | Ga0496115_0599531 | |||
| 2226 | Ga0495682_0010495 | |||
| 2227 | Ga0501293_007088 | |||
| 2228 | Ga0501299_070855 | |||
| 2229 | Ga0501300_006705 | |||
| 2230 | Ga0501233_020731 | |||
| 2231 | Ga0501271_040855 | |||
| 2232 | nmdc:mga05p37_196867_c1 | |||
| 2233 | nmdc:mga0n895_1076829_c1 | |||
| 2234 | nmdc:mga0n895_2935_c1 | |||
| 2235 | nmdc:mga0n895_31_c1 | |||
| 2236 | nmdc:mga0n895_40130_c1 | |||
| 2237 | nmdc:mga0n895_602194_c1 | |||
| 2238 | nmdc:mga0rr50_138451_c1 | |||
| 2239 | nmdc:mga0rr50_1416_c1 | |||
| 2240 | nmdc:mga0rr50_292208_c1 | |||
| 2241 | nmdc:mga0rr50_355538_c1 | |||
| 2242 | nmdc:mga0rr50_437849_c1 | |||
| 2243 | nmdc:mga0rr50_451970_c1 | |||
| 2244 | nmdc:mga0rr50_777501_c1 | |||
| 2245 | nmdc:mga08x19_1455_c1 | |||
| 2246 | nmdc:mga08x19_16655_c2 | |||
| 2247 | nmdc:mga08x19_200950_c1 | |||
| 2248 | nmdc:mga08x19_284573_c1 | |||
| 2249 | nmdc:mga08x19_5358_c1 | |||
| 2250 | nmdc:mga08x19_65722_c1 | |||
| 2251 | nmdc:mga0a205_1702_c1 | |||
| 2252 | nmdc:mga0a205_562_c1 | |||
| 2253 | Ga0495601_0171732 | |||
| 2254 | Ga0495601_0504176 | |||
| 2255 | Ga0495612_0158105 | |||
| 2256 | Ga0501084_0166535 | |||
| 2257 | Ga0587069_036659 | |||
| 2258 | Ga0587107_023162 | |||
| 2259 | Ga0501082_0035560 | |||
| 2260 | Ga0466962_0111067 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6vud-assembly1.cif.gz_B | crystal structure of a ribosome recycling factor from ehrlichia chaffeensis | 0.8982 | 13 | 160 |
| 7xge-assembly3.cif.gz_E | crystal structure of mcl-1 in complex with computationally designed inhibitor protein | 0.8717 | 115 | 160 |
| 1ge9-assembly1.cif.gz_A | solution structure of the ribosome recycling factor | 0.8689 | 13 | 162 |
| 4woi-assembly1.cif.gz_AV | 4,5-linked aminoglycoside antibiotics regulate the bacterial ribosome by targeting dynamic conformational processes within intersubunit bridge b2 | 0.8194 | 18 | 162 |
| 4v9d-assembly1.cif.gz_AY | structures of the bacterial ribosome in classical and hybrid states of trna binding | 0.8188 | 13 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGY1_31_105_3.30.1360.40 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; | 0.9729 | 41 | 115 | 3.30.1360.40 |
| af_P0A805_31_105_3.30.1360.40 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; | 0.9719 | 41 | 115 | 3.30.1360.40 |
| af_B6TAV8_107_177_3.30.1360.40 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; | 0.9668 | 41 | 110 | 3.30.1360.40 |
| af_P9WGY1_31_105_3.30.1360.40 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; | 0.9605 | 41 | 115 | 3.30.1360.40 |
| af_P0A805_31_105_3.30.1360.40 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; | 0.9594 | 41 | 115 | 3.30.1360.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522YRR8-F1-model_v4 | Ribosome recycling factor | 0.9133 | 41 | 160 |
GO:0006412
GO:0043023 |
| AF-A0A2D6INI1-F1-model_v4 | Ribosome recycling factor | 0.909 | 46 | 162 |
GO:0006412
GO:0043023 |
| AF-A0A287IQI7-F1-model_v4 | deleted | 0.9032 | 46 | 145 |
|
| AF-X1LF43-F1-model_v4 | Ribosome recycling factor domain-containing protein | 0.8965 | 38 | 121 |
GO:0006412
GO:0043023 |
| AF-A0A287IQI7-F1-model_v4 | deleted | 0.8869 | 46 | 145 |
|