F490540

General Info

Members Datasets Scaffolds Average Seq Length
1130 327 2260 166

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_185444_c1|nmdc:mga08x19_185444_c1_595_1299
Length 200
Sequence MVSAVNLASAEAAKWRRSFLYNYESLNVWSCHGPTLERAMAVSGMGGNPALRDIHTQLKNRMDKAVGDFRTSLLSTRTGRASVHMVDSIRVPYYGSEMPLNQIAQVHAPEAQLITVQPFDPSSLAEIEKALRTSDMGFNPQNDGKLIRIPIPPLTEERRKELVKHLHKVLEEHRTAIRNVRRDGNDLIKKALKDKKISQV

Samples

Sample ID Description Type Environment
1 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
126 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
128 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
129 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
130 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
198 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
199 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
200 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
204 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
205 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
206 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
207 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
208 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
209 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
212 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
213 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
217 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
218 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
219 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
220 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
221 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
222 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
223 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
224 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
225 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
228 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
229 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
230 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
231 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
232 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
233 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
234 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
235 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
238 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
239 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
246 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
247 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
248 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
249 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
250 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
251 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
252 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
253 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
254 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
255 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
261 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
262 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
263 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
264 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
265 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
266 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
267 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
268 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
271 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
272 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
273 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
274 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
275 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
276 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
277 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
278 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
279 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
280 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
281 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
282 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
283 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
284 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
285 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
286 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
287 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
288 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
289 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
290 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
291 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
292 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
293 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
294 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
295 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
296 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
297 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
298 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
299 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
300 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
301 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
302 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
303 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
304 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
305 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
306 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
307 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
308 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
309 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
312 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
313 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
314 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
315 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
316 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
320 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
321 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
322 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
323 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
324 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
327 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 1.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.09
Nodule 0
Rhizoplane 4.42
Rhizosphere 94.07
Stem 0
Stem Tuber 0
Unclassified 12.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08x19_185444_c1 3300050514 Unclassified 1422
2 MRS1b_contig_2926443 2162886011 Bacteria 878
3 JGI24752J21851_1004409 3300001976 Bacteria 1845
4 JGI24737J22298_10021840 3300001990 Bacteria 2036
5 JGI24034J26672_10009286 3300002239 Bacteria 1449
6 JGI24751J29686_10000539 3300002459 Bacteria 10617
7 rootH2_10166807 3300003320 Bacteria 1253
8 rootH1_10207098 3300003323 Bacteria 2296
9 Ga0058863_10015630 3300004799 Bacteria 1580
10 Ga0058861_11818347 3300004800 Bacteria 886
11 Ga0058862_12695550 3300004803 Bacteria 1490
12 Ga0065712_10073970 3300005290 Bacteria 4223
13 Ga0065712_10097702 3300005290 Bacteria 2142
14 Ga0065715_10155513 3300005293 Bacteria 1682
15 Ga0065715_10181645 3300005293 Bacteria 1472
16 Ga0070658_10023393 3300005327 Bacteria 4960
17 Ga0070683_100022906 3300005329 Bacteria 5584
18 Ga0070683_100043047 3300005329 Bacteria 4160
19 Ga0070683_100109812 3300005329 Bacteria 2601
20 Ga0070683_100338193 3300005329 Unclassified 1433
21 Ga0070690_100807264 3300005330 Bacteria 728
22 Ga0070670_100006314 3300005331 Bacteria 10035
23 Ga0070670_100215766 3300005331 Bacteria 1669
24 Ga0070670_100264093 3300005331 Bacteria 1501
25 Ga0070677_10001451 3300005333 Bacteria 7507
26 Ga0068869_100026030 3300005334 Bacteria 4068
27 Ga0068869_100031914 3300005334 Bacteria 3709
28 Ga0068869_100226036 3300005334 Bacteria 1485
29 Ga0070666_10016274 3300005335 Bacteria 4756
30 Ga0070666_10211616 3300005335 Bacteria 1365
31 Ga0070680_100010401 3300005336 Bacteria 7173
32 Ga0070680_100018751 3300005336 Bacteria 5475
33 Ga0070680_100070274 3300005336 Unclassified 2876
34 Ga0070680_100427872 3300005336 Unclassified 1129
35 Ga0070680_100880513 3300005336 Bacteria 772
36 Ga0070682_100044123 3300005337 Bacteria 2760
37 Ga0068868_100000808 3300005338 Bacteria 21230
38 Ga0068868_100012242 3300005338 Bacteria 6267
39 Ga0068868_100019290 3300005338 Bacteria 5109
40 Ga0068868_100041359 3300005338 Bacteria 3591
41 Ga0068868_100055888 3300005338 Bacteria 3116
42 Ga0068868_100069378 3300005338 Bacteria 2809
43 Ga0068868_100170325 3300005338 Bacteria 1802
44 Ga0070660_100000311 3300005339 Bacteria 32366
45 Ga0070660_100003019 3300005339 Bacteria 11586
46 Ga0070660_100634285 3300005339 Bacteria 894
47 Ga0070689_100026004 3300005340 Bacteria 4402
48 Ga0070689_100288435 3300005340 Bacteria 1363
49 Ga0070691_10021433 3300005341 Bacteria 2990
50 Ga0070687_100073980 3300005343 Bacteria 1838
51 Ga0070687_100186609 3300005343 Bacteria 1246
52 Ga0070661_100098261 3300005344 Bacteria 2174
53 Ga0070661_101025100 3300005344 Unclassified 685
54 Ga0070668_100232715 3300005347 Bacteria 1524
55 Ga0070669_100159173 3300005353 Unclassified 1753
56 Ga0070669_100773762 3300005353 Bacteria 814
57 Ga0070675_100009309 3300005354 Bacteria 7638
58 Ga0070675_100249752 3300005354 Bacteria 1552
59 Ga0070671_100004796 3300005355 Bacteria 10751
60 Ga0070671_100068392 3300005355 Unclassified 2962
61 Ga0070671_100125778 3300005355 Bacteria 2158
62 Ga0070671_101134108 3300005355 Bacteria 687
63 Ga0070673_100195577 3300005364 Bacteria 1739
64 Ga0070673_101084975 3300005364 Bacteria 747
65 Ga0070688_100000311 3300005365 Bacteria 24808
66 Ga0070659_100005680 3300005366 Bacteria 8973
67 Ga0070659_100025393 3300005366 Bacteria 4550
68 Ga0070659_100071192 3300005366 Bacteria 2764
69 Ga0070709_10003427 3300005434 Bacteria 8506
70 Ga0070709_10003845 3300005434 Bacteria 8089
71 Ga0070709_10055665 3300005434 Bacteria 2498
72 Ga0070709_10145981 3300005434 Bacteria 1630
73 Ga0070709_10226109 3300005434 Bacteria 1337
74 Ga0070709_10320656 3300005434 Bacteria 1137
75 Ga0070709_10508593 3300005434 Bacteria 916
76 Ga0070709_10563513 3300005434 Bacteria 873
77 Ga0070709_10678442 3300005434 Viruses 800
78 Ga0070714_100001016 3300005435 Bacteria 20051
79 Ga0070714_100025849 3300005435 Bacteria 4849
80 Ga0070714_100044070 3300005435 Bacteria 3776
81 Ga0070714_100052502 3300005435 Bacteria 3477
82 Ga0070714_100219435 3300005435 Unclassified 1747
83 Ga0070714_100229763 3300005435 Bacteria 1708
84 Ga0070714_100246563 3300005435 Bacteria 1650
85 Ga0070714_100379295 3300005435 Bacteria 1333
86 Ga0070714_100384918 3300005435 Bacteria 1323
87 Ga0070714_100529095 3300005435 Bacteria 1127
88 Ga0070714_100674479 3300005435 Unclassified 996
89 Ga0070714_101031488 3300005435 Bacteria 801
90 Ga0070714_101033029 3300005435 Bacteria 800
91 Ga0070714_101548597 3300005435 Unclassified 647
92 Ga0070713_100000460 3300005436 Bacteria 26005
93 Ga0070713_100000863 3300005436 Bacteria 19392
94 Ga0070713_100009985 3300005436 Bacteria 6839
95 Ga0070713_100012863 3300005436 Bacteria 6156
96 Ga0070713_100022236 3300005436 Bacteria 4897
97 Ga0070713_100035831 3300005436 Bacteria 3998
98 Ga0070713_100047278 3300005436 Unclassified 3536
99 Ga0070713_100055567 3300005436 Bacteria 3290
100 Ga0070713_100083204 3300005436 Unclassified 2735
101 Ga0070713_100104832 3300005436 Bacteria 2455
102 Ga0070713_100121693 3300005436 Bacteria 2290
103 Ga0070713_100219920 3300005436 Bacteria 1722
104 Ga0070713_100231593 3300005436 Bacteria 1679
105 Ga0070713_100235254 3300005436 Bacteria 1666
106 Ga0070713_100244780 3300005436 Unclassified 1634
107 Ga0070713_100306328 3300005436 Bacteria 1464
108 Ga0070713_100372196 3300005436 Bacteria 1329
109 Ga0070713_100407609 3300005436 Bacteria 1270
110 Ga0070713_100413271 3300005436 Bacteria 1262
111 Ga0070713_100453431 3300005436 Bacteria 1205
112 Ga0070713_100485707 3300005436 Bacteria 1164
113 Ga0070710_10007216 3300005437 Bacteria 5371
114 Ga0070710_10110128 3300005437 Bacteria 1653
115 Ga0070710_10190600 3300005437 Bacteria 1289
116 Ga0070710_10267437 3300005437 Bacteria 1104
117 Ga0070711_100000656 3300005439 Bacteria 18067
118 Ga0070711_100022448 3300005439 Unclassified 4091
119 Ga0070711_100063439 3300005439 Bacteria 2579
120 Ga0070711_100089520 3300005439 Bacteria 2214
121 Ga0070711_100128912 3300005439 Bacteria 1881
122 Ga0070711_100394033 3300005439 Bacteria 1122
123 Ga0070711_100953105 3300005439 Bacteria 734
124 Ga0070708_100002306 3300005445 Bacteria 14779
125 Ga0070708_100022528 3300005445 Bacteria 5344
126 Ga0070708_100038532 3300005445 Bacteria 4176
127 Ga0070708_100074972 3300005445 Bacteria 3053
128 Ga0070708_100120276 3300005445 Unclassified 2422
129 Ga0070708_100487318 3300005445 Bacteria 1163
130 Ga0070708_100845443 3300005445 Unclassified 860
131 Ga0070663_100176318 3300005455 Bacteria 1655
132 Ga0070678_100237862 3300005456 Bacteria 1521
133 Ga0070678_100321402 3300005456 Unclassified 1322
134 Ga0070662_100057613 3300005457 Bacteria 2823
135 Ga0070662_100950663 3300005457 Bacteria 734
136 Ga0070681_10000304 3300005458 Bacteria 39863
137 Ga0070681_10000804 3300005458 Bacteria 26179
138 Ga0070681_10012167 3300005458 Bacteria 8536
139 Ga0070681_10031578 3300005458 Bacteria 5316
140 Ga0070681_10041573 3300005458 Bacteria 4607
141 Ga0070681_10056600 3300005458 Bacteria 3902
142 Ga0070681_10175459 3300005458 Bacteria 2065
143 Ga0070681_10208763 3300005458 Bacteria 1869
144 Ga0070681_10213647 3300005458 Bacteria 1845
145 Ga0070681_10317009 3300005458 Bacteria 1469
146 Ga0070681_10393837 3300005458 Bacteria 1296
147 Ga0070681_10507145 3300005458 Bacteria 1120
148 Ga0070681_10612933 3300005458 Bacteria 1003
149 Ga0068867_100073940 3300005459 Bacteria 2553
150 Ga0068867_100254141 3300005459 Bacteria 1430
151 Ga0068867_100949769 3300005459 Bacteria 776
152 Ga0070706_100001345 3300005467 Bacteria 26134
153 Ga0070706_100001630 3300005467 Bacteria 23404
154 Ga0070706_100005850 3300005467 Bacteria 11665
155 Ga0070706_100006393 3300005467 Bacteria 11134
156 Ga0070706_100020891 3300005467 Bacteria 6028
157 Ga0070706_100342903 3300005467 Bacteria 1393
158 Ga0070707_100001066 3300005468 Bacteria 27046
159 Ga0070707_100003999 3300005468 Bacteria 13875
160 Ga0070707_100021280 3300005468 Bacteria 6130
161 Ga0070707_100028348 3300005468 Bacteria 5329
162 Ga0070707_100158512 3300005468 Bacteria 2205
163 Ga0070707_100164194 3300005468 Bacteria 2164
164 Ga0070707_100288346 3300005468 Unclassified 1595
165 Ga0070707_100338552 3300005468 Bacteria 1462
166 Ga0070707_100596575 3300005468 Bacteria 1067
167 Ga0070698_100000247 3300005471 Bacteria 54164
168 Ga0070698_100001098 3300005471 Bacteria 29768
169 Ga0070698_100020529 3300005471 Bacteria 6926
170 Ga0070698_100105362 3300005471 Bacteria 2790
171 Ga0070698_100709849 3300005471 Bacteria 948
172 Ga0070699_100002044 3300005518 Bacteria 18236
173 Ga0070699_100004004 3300005518 Bacteria 13020
174 Ga0070699_100023250 3300005518 Bacteria 5339
175 Ga0070699_100027660 3300005518 Bacteria 4890
176 Ga0070699_100877918 3300005518 Bacteria 821
177 Ga0070679_100014420 3300005530 Bacteria 7591
178 Ga0070679_100024151 3300005530 Bacteria 5956
179 Ga0070679_100067059 3300005530 Bacteria 3578
180 Ga0070679_100312675 3300005530 Bacteria 1520
181 Ga0070679_100336724 3300005530 Bacteria 1457
182 Ga0070679_100781920 3300005530 Bacteria 898
183 Ga0070684_100001116 3300005535 Bacteria 19277
184 Ga0070684_100003411 3300005535 Bacteria 11927
185 Ga0070684_100063033 3300005535 Bacteria 3248
186 Ga0070684_100076893 3300005535 Bacteria 2947
187 Ga0070684_100484636 3300005535 Bacteria 1145
188 Ga0070684_100516914 3300005535 Bacteria 1106
189 Ga0070697_100000463 3300005536 Bacteria 31115
190 Ga0070697_100000758 3300005536 Bacteria 24138
191 Ga0070697_100004218 3300005536 Bacteria 11012
192 Ga0070697_100005905 3300005536 Bacteria 9451
193 Ga0070697_100011766 3300005536 Bacteria 6845
194 Ga0070697_100016515 3300005536 Bacteria 5807
195 Ga0070697_100017118 3300005536 Bacteria 5703
196 Ga0070697_100229408 3300005536 Bacteria 1583
197 Ga0070697_100875742 3300005536 Bacteria 796
198 Ga0068853_100029743 3300005539 Unclassified 4608
199 Ga0068853_100078145 3300005539 Bacteria 2891
200 Ga0068853_100208413 3300005539 Unclassified 1781
201 Ga0068853_100365811 3300005539 Bacteria 1344
202 Ga0070672_100004674 3300005543 Bacteria 8978
203 Ga0070686_100059757 3300005544 Bacteria 2457
204 Ga0070695_100264147 3300005545 Bacteria 1258
205 Ga0070693_100023182 3300005547 Bacteria 3314
206 Ga0070693_100035108 3300005547 Bacteria 2778
207 Ga0070693_100051789 3300005547 Bacteria 2352
208 Ga0070693_100396859 3300005547 Bacteria 955
209 Ga0070693_100862530 3300005547 Unclassified 676
210 Ga0070665_100007099 3300005548 Bacteria 11381
211 Ga0070665_100259765 3300005548 Bacteria 1738
212 Ga0070665_100429823 3300005548 Bacteria 1329
213 Ga0068855_100000563 3300005563 Bacteria 45518
214 Ga0068855_100004163 3300005563 Bacteria 17651
215 Ga0068855_100011625 3300005563 Bacteria 10638
216 Ga0068855_100012802 3300005563 Bacteria 10119
217 Ga0068855_100043564 3300005563 Bacteria 5316
218 Ga0068855_100049412 3300005563 Unclassified 4961
219 Ga0068855_100059059 3300005563 Bacteria 4489
220 Ga0068855_100139903 3300005563 Bacteria 2760
221 Ga0068855_100235912 3300005563 Bacteria 2046
222 Ga0068855_100252692 3300005563 Bacteria 1966
223 Ga0068855_100410746 3300005563 Bacteria 1482
224 Ga0068855_100418114 3300005563 Unclassified 1467
225 Ga0070664_100000879 3300005564 Bacteria 23312
226 Ga0070664_100027623 3300005564 Bacteria 4716
227 Ga0070664_100188302 3300005564 Bacteria 1838
228 Ga0070664_100467501 3300005564 Bacteria 1159
229 Ga0070664_101167491 3300005564 Bacteria 726
230 Ga0068857_100000022 3300005577 Bacteria 87864
231 Ga0068857_100000880 3300005577 Bacteria 22656
232 Ga0068857_100002691 3300005577 Bacteria 14592
233 Ga0068857_100055123 3300005577 Bacteria 3528
234 Ga0068857_100137570 3300005577 Bacteria 2206
235 Ga0068857_100427623 3300005577 Bacteria 1235
236 Ga0068857_100991849 3300005577 Bacteria 808
237 Ga0068854_100009080 3300005578 Bacteria 6408
238 Ga0068854_100058520 3300005578 Bacteria 2782
239 Ga0068854_100428803 3300005578 Bacteria 1100
240 Ga0068854_100583818 3300005578 Bacteria 952
241 Ga0068856_100000448 3300005614 Bacteria 45521
242 Ga0068856_100002645 3300005614 Bacteria 18368
243 Ga0068856_100023133 3300005614 Bacteria 6044
244 Ga0068856_100025330 3300005614 Bacteria 5783
245 Ga0068856_100029764 3300005614 Bacteria 5335
246 Ga0068856_100053508 3300005614 Bacteria 3980
247 Ga0068856_100172826 3300005614 Bacteria 2173
248 Ga0068856_100189611 3300005614 Bacteria 2070
249 Ga0068856_100228017 3300005614 Bacteria 1878
250 Ga0068856_100266573 3300005614 Unclassified 1729
251 Ga0068856_100768003 3300005614 Bacteria 984
252 Ga0068856_101372361 3300005614 Bacteria 721
253 Ga0070702_100111738 3300005615 Bacteria 1695
254 Ga0070702_100448427 3300005615 Bacteria 935
255 Ga0070702_100570247 3300005615 Bacteria 843
256 Ga0068852_100028082 3300005616 Unclassified 4599
257 Ga0068852_100037467 3300005616 Bacteria 4066
258 Ga0068852_100053376 3300005616 Unclassified 3479
259 Ga0068852_100247218 3300005616 Bacteria 1707
260 Ga0068859_100000885 3300005617 Bacteria 30517
261 Ga0068859_100199301 3300005617 Bacteria 2086
262 Ga0068864_100007383 3300005618 Bacteria 9047
263 Ga0068864_100013662 3300005618 Bacteria 6732
264 Ga0068864_100139812 3300005618 Bacteria 2183
265 Ga0068864_100150760 3300005618 Bacteria 2106
266 Ga0068864_100516958 3300005618 Bacteria 1150
267 Ga0068866_10006754 3300005718 Bacteria 4785
268 Ga0068866_10038191 3300005718 Bacteria 2363
269 Ga0068866_10210292 3300005718 Bacteria 1167
270 Ga0068866_10270163 3300005718 Unclassified 1049
271 Ga0068861_100760985 3300005719 Bacteria 906
272 Ga0068851_10339463 3300005834 Bacteria 872
273 Ga0068851_10518329 3300005834 Unclassified 717
274 Ga0068870_10000641 3300005840 Bacteria 13340
275 Ga0068863_100012164 3300005841 Bacteria 8311
276 Ga0068863_100037948 3300005841 Bacteria 4585
277 Ga0068863_100082470 3300005841 Bacteria 3047
278 Ga0068863_100253000 3300005841 Bacteria 1702
279 Ga0068863_101040830 3300005841 Bacteria 822
280 Ga0068858_100004455 3300005842 Bacteria 13728
281 Ga0068858_100047139 3300005842 Bacteria 3996
282 Ga0068858_100070184 3300005842 Bacteria 3247
283 Ga0068860_100005346 3300005843 Bacteria 13033
284 Ga0068860_100163095 3300005843 Bacteria 2150
285 Ga0068860_100535099 3300005843 Bacteria 1172
286 Ga0068862_100026563 3300005844 Bacteria 4867
287 Ga0081540_1024261 3300005983 Bacteria 3523
288 Ga0070717_10002868 3300006028 Bacteria 12228
289 Ga0070717_10011716 3300006028 Bacteria 6671
290 Ga0070717_10012576 3300006028 Bacteria 6457
291 Ga0070717_10014948 3300006028 Bacteria 5979
292 Ga0070717_10027218 3300006028 Bacteria 4569
293 Ga0070717_10056258 3300006028 Unclassified 3249
294 Ga0070717_10067301 3300006028 Bacteria 2980
295 Ga0070717_10070734 3300006028 Bacteria 2909
296 Ga0070717_10150529 3300006028 Bacteria 2013
297 Ga0070717_10166834 3300006028 Unclassified 1913
298 Ga0070717_10231654 3300006028 Bacteria 1626
299 Ga0070717_10374817 3300006028 Bacteria 1275
300 Ga0070717_10407691 3300006028 Unclassified 1222
301 Ga0070717_10434388 3300006028 Bacteria 1182
302 Ga0070717_10770460 3300006028 Bacteria 875
303 Ga0070715_10003724 3300006163 Bacteria 4903
304 Ga0070715_10006827 3300006163 Bacteria 3897
305 Ga0070715_10061334 3300006163 Bacteria 1651
306 Ga0070715_10103761 3300006163 Bacteria 1331
307 Ga0070716_100000337 3300006173 Bacteria 18968
308 Ga0070716_100005134 3300006173 Bacteria 6328
309 Ga0070716_100076275 3300006173 Bacteria 1986
310 Ga0070716_100101316 3300006173 Bacteria 1766
311 Ga0070716_100881452 3300006173 Unclassified 699
312 Ga0070712_100000117 3300006175 Bacteria 41403
313 Ga0070712_100001060 3300006175 Bacteria 16615
314 Ga0070712_100003616 3300006175 Bacteria 9531
315 Ga0070712_100016517 3300006175 Bacteria 4770
316 Ga0070712_100022864 3300006175 Unclassified 4122
317 Ga0070712_100046445 3300006175 Bacteria 3002
318 Ga0070712_100068359 3300006175 Bacteria 2531
319 Ga0070712_100179972 3300006175 Bacteria 1647
320 Ga0070712_100245775 3300006175 Bacteria 1427
321 Ga0070712_100249283 3300006175 Bacteria 1418
322 Ga0070712_100256615 3300006175 Bacteria 1399
323 Ga0070712_100456631 3300006175 Unclassified 1065
324 Ga0070712_100529470 3300006175 Bacteria 991
325 Ga0070712_100688103 3300006175 Unclassified 871
326 Ga0097621_100000279 3300006237 Bacteria 34252
327 Ga0097621_100000712 3300006237 Bacteria 23346
328 Ga0097621_100002496 3300006237 Bacteria 12605
329 Ga0097621_100282120 3300006237 Bacteria 1462
330 Ga0097621_100785347 3300006237 Bacteria 881
331 Ga0068871_100000304 3300006358 Bacteria 34254
332 Ga0068871_100001868 3300006358 Bacteria 14246
333 Ga0068871_100037189 3300006358 Bacteria 3881
334 Ga0068871_100161874 3300006358 Unclassified 1914
335 Ga0068871_100218018 3300006358 Bacteria 1652
336 Ga0068871_100263372 3300006358 Unclassified 1504
337 Ga0068871_100287775 3300006358 Bacteria 1439
338 Ga0075433_10006367 3300006852 Bacteria 9334
339 Ga0075433_10037506 3300006852 Bacteria 4182
340 Ga0075434_100000005 3300006871 Bacteria 104425
341 Ga0075434_100000969 3300006871 Bacteria 23145
342 Ga0075434_100041426 3300006871 Bacteria 4563
343 Ga0075434_100194236 3300006871 Bacteria 2050
344 Ga0068865_100009244 3300006881 Bacteria 6103
345 Ga0068865_100332053 3300006881 Unclassified 1226
346 Ga0075436_100007285 3300006914 Bacteria 7566
347 Ga0075436_100015313 3300006914 Bacteria 5254
348 Ga0075436_100015445 3300006914 Bacteria 5228
349 Ga0075436_100034652 3300006914 Bacteria 3481
350 Ga0075436_100082200 3300006914 Bacteria 2234
351 Ga0075436_100154951 3300006914 Unclassified 1613
352 Ga0075436_100163032 3300006914 Unclassified 1572
353 Ga0075436_100492305 3300006914 Bacteria 896
354 Ga0097620_100000885 3300006931 Bacteria 30517
355 Ga0097620_100199331 3300006931 Bacteria 2086
356 Ga0075435_100003087 3300007076 Bacteria 11241
357 Ga0075435_100024980 3300007076 Bacteria 4645
358 Ga0075435_100025274 3300007076 Bacteria 4622
359 Ga0075435_100358707 3300007076 Unclassified 1250
360 Ga0075435_100438932 3300007076 Bacteria 1125
361 Ga0099795_10223978 3300007788 Bacteria 802
362 Ga0105240_10002552 3300009093 Bacteria 29190
363 Ga0105240_10007213 3300009093 Bacteria 16187
364 Ga0105240_10059972 3300009093 Bacteria 4745
365 Ga0105240_10087608 3300009093 Unclassified 3812
366 Ga0105240_10164930 3300009093 Bacteria 2628
367 Ga0105240_10216653 3300009093 Bacteria 2233
368 Ga0105240_10447771 3300009093 Bacteria 1446
369 Ga0105240_10659300 3300009093 Bacteria 1146
370 Ga0105240_10686379 3300009093 Unclassified 1119
371 Ga0105240_11160122 3300009093 Bacteria 820
372 Ga0105240_11476431 3300009093 Bacteria 713
373 Ga0105245_10003405 3300009098 Bacteria 14246
374 Ga0105245_10044347 3300009098 Bacteria 3969
375 Ga0105245_10067028 3300009098 Unclassified 3250
376 Ga0105245_10371530 3300009098 Bacteria 1422
377 Ga0105247_10006854 3300009101 Bacteria 7021
378 Ga0114129_10022771 3300009147 Bacteria 8884
379 Ga0114129_10928432 3300009147 Bacteria 1101
380 Ga0114129_11471842 3300009147 Bacteria 838
381 Ga0105241_10002278 3300009174 Bacteria 14426
382 Ga0105241_10014672 3300009174 Bacteria 5735
383 Ga0105241_10047441 3300009174 Bacteria 3266
384 Ga0105241_10103498 3300009174 Bacteria 2267
385 Ga0105241_10227672 3300009174 Unclassified 1570
386 Ga0105241_10228395 3300009174 Bacteria 1568
387 Ga0105241_10293617 3300009174 Bacteria 1393
388 Ga0105241_10530602 3300009174 Bacteria 1054
389 Ga0105242_10024992 3300009176 Bacteria 4721
390 Ga0105242_10537825 3300009176 Bacteria 1118
391 Ga0105248_10031636 3300009177 Bacteria 5911
392 Ga0105248_10043691 3300009177 Bacteria 5026
393 Ga0105248_10095323 3300009177 Bacteria 3351
394 Ga0105248_10394575 3300009177 Bacteria 1558
395 Ga0105248_10675500 3300009177 Bacteria 1165
396 Ga0105237_10019037 3300009545 Bacteria 7097
397 Ga0105237_10257336 3300009545 Bacteria 1748
398 Ga0105237_10296892 3300009545 Bacteria 1618
399 Ga0105237_10298370 3300009545 Bacteria 1614
400 Ga0105237_10923841 3300009545 Bacteria 880
401 Ga0105237_11421464 3300009545 Bacteria 700
402 Ga0105238_10002919 3300009551 Bacteria 17068
403 Ga0105238_10041603 3300009551 Unclassified 4654
404 Ga0105238_10104051 3300009551 Bacteria 2820
405 Ga0105238_10212205 3300009551 Bacteria 1912
406 Ga0105249_10044335 3300009553 Bacteria 4045
407 Ga0105249_10542083 3300009553 Bacteria 1213
408 Ga0105249_11136323 3300009553 Unclassified 851
409 Ga0099796_10048775 3300010159 Bacteria 1462
410 Ga0105239_10017824 3300010375 Bacteria 7854
411 Ga0105239_10080832 3300010375 Bacteria 3576
412 Ga0105239_10081568 3300010375 Bacteria 3560
413 Ga0105239_10199907 3300010375 Bacteria 2239
414 Ga0105239_10271004 3300010375 Bacteria 1909
415 Ga0105239_11288240 3300010375 Unclassified 843
416 Ga0105246_10003185 3300011119 Bacteria 9972
417 Ga0157373_10067274 3300013100 Bacteria 2534
418 Ga0157373_10113101 3300013100 Bacteria 1908
419 Ga0157373_10259488 3300013100 Bacteria 1230
420 Ga0157373_10326479 3300013100 Unclassified 1092
421 Ga0157371_10172086 3300013102 Bacteria 1548
422 Ga0157370_10033829 3300013104 Bacteria 4982
423 Ga0157370_10094369 3300013104 Bacteria 2807
424 Ga0157370_10105410 3300013104 Bacteria 2639
425 Ga0157369_10000243 3300013105 Bacteria 75602
426 Ga0157369_10002120 3300013105 Bacteria 23917
427 Ga0157369_10009538 3300013105 Bacteria 11100
428 Ga0157369_10019842 3300013105 Bacteria 7522
429 Ga0157369_10045930 3300013105 Bacteria 4748
430 Ga0157369_10050031 3300013105 Bacteria 4528
431 Ga0157369_10074211 3300013105 Bacteria 3648
432 Ga0157369_10076892 3300013105 Bacteria 3578
433 Ga0157369_10094000 3300013105 Bacteria 3201
434 Ga0157369_10236466 3300013105 Bacteria 1909
435 Ga0157369_10241931 3300013105 Bacteria 1885
436 Ga0157369_10385930 3300013105 Bacteria 1453
437 Ga0157369_10609448 3300013105 Bacteria 1127
438 Ga0157374_10001216 3300013296 Bacteria 22009
439 Ga0157374_10001860 3300013296 Bacteria 17768
440 Ga0157374_10011248 3300013296 Bacteria 7740
441 Ga0157374_10024826 3300013296 Bacteria 5376
442 Ga0157374_10234055 3300013296 Bacteria 1805
443 Ga0157374_10435143 3300013296 Bacteria 1312
444 Ga0157374_10445337 3300013296 Unclassified 1296
445 Ga0157374_10543456 3300013296 Bacteria 1169
446 Ga0157374_10665714 3300013296 Unclassified 1053
447 Ga0157374_10788276 3300013296 Bacteria 966
448 Ga0157378_10000325 3300013297 Bacteria 47034
449 Ga0157378_10000925 3300013297 Bacteria 27033
450 Ga0157378_10001581 3300013297 Bacteria 20568
451 Ga0163162_10027862 3300013306 Bacteria 5588
452 Ga0163162_10082571 3300013306 Bacteria 3286
453 Ga0157372_10004045 3300013307 Bacteria 15713
454 Ga0157372_10005315 3300013307 Bacteria 13677
455 Ga0157372_10015124 3300013307 Bacteria 8260
456 Ga0157372_10015924 3300013307 Bacteria 8063
457 Ga0157372_10037114 3300013307 Bacteria 5372
458 Ga0157372_10073579 3300013307 Bacteria 3852
459 Ga0157372_10492405 3300013307 Unclassified 1429
460 Ga0157372_11241877 3300013307 Bacteria 860
461 Ga0157372_11325405 3300013307 Bacteria 831
462 Ga0157372_11515255 3300013307 Bacteria 772
463 Ga0157375_10738840 3300013308 Bacteria 1136
464 Ga0157375_11552976 3300013308 Bacteria 782
465 Ga0163163_10001425 3300014325 Bacteria 20233
466 Ga0163163_10018723 3300014325 Bacteria 6489
467 Ga0163163_10107681 3300014325 Bacteria 2814
468 Ga0163163_10679059 3300014325 Bacteria 1093
469 Ga0163163_10946111 3300014325 Bacteria 925
470 Ga0163163_11077830 3300014325 Bacteria 866
471 Ga0157380_10100323 3300014326 Bacteria 2410
472 Ga0182008_10006237 3300014497 Bacteria 6699
473 Ga0182008_10051708 3300014497 Bacteria 2038
474 Ga0182008_10209395 3300014497 Bacteria 994
475 Ga0157377_10000286 3300014745 Bacteria 24143
476 Ga0157379_10001394 3300014968 Bacteria 19786
477 Ga0157379_10906224 3300014968 Bacteria 837
478 Ga0157376_10001475 3300014969 Bacteria 15497
479 Ga0157376_10015440 3300014969 Bacteria 5769
480 Ga0182006_1159862 3300015261 Unclassified 759
481 Ga0182007_10004788 3300015262 Bacteria 6077
482 Ga0182005_1008641 3300015265 Bacteria 2992
483 Ga0163161_10001313 3300017792 Bacteria 18509
484 Ga0197907_10220925 3300020069 Unclassified 1583
485 Ga0206350_10573770 3300020080 Bacteria 715
486 Ga0213874_10040258 3300021377 Bacteria 1395
487 Ga0213874_10040613 3300021377 Bacteria 1390
488 Ga0213874_10054554 3300021377 Bacteria 1236
489 Ga0224712_10305312 3300022467 Bacteria 745
490 Ga0224569_101258 3300022732 Bacteria 2147
491 Ga0224571_101242 3300022734 Unclassified 1585
492 Ga0224572_1003199 3300024225 Bacteria 2741
493 Ga0224572_1008880 3300024225 Bacteria 1866
494 Ga0224572_1013734 3300024225 Bacteria 1544
495 Ga0224572_1031482 3300024225 Unclassified 1011
496 Ga0228598_1000263 3300024227 Bacteria 10085
497 Ga0228598_1002110 3300024227 Bacteria 4347
498 Ga0228598_1003378 3300024227 Bacteria 3435
499 Ga0207426_1074058 3300025302 Bacteria 941
500 Ga0207697_10002666 3300025315 Bacteria 9135
501 Ga0207697_10207581 3300025315 Bacteria 863
502 Ga0207656_10100183 3300025321 Bacteria 1327
503 Ga0207682_10002185 3300025893 Bacteria 8842
504 Ga0207692_10010027 3300025898 Bacteria 3975
505 Ga0207692_10015954 3300025898 Bacteria 3315
506 Ga0207692_10047958 3300025898 Bacteria 2148
507 Ga0207692_10058174 3300025898 Bacteria 1990
508 Ga0207692_10111873 3300025898 Bacteria 1516
509 Ga0207692_10115646 3300025898 Bacteria 1495
510 Ga0207692_10149360 3300025898 Bacteria 1337
511 Ga0207692_10228683 3300025898 Unclassified 1106
512 Ga0207642_10155439 3300025899 Bacteria 1222
513 Ga0207642_10344192 3300025899 Bacteria 877
514 Ga0207710_10185767 3300025900 Bacteria 1022
515 Ga0207688_10005547 3300025901 Bacteria 6863
516 Ga0207688_10417374 3300025901 Bacteria 834
517 Ga0207680_10053144 3300025903 Bacteria 2431
518 Ga0207680_10060920 3300025903 Bacteria 2299
519 Ga0207647_10004334 3300025904 Bacteria 10521
520 Ga0207647_10013289 3300025904 Bacteria 5714
521 Ga0207647_10051423 3300025904 Bacteria 2547
522 Ga0207685_10005994 3300025905 Bacteria 3268
523 Ga0207685_10025564 3300025905 Bacteria 2040
524 Ga0207699_10001626 3300025906 Bacteria 10649
525 Ga0207699_10007448 3300025906 Bacteria 5355
526 Ga0207699_10088650 3300025906 Bacteria 1937
527 Ga0207699_10092673 3300025906 Bacteria 1900
528 Ga0207699_10213230 3300025906 Bacteria 1314
529 Ga0207699_10425255 3300025906 Bacteria 949
530 Ga0207699_10437583 3300025906 Bacteria 936
531 Ga0207699_10489705 3300025906 Bacteria 886
532 Ga0207699_10492797 3300025906 Unclassified 884
533 Ga0207699_10543877 3300025906 Bacteria 842
534 Ga0207699_10552193 3300025906 Bacteria 836
535 Ga0207645_10000781 3300025907 Bacteria 26560
536 Ga0207643_10001078 3300025908 Bacteria 16138
537 Ga0207705_10079407 3300025909 Bacteria 2389
538 Ga0207705_10200191 3300025909 Unclassified 1513
539 Ga0207684_10000081 3300025910 Bacteria 178619
540 Ga0207684_10000762 3300025910 Bacteria 37545
541 Ga0207684_10007088 3300025910 Bacteria 10134
542 Ga0207684_10014384 3300025910 Bacteria 6824
543 Ga0207684_10079249 3300025910 Bacteria 2794
544 Ga0207684_10087488 3300025910 Bacteria 2655
545 Ga0207684_10267387 3300025910 Bacteria 1475
546 Ga0207684_10624608 3300025910 Bacteria 919
547 Ga0207654_10077294 3300025911 Bacteria 1995
548 Ga0207654_10715517 3300025911 Bacteria 720
549 Ga0207707_10001814 3300025912 Bacteria 19598
550 Ga0207707_10002624 3300025912 Bacteria 16096
551 Ga0207707_10004912 3300025912 Bacteria 11754
552 Ga0207707_10011466 3300025912 Bacteria 7719
553 Ga0207707_10012005 3300025912 Bacteria 7530
554 Ga0207707_10024968 3300025912 Bacteria 5229
555 Ga0207707_10044157 3300025912 Bacteria 3887
556 Ga0207707_10048740 3300025912 Bacteria 3690
557 Ga0207707_10090931 3300025912 Bacteria 2667
558 Ga0207707_10096339 3300025912 Bacteria 2586
559 Ga0207707_10153392 3300025912 Bacteria 2014
560 Ga0207707_10265629 3300025912 Bacteria 1488
561 Ga0207695_10001570 3300025913 Bacteria 37221
562 Ga0207695_10020694 3300025913 Bacteria 7528
563 Ga0207695_10023851 3300025913 Bacteria 6904
564 Ga0207695_10081445 3300025913 Bacteria 3276
565 Ga0207695_10085477 3300025913 Bacteria 3183
566 Ga0207695_10126032 3300025913 Bacteria 2523
567 Ga0207695_10220829 3300025913 Bacteria 1802
568 Ga0207695_11000864 3300025913 Bacteria 716
569 Ga0207671_10186478 3300025914 Bacteria 1616
570 Ga0207671_10424299 3300025914 Bacteria 1058
571 Ga0207693_10000019 3300025915 Bacteria 138082
572 Ga0207693_10000158 3300025915 Bacteria 63123
573 Ga0207693_10004951 3300025915 Bacteria 11192
574 Ga0207693_10005955 3300025915 Bacteria 10118
575 Ga0207693_10010174 3300025915 Bacteria 7639
576 Ga0207693_10016464 3300025915 Bacteria 5908
577 Ga0207693_10017284 3300025915 Bacteria 5753
578 Ga0207693_10026910 3300025915 Bacteria 4550
579 Ga0207693_10056311 3300025915 Bacteria 3083
580 Ga0207693_10162560 3300025915 Bacteria 1757
581 Ga0207693_10184687 3300025915 Bacteria 1641
582 Ga0207693_10237810 3300025915 Bacteria 1430
583 Ga0207693_10423031 3300025915 Bacteria 1041
584 Ga0207693_10806600 3300025915 Bacteria 723
585 Ga0207663_10000394 3300025916 Bacteria 18953
586 Ga0207663_10003222 3300025916 Bacteria 7950
587 Ga0207663_10032413 3300025916 Bacteria 3102
588 Ga0207663_10064412 3300025916 Bacteria 2339
589 Ga0207663_10123226 3300025916 Bacteria 1778
590 Ga0207663_10146699 3300025916 Bacteria 1650
591 Ga0207663_10197602 3300025916 Bacteria 1448
592 Ga0207663_10453994 3300025916 Bacteria 989
593 Ga0207660_10004717 3300025917 Bacteria 8876
594 Ga0207660_10030153 3300025917 Unclassified 3727
595 Ga0207660_10099605 3300025917 Bacteria 2169
596 Ga0207660_10472762 3300025917 Unclassified 1015
597 Ga0207660_10812024 3300025917 Bacteria 763
598 Ga0207662_10004934 3300025918 Bacteria 7054
599 Ga0207657_10000311 3300025919 Bacteria 51649
600 Ga0207657_10001224 3300025919 Bacteria 27379
601 Ga0207657_10013003 3300025919 Bacteria 8180
602 Ga0207649_10002645 3300025920 Bacteria 9951
603 Ga0207649_10285714 3300025920 Bacteria 1201
604 Ga0207649_10379415 3300025920 Bacteria 1053
605 Ga0207649_10398888 3300025920 Bacteria 1029
606 Ga0207649_10910217 3300025920 Unclassified 690
607 Ga0207652_10008939 3300025921 Bacteria 8072
608 Ga0207652_10066816 3300025921 Bacteria 3117
609 Ga0207652_10322451 3300025921 Bacteria 1395
610 Ga0207652_10510132 3300025921 Bacteria 1082
611 Ga0207652_10539200 3300025921 Bacteria 1049
612 Ga0207646_10000334 3300025922 Bacteria 63767
613 Ga0207646_10004011 3300025922 Bacteria 16291
614 Ga0207646_10005419 3300025922 Bacteria 13420
615 Ga0207646_10008546 3300025922 Bacteria 10244
616 Ga0207646_10014759 3300025922 Bacteria 7403
617 Ga0207646_10025466 3300025922 Bacteria 5412
618 Ga0207646_10089627 3300025922 Bacteria 2753
619 Ga0207646_10620516 3300025922 Bacteria 970
620 Ga0207646_10682214 3300025922 Bacteria 919
621 Ga0207681_10063854 3300025923 Bacteria 2540
622 Ga0207681_10893518 3300025923 Bacteria 744
623 Ga0207694_10000896 3300025924 Bacteria 26371
624 Ga0207694_10026092 3300025924 Unclassified 4443
625 Ga0207694_10090793 3300025924 Bacteria 2410
626 Ga0207694_10124758 3300025924 Unclassified 2059
627 Ga0207694_10350570 3300025924 Bacteria 1222
628 Ga0207694_10641146 3300025924 Bacteria 895
629 Ga0207650_10000063 3300025925 Bacteria 146432
630 Ga0207650_10040526 3300025925 Bacteria 3409
631 Ga0207650_10200591 3300025925 Bacteria 1598
632 Ga0207650_10270125 3300025925 Unclassified 1382
633 Ga0207659_10198885 3300025926 Unclassified 1599
634 Ga0207659_10486190 3300025926 Bacteria 1043
635 Ga0207687_10001952 3300025927 Bacteria 14189
636 Ga0207687_10041927 3300025927 Unclassified 3146
637 Ga0207687_10158728 3300025927 Bacteria 1733
638 Ga0207700_10000129 3300025928 Bacteria 44957
639 Ga0207700_10000233 3300025928 Bacteria 33328
640 Ga0207700_10000348 3300025928 Bacteria 27120
641 Ga0207700_10027210 3300025928 Unclassified 4001
642 Ga0207700_10042188 3300025928 Bacteria 3343
643 Ga0207700_10073121 3300025928 Bacteria 2646
644 Ga0207700_10084711 3300025928 Bacteria 2486
645 Ga0207700_10087348 3300025928 Bacteria 2452
646 Ga0207700_10110841 3300025928 Unclassified 2208
647 Ga0207700_10136524 3300025928 Bacteria 2010
648 Ga0207700_10221476 3300025928 Bacteria 1604
649 Ga0207700_10230801 3300025928 Bacteria 1573
650 Ga0207700_10279530 3300025928 Bacteria 1435
651 Ga0207700_10438623 3300025928 Bacteria 1149
652 Ga0207700_10497961 3300025928 Bacteria 1078
653 Ga0207700_10628283 3300025928 Bacteria 957
654 Ga0207700_10675797 3300025928 Unclassified 921
655 Ga0207700_10791731 3300025928 Bacteria 848
656 Ga0207700_10950828 3300025928 Unclassified 769
657 Ga0207664_10000284 3300025929 Bacteria 38480
658 Ga0207664_10022822 3300025929 Bacteria 4680
659 Ga0207664_10065466 3300025929 Unclassified 2910
660 Ga0207664_10104533 3300025929 Bacteria 2345
661 Ga0207664_10196730 3300025929 Bacteria 1738
662 Ga0207664_10278299 3300025929 Bacteria 1468
663 Ga0207664_10290809 3300025929 Bacteria 1436
664 Ga0207664_10357885 3300025929 Unclassified 1293
665 Ga0207664_10417528 3300025929 Bacteria 1195
666 Ga0207664_10770535 3300025929 Bacteria 865
667 Ga0207644_10004369 3300025931 Bacteria 9169
668 Ga0207644_10037893 3300025931 Bacteria 3393
669 Ga0207644_10165591 3300025931 Bacteria 1722
670 Ga0207644_10803086 3300025931 Bacteria 787
671 Ga0207644_10897068 3300025931 Bacteria 743
672 Ga0207690_10507293 3300025932 Bacteria 976
673 Ga0207690_10900353 3300025932 Bacteria 734
674 Ga0207706_10001937 3300025933 Bacteria 20312
675 Ga0207706_10119693 3300025933 Bacteria 2315
676 Ga0207670_10099607 3300025936 Bacteria 2073
677 Ga0207670_10422801 3300025936 Bacteria 1069
678 Ga0207704_10271304 3300025938 Unclassified 1285
679 Ga0207665_10000109 3300025939 Bacteria 53830
680 Ga0207665_10013403 3300025939 Bacteria 5390
681 Ga0207665_10016509 3300025939 Bacteria 4849
682 Ga0207665_10086268 3300025939 Bacteria 2167
683 Ga0207665_10122953 3300025939 Bacteria 1835
684 Ga0207665_10124518 3300025939 Bacteria 1824
685 Ga0207665_10129107 3300025939 Bacteria 1792
686 Ga0207665_10201787 3300025939 Bacteria 1449
687 Ga0207665_10438103 3300025939 Bacteria 1001
688 Ga0207665_10739481 3300025939 Unclassified 775
689 Ga0207665_10958087 3300025939 Unclassified 680
690 Ga0207691_10001123 3300025940 Bacteria 26596
691 Ga0207711_10043977 3300025941 Bacteria 3811
692 Ga0207711_10115246 3300025941 Bacteria 2394
693 Ga0207711_10135993 3300025941 Bacteria 2207
694 Ga0207711_10542172 3300025941 Bacteria 1085
695 Ga0207689_10001298 3300025942 Bacteria 24081
696 Ga0207689_10130321 3300025942 Unclassified 2070
697 Ga0207689_10483165 3300025942 Bacteria 1037
698 Ga0207661_10000156 3300025944 Bacteria 43880
699 Ga0207661_10024048 3300025944 Bacteria 4610
700 Ga0207661_10053000 3300025944 Bacteria 3244
701 Ga0207661_10749830 3300025944 Unclassified 899
702 Ga0207679_10000588 3300025945 Bacteria 24327
703 Ga0207679_10001790 3300025945 Bacteria 13372
704 Ga0207667_10000188 3300025949 Bacteria 90598
705 Ga0207667_10000302 3300025949 Bacteria 68245
706 Ga0207667_10009252 3300025949 Bacteria 11632
707 Ga0207667_10013037 3300025949 Bacteria 9542
708 Ga0207667_10027559 3300025949 Bacteria 6181
709 Ga0207667_10034008 3300025949 Bacteria 5476
710 Ga0207667_10081567 3300025949 Bacteria 3350
711 Ga0207667_10175356 3300025949 Bacteria 2203
712 Ga0207667_10352037 3300025949 Bacteria 1502
713 Ga0207667_10435883 3300025949 Bacteria 1333
714 Ga0207667_10524281 3300025949 Unclassified 1200
715 Ga0207667_10529480 3300025949 Bacteria 1193
716 Ga0207667_10811916 3300025949 Bacteria 931
717 Ga0207667_10817611 3300025949 Bacteria 928
718 Ga0207667_11027943 3300025949 Bacteria 810
719 Ga0207651_10072540 3300025960 Bacteria 2444
720 Ga0207651_10082588 3300025960 Bacteria 2320
721 Ga0207651_10966899 3300025960 Bacteria 760
722 Ga0207712_10100024 3300025961 Bacteria 2154
723 Ga0207668_10069067 3300025972 Bacteria 2514
724 Ga0207640_10006509 3300025981 Bacteria 6415
725 Ga0207640_10014840 3300025981 Bacteria 4494
726 Ga0207640_10070946 3300025981 Bacteria 2345
727 Ga0207640_10171438 3300025981 Bacteria 1617
728 Ga0207658_10320430 3300025986 Bacteria 1342
729 Ga0207658_10320467 3300025986 Bacteria 1341
730 Ga0207658_11403314 3300025986 Bacteria 639
731 Ga0207677_10012203 3300026023 Unclassified 4929
732 Ga0207677_10018172 3300026023 Bacteria 4214
733 Ga0207677_10082030 3300026023 Bacteria 2316
734 Ga0207677_10098027 3300026023 Bacteria 2149
735 Ga0207677_10570310 3300026023 Bacteria 989
736 Ga0207703_10001842 3300026035 Bacteria 18897
737 Ga0207703_10049928 3300026035 Bacteria 3384
738 Ga0207703_10137491 3300026035 Unclassified 2117
739 Ga0207703_10274595 3300026035 Unclassified 1528
740 Ga0207639_10117177 3300026041 Bacteria 2182
741 Ga0207639_10208331 3300026041 Bacteria 1681
742 Ga0207639_10255343 3300026041 Bacteria 1530
743 Ga0207639_10458632 3300026041 Unclassified 1158
744 Ga0207678_10000443 3300026067 Bacteria 37711
745 Ga0207702_10000120 3300026078 Bacteria 91853
746 Ga0207702_10001675 3300026078 Bacteria 21899
747 Ga0207702_10009760 3300026078 Bacteria 8058
748 Ga0207702_10036655 3300026078 Unclassified 4102
749 Ga0207702_10062637 3300026078 Unclassified 3177
750 Ga0207702_10083250 3300026078 Bacteria 2783
751 Ga0207702_10327015 3300026078 Bacteria 1461
752 Ga0207702_10521314 3300026078 Bacteria 1160
753 Ga0207702_10527538 3300026078 Unclassified 1153
754 Ga0207641_10000131 3300026088 Bacteria 110151
755 Ga0207641_10016212 3300026088 Bacteria 6103
756 Ga0207641_10072350 3300026088 Bacteria 2969
757 Ga0207641_10317002 3300026088 Bacteria 1477
758 Ga0207641_10895527 3300026088 Bacteria 881
759 Ga0207648_10000403 3300026089 Bacteria 48140
760 Ga0207648_10091189 3300026089 Bacteria 2664
761 Ga0207676_10000517 3300026095 Bacteria 32477
762 Ga0207676_10002843 3300026095 Bacteria 12326
763 Ga0207676_10012744 3300026095 Bacteria 6032
764 Ga0207676_10017081 3300026095 Bacteria 5257
765 Ga0207676_10729253 3300026095 Unclassified 962
766 Ga0207676_10936319 3300026095 Bacteria 851
767 Ga0207674_10000056 3300026116 Bacteria 113265
768 Ga0207674_10000201 3300026116 Bacteria 74066
769 Ga0207674_10010860 3300026116 Bacteria 10264
770 Ga0207683_10000848 3300026121 Bacteria 28069
771 Ga0207683_10217698 3300026121 Bacteria 1739
772 Ga0207683_10301977 3300026121 Bacteria 1465
773 Ga0207683_10622655 3300026121 Bacteria 999
774 Ga0207698_10041264 3300026142 Unclassified 3437
775 Ga0207698_10071903 3300026142 Bacteria 2747
776 Ga0207698_10269322 3300026142 Bacteria 1569
777 Ga0268266_10002994 3300028379 Bacteria 17410
778 Ga0268266_10024815 3300028379 Bacteria 5101
779 Ga0268266_10031914 3300028379 Bacteria 4475
780 Ga0268265_10001656 3300028380 Bacteria 18220
781 Ga0268264_10003976 3300028381 Bacteria 12651
782 Ga0268264_10129387 3300028381 Bacteria 2236
783 Ga0268264_10502990 3300028381 Bacteria 1182
784 Ga0265336_10002308 3300028666 Bacteria 7955
785 Ga0265336_10006115 3300028666 Bacteria 4365
786 Ga0265338_10008619 3300028800 Bacteria 12334
787 Ga0265338_10045200 3300028800 Unclassified 4053
788 Ga0265338_10049670 3300028800 Unclassified 3799
789 Ga0265338_10079931 3300028800 Bacteria 2749
790 Ga0265338_10122311 3300028800 Bacteria 2071
791 Ga0265338_10504030 3300028800 Unclassified 852
792 Ga0265324_10071311 3300029957 Bacteria 1184
793 Ga0265324_10151339 3300029957 Bacteria 788
794 Ga0265762_1000263 3300030760 Bacteria 8735
795 Ga0265762_1031420 3300030760 Bacteria 1009
796 Ga0265765_1003039 3300030879 Bacteria 1663
797 Ga0265760_10003581 3300031090 Bacteria 4507
798 Ga0265760_10013154 3300031090 Bacteria 2368
799 Ga0265330_10000216 3300031235 Bacteria 44839
800 Ga0265330_10107139 3300031235 Bacteria 1195
801 Ga0265328_10002261 3300031239 Bacteria 8684
802 Ga0265325_10000249 3300031241 Bacteria 38332
803 Ga0265325_10001092 3300031241 Bacteria 19505
804 Ga0265325_10002613 3300031241 Bacteria 12063
805 Ga0265325_10004469 3300031241 Bacteria 8832
806 Ga0265325_10027277 3300031241 Bacteria 3087
807 Ga0265325_10115609 3300031241 Bacteria 1299
808 Ga0265329_10006633 3300031242 Unclassified 4578
809 Ga0265340_10001240 3300031247 Bacteria 14627
810 Ga0265340_10005066 3300031247 Bacteria 7326
811 Ga0265340_10011713 3300031247 Bacteria 4653
812 Ga0265340_10058024 3300031247 Bacteria 1859
813 Ga0265340_10283011 3300031247 Bacteria 736
814 Ga0265339_10002285 3300031249 Bacteria 13823
815 Ga0265339_10007283 3300031249 Bacteria 7168
816 Ga0265339_10007957 3300031249 Bacteria 6799
817 Ga0265339_10018564 3300031249 Bacteria 4096
818 Ga0265339_10062462 3300031249 Bacteria 2002
819 Ga0265339_10081517 3300031249 Unclassified 1710
820 Ga0265339_10087663 3300031249 Bacteria 1636
821 Ga0265339_10091987 3300031249 Unclassified 1588
822 Ga0265339_10106662 3300031249 Unclassified 1453
823 Ga0265339_10166709 3300031249 Bacteria 1105
824 Ga0265316_10006447 3300031344 Bacteria 11208
825 Ga0265316_10012816 3300031344 Bacteria 7490
826 Ga0265316_10014051 3300031344 Bacteria 7070
827 Ga0265316_10018325 3300031344 Bacteria 6018
828 Ga0265316_10033744 3300031344 Bacteria 4165
829 Ga0265316_10061602 3300031344 Unclassified 2913
830 Ga0265316_10075358 3300031344 Bacteria 2595
831 Ga0265316_10138143 3300031344 Bacteria 1832
832 Ga0265316_10212805 3300031344 Bacteria 1429
833 Ga0307408_100606656 3300031548 Bacteria 973
834 Ga0265313_10028796 3300031595 Unclassified 2881
835 Ga0265313_10061217 3300031595 Unclassified 1762
836 Ga0265313_10187707 3300031595 Bacteria 866
837 Ga0265314_10000239 3300031711 Bacteria 80839
838 Ga0265314_10024977 3300031711 Bacteria 4517
839 Ga0265314_10026822 3300031711 Bacteria 4323
840 Ga0265342_10089547 3300031712 Bacteria 1766
841 Ga0265342_10101518 3300031712 Bacteria 1638
842 Ga0265342_10126090 3300031712 Bacteria 1437
843 Ga0265342_10135676 3300031712 Unclassified 1375
844 Ga0265342_10312068 3300031712 Bacteria 826
845 Ga0307405_10396682 3300031731 Bacteria 1079
846 Ga0307410_10841835 3300031852 Bacteria 783
847 Ga0307407_10061760 3300031903 Bacteria 2192
848 Ga0307409_100000830 3300031995 Bacteria 14219
849 Ga0307409_100178699 3300031995 Bacteria 1876
850 Ga0307416_100096091 3300032002 Bacteria 2561
851 Ga0307411_10126790 3300032005 Bacteria 1858
852 Ga0307415_100057830 3300032126 Bacteria 2667
853 Ga0307415_101287575 3300032126 Unclassified 692
854 Ga0373938_0088007 3300034957 Unclassified 765
855 Ga0373926_0010000 3300035083 Bacteria 3175
856 Ga0373926_0020347 3300035083 Bacteria 2292
857 Ga0373926_0105118 3300035083 Unclassified 1058
858 Ga0373934_0004411 3300035086 Bacteria 5197
859 Ga0373934_0160448 3300035086 Unclassified 922
860 Ga0373944_0109097 3300035089 Unclassified 943
861 Ga0373923_0034945 3300035111 Bacteria 2043
862 Ga0373923_0048753 3300035111 Bacteria 1769
863 Ga0373936_0001435 3300035113 Bacteria 8671
864 Ga0373936_0033081 3300035113 Bacteria 2048
865 Ga0373936_0132501 3300035113 Unclassified 1072
866 Ga0373936_0280289 3300035113 Bacteria 749
867 Ga0373945_0001479 3300035116 Bacteria 7184
868 Ga0373945_0069093 3300035116 Bacteria 1334
869 Ga0373945_0099123 3300035116 Bacteria 1138
870 Ga0373945_0207116 3300035116 Unclassified 816
871 Ga0373953_0087301 3300035117 Bacteria 1302
872 Ga0373954_0008005 3300035118 Bacteria 4631
873 Ga0373954_0312806 3300035118 Bacteria 775
874 Ga0373956_0185992 3300035119 Unclassified 983
875 Ga0373956_0258463 3300035119 Bacteria 828
876 Ga0373957_0052285 3300035120 Bacteria 1564
877 Ga0373943_0000141 3300035170 Bacteria 27422
878 Ga0373943_0002710 3300035170 Bacteria 8042
879 Ga0373943_0029568 3300035170 Bacteria 2589
880 Ga0373943_0239179 3300035170 Bacteria 1017
881 Ga0373943_0306472 3300035170 Unclassified 903
882 Ga0373946_0157980 3300035171 Bacteria 1062
883 Ga0373955_0030154 3300035172 Bacteria 2828
884 Ga0373955_0069620 3300035172 Bacteria 1964
885 Ga0373955_0154660 3300035172 Bacteria 1351
886 Ga0373924_0000021 3300035410 Bacteria 39808
887 Ga0373924_0008113 3300035410 Bacteria 3804
888 Ga0373935_0002090 3300035692 Bacteria 11335
889 Ga0373935_0018584 3300035692 Bacteria 4231
890 Ga0373935_0271557 3300035692 Bacteria 1192
891 Ga0373935_0404909 3300035692 Unclassified 980
892 Ga0373927_0003981 3300035695 Bacteria 10449
893 Ga0373927_0005726 3300035695 Bacteria 8534
894 Ga0373927_0010171 3300035695 Bacteria 6290
895 Ga0373927_0096655 3300035695 Bacteria 1920
896 Ga0373927_0309430 3300035695 Bacteria 1040
897 Ga0373927_0327525 3300035695 Bacteria 1009
898 Ga0373927_0357412 3300035695 Unclassified 963
899 Ga0373933_0062465 3300035724 Bacteria 2249
900 Ga0373933_0078091 3300035724 Bacteria 2025
901 Ga0373933_0087060 3300035724 Bacteria 1923
902 Ga0373933_0650431 3300035724 Unclassified 693
903 Ga0373947_0001591 3300035725 Bacteria 13923
904 Ga0373947_0002655 3300035725 Bacteria 10745
905 Ga0373947_0023446 3300035725 Bacteria 3590
906 Ga0373947_0120009 3300035725 Bacteria 1669
907 Ga0373947_0259633 3300035725 Bacteria 1151
908 Ga0373947_0307181 3300035725 Bacteria 1058
909 Ga0373937_0000090 3300036401 Bacteria 84561
910 Ga0373937_0012656 3300036401 Bacteria 7425
911 Ga0373937_0037458 3300036401 Bacteria 4420
912 Ga0373937_0084735 3300036401 Bacteria 2932
913 Ga0373937_0178364 3300036401 Bacteria 1995
914 Ga0373937_0220053 3300036401 Bacteria 1787
915 Ga0373937_0253273 3300036401 Bacteria 1660
916 Ga0373937_0799166 3300036401 Unclassified 891
917 Ga0373925_0002098 3300037068 Bacteria 16357
918 Ga0373925_0003638 3300037068 Bacteria 11879
919 Ga0373925_0024365 3300037068 Bacteria 4419
920 Ga0373925_0031436 3300037068 Bacteria 3901
921 Ga0373925_0065788 3300037068 Bacteria 2731
922 Ga0373925_0244951 3300037068 Bacteria 1436
923 Ga0373925_0995700 3300037068 Bacteria 690
924 Ga0373925_1061151 3300037068 Bacteria 667
925 Ga0395900_0754843 3300037418 Bacteria 903
926 Ga0395900_1085604 3300037418 Bacteria 718
927 Ga0395898_0145777 3300037466 Bacteria 2266
928 Ga0395905_0152499 3300037471 Bacteria 2174
929 Ga0395905_0447297 3300037471 Bacteria 1190
930 Ga0395905_1177096 3300037471 Bacteria 670
931 Ga0436364_1537985 3300037853 Bacteria 2479
932 Ga0436365_0369277 3300039437 Bacteria 2132
933 Ga0436365_0589729 3300039437 Unclassified 1759
934 Ga0436365_1128997 3300039437 Bacteria 3599
935 Ga0436363_0075211 3300039450 Bacteria 7880
936 Ga0436363_0405112 3300039450 Bacteria 2388
937 Ga0436363_0631224 3300039450 Bacteria 2351
938 Ga0436363_1002749 3300039450 Bacteria 1658
939 Ga0436363_1108521 3300039450 Unclassified 750
940 Ga0436363_1316118 3300039450 Unclassified 1263
941 Ga0436363_1636503 3300039450 Bacteria 1630
942 Ga0436362_0059665 3300039453 Bacteria 1143
943 Ga0436362_0893348 3300039453 Bacteria 766
944 Ga0453683_0038993 3300044673 Bacteria 2986
945 Ga0466965_0281811 3300044683 Bacteria 898
946 Ga0466966_0074360 3300044684 Bacteria 2124
947 Ga0466966_0145684 3300044684 Bacteria 1446
948 Ga0466963_0001401 3300044694 Bacteria 12935
949 Ga0466963_0054616 3300044694 Bacteria 2655
950 Ga0466963_0130099 3300044694 Bacteria 1738
951 Ga0466963_0629341 3300044694 Unclassified 757
952 Ga0453684_0672333 3300044712 Bacteria 1128
953 Ga0466957_0000027 3300044842 Bacteria 53351
954 Ga0466957_0204542 3300044842 Bacteria 1298
955 Ga0466959_0027847 3300045049 Bacteria 4192
956 Ga0451576_0559213 3300045051 Unclassified 1202
957 Ga0451576_1068463 3300045051 Bacteria 845
958 Ga0451576_1209917 3300045051 Bacteria 789
959 Ga0466958_0018139 3300045836 Bacteria 4079
960 Ga0466958_0148741 3300045836 Bacteria 1477
961 Ga0466958_0189949 3300045836 Bacteria 1305
962 Ga0466958_0319408 3300045836 Unclassified 998
963 Ga0466958_0579904 3300045836 Bacteria 729
964 Ga0466967_0001298 3300045976 Bacteria 14250
965 Ga0466967_0007522 3300045976 Bacteria 7869
966 Ga0466967_0070250 3300045976 Bacteria 3132
967 Ga0466967_0119616 3300045976 Unclassified 2431
968 Ga0466967_0150997 3300045976 Unclassified 2171
969 Ga0466967_0208456 3300045976 Bacteria 1853
970 Ga0466967_0352802 3300045976 Bacteria 1424
971 Ga0466967_0435095 3300045976 Bacteria 1280
972 Ga0466967_1212748 3300045976 Bacteria 752
973 Ga0495629_0153744 3300046459 Bacteria 1599
974 Ga0495629_0198735 3300046459 Bacteria 1386
975 Ga0495651_0180618 3300046462 Bacteria 1494
976 Ga0495580_0001084 3300046472 Bacteria 23894
977 Ga0495580_0001209 3300046472 Bacteria 22740
978 Ga0495580_0002030 3300046472 Bacteria 17811
979 Ga0495580_0013824 3300046472 Bacteria 6146
980 Ga0495580_0022266 3300046472 Bacteria 4665
981 Ga0495580_0071927 3300046472 Bacteria 2416
982 Ga0495580_0238748 3300046472 Bacteria 1246
983 Ga0495580_0323558 3300046472 Bacteria 1048
984 Ga0495580_0689260 3300046472 Bacteria 669
985 Ga0495582_0001249 3300046473 Bacteria 14283
986 Ga0495582_0005964 3300046473 Bacteria 6792
987 Ga0495582_0162835 3300046473 Bacteria 1269
988 Ga0495582_0243630 3300046473 Bacteria 1030
989 Ga0495639_0088124 3300046475 Bacteria 1453
990 Ga0495639_0188868 3300046475 Bacteria 1005
991 Ga0495639_0263263 3300046475 Bacteria 854
992 Ga0495662_0250245 3300046476 Unclassified 873
993 Ga0495664_0045558 3300046477 Bacteria 2601
994 Ga0495664_0124142 3300046477 Bacteria 1561
995 Ga0495594_0011591 3300046499 Bacteria 4584
996 Ga0495606_0225889 3300046507 Bacteria 1052
997 Ga0495606_0263913 3300046507 Bacteria 949
998 Ga0495608_0140966 3300046511 Bacteria 1538
999 Ga0495608_0326312 3300046511 Bacteria 948
1000 Ga0495630_0127662 3300046517 Bacteria 1930
1001 Ga0495643_0022688 3300046522 Bacteria 3577
1002 Ga0495665_0005328 3300046531 Bacteria 6930
1003 Ga0495665_0021444 3300046531 Bacteria 3471
1004 Ga0495665_0052401 3300046531 Unclassified 2160
1005 Ga0495665_0067337 3300046531 Bacteria 1889
1006 Ga0495665_0087833 3300046531 Bacteria 1634
1007 Ga0495665_0250377 3300046531 Unclassified 912
1008 Ga0495622_0076036 3300046557 Bacteria 1548
1009 Ga0495667_0227907 3300046559 Bacteria 1188
1010 Ga0495656_0060580 3300046615 Bacteria 1650
1011 Ga0495668_0246029 3300046616 Bacteria 979
1012 Ga0495625_0025076 3300046660 Bacteria 4527
1013 Ga0495635_0141449 3300046663 Bacteria 1639
1014 Ga0495659_0002349 3300046664 Bacteria 6109
1015 Ga0495588_0291694 3300046674 Bacteria 859
1016 Ga0495588_0437694 3300046674 Bacteria 686
1017 Ga0495657_0247375 3300046675 Bacteria 1074
1018 Ga0495657_0305658 3300046675 Unclassified 948
1019 Ga0495657_0317654 3300046675 Bacteria 926
1020 Ga0495599_0290322 3300046678 Bacteria 989
1021 Ga0495623_0056265 3300046679 Bacteria 2476
1022 Ga0495623_0135734 3300046679 Bacteria 1468
1023 Ga0495623_0298431 3300046679 Unclassified 891
1024 Ga0495623_0416915 3300046679 Unclassified 720
1025 Ga0495658_0170604 3300046683 Bacteria 1346
1026 Ga0495658_0296412 3300046683 Bacteria 1022
1027 Ga0495669_0035537 3300046684 Bacteria 2200
1028 Ga0495669_0225250 3300046684 Unclassified 899
1029 Ga0495669_0384719 3300046684 Bacteria 679
1030 Ga0495613_0002395 3300046689 Bacteria 14200
1031 Ga0495613_0767043 3300046689 Bacteria 631
1032 Ga0495649_0012383 3300046694 Bacteria 4965
1033 Ga0495581_0101977 3300047315 Bacteria 1667
1034 Ga0495636_0111760 3300047318 Bacteria 1203
1035 Ga0495674_0457238 3300047319 Bacteria 1025
1036 Ga0495674_0663367 3300047319 Bacteria 821
1037 Ga0495676_0229278 3300047321 Bacteria 1276
1038 Ga0495683_0038696 3300047323 Bacteria 2414
1039 Ga0495675_0045855 3300047444 Unclassified 2784
1040 Ga0495675_0125230 3300047444 Bacteria 1599
1041 Ga0495684_0124046 3300047471 Bacteria 1944
1042 Ga0495593_0193732 3300047673 Bacteria 1022
1043 Ga0495602_0252774 3300048088 Bacteria 1312
1044 Ga0495602_0348465 3300048088 Unclassified 1069
1045 Ga0495614_0010578 3300048089 Bacteria 4068
1046 Ga0496100_0150797 3300048903 Bacteria 1658
1047 Ga0496101_0747996 3300048904 Bacteria 771
1048 Ga0496101_0929613 3300048904 Unclassified 684
1049 Ga0496102_0032273 3300048905 Bacteria 4705
1050 Ga0496102_0201211 3300048905 Bacteria 1877
1051 Ga0496102_0356990 3300048905 Unclassified 1376
1052 Ga0496102_0416269 3300048905 Bacteria 1262
1053 Ga0496103_0456048 3300048906 Bacteria 820
1054 Ga0496104_0054494 3300048907 Bacteria 3780
1055 Ga0496104_0073409 3300048907 Bacteria 3255
1056 Ga0496104_0075975 3300048907 Unclassified 3199
1057 Ga0496104_0161770 3300048907 Bacteria 2147
1058 Ga0496104_0243639 3300048907 Bacteria 1710
1059 Ga0496104_0314795 3300048907 Bacteria 1478
1060 Ga0496104_0774529 3300048907 Bacteria 866
1061 Ga0496104_1285055 3300048907 Unclassified 635
1062 Ga0496105_0729509 3300048908 Bacteria 758
1063 Ga0496106_0124154 3300048909 Bacteria 2020
1064 Ga0496106_0219808 3300048909 Bacteria 1515
1065 Ga0496108_0000038 3300048911 Bacteria 149482
1066 Ga0496109_0000082 3300048912 Bacteria 99164
1067 Ga0496109_0099379 3300048912 Bacteria 2699
1068 Ga0496109_0164501 3300048912 Bacteria 2079
1069 Ga0496109_0684208 3300048912 Bacteria 963
1070 Ga0496109_1068779 3300048912 Bacteria 744
1071 Ga0496110_0000195 3300048913 Bacteria 38261
1072 Ga0496110_0077168 3300048913 Bacteria 2963
1073 Ga0496110_0225750 3300048913 Bacteria 1703
1074 Ga0496110_0542211 3300048913 Unclassified 1057
1075 Ga0496111_0002758 3300048914 Bacteria 10684
1076 Ga0496111_0008810 3300048914 Bacteria 6702
1077 Ga0496112_0000032 3300048915 Bacteria 116962
1078 Ga0496112_0001293 3300048915 Bacteria 19017
1079 Ga0496112_0032363 3300048915 Bacteria 5078
1080 Ga0496112_0057628 3300048915 Bacteria 3825
1081 Ga0496112_0062423 3300048915 Bacteria 3675
1082 Ga0496112_0067290 3300048915 Bacteria 3535
1083 Ga0496112_0145945 3300048915 Unclassified 2334
1084 Ga0496112_0151886 3300048915 Bacteria 2283
1085 Ga0496112_0313995 3300048915 Unclassified 1512
1086 Ga0496112_0499326 3300048915 Unclassified 1152
1087 Ga0496112_0800059 3300048915 Bacteria 868
1088 Ga0496113_0000094 3300048916 Bacteria 38512
1089 Ga0496113_0036480 3300048916 Unclassified 3602
1090 Ga0496113_0038073 3300048916 Bacteria 3534
1091 Ga0496115_0009730 3300048918 Bacteria 7159
1092 Ga0496115_0019473 3300048918 Bacteria 5222
1093 Ga0496115_0163263 3300048918 Bacteria 1842
1094 Ga0496115_0204328 3300048918 Unclassified 1632
1095 Ga0496115_0599531 3300048918 Unclassified 876
1096 Ga0495682_0010495 3300049460 Bacteria 3586
1097 Ga0501293_007088 3300049516 Bacteria 924
1098 Ga0501299_070855 3300049522 Bacteria 756
1099 Ga0501300_006705 3300049523 Bacteria 1692
1100 Ga0501233_020731 3300049668 Bacteria 1405
1101 Ga0501271_040855 3300049768 Bacteria 604
1102 nmdc:mga05p37_196867_c1 3300050507 Bacteria 2443
1103 nmdc:mga0n895_1076829_c1 3300050512 Bacteria 782
1104 nmdc:mga0n895_2935_c1 3300050512 Bacteria 13530
1105 nmdc:mga0n895_31_c1 3300050512 Bacteria 81579
1106 nmdc:mga0n895_40130_c1 3300050512 Bacteria 4546
1107 nmdc:mga0n895_602194_c1 3300050512 Bacteria 1101
1108 nmdc:mga0rr50_138451_c1 3300050513 Bacteria 1956
1109 nmdc:mga0rr50_1416_c1 3300050513 Bacteria 13144
1110 nmdc:mga0rr50_292208_c1 3300050513 Bacteria 1362
1111 nmdc:mga0rr50_355538_c1 3300050513 Unclassified 1232
1112 nmdc:mga0rr50_437849_c1 3300050513 Unclassified 1107
1113 nmdc:mga0rr50_451970_c1 3300050513 Bacteria 1089
1114 nmdc:mga0rr50_777501_c1 3300050513 Unclassified 817
1115 nmdc:mga08x19_1455_c1 3300050514 Bacteria 14656
1116 nmdc:mga08x19_16655_c2 3300050514 Bacteria 4167
1117 nmdc:mga08x19_200950_c1 3300050514 Bacteria 1366
1118 nmdc:mga08x19_284573_c1 3300050514 Bacteria 1146
1119 nmdc:mga08x19_5358_c1 3300050514 Bacteria 7584
1120 nmdc:mga08x19_65722_c1 3300050514 Bacteria 2356
1121 nmdc:mga0a205_1702_c1 3300050515 Bacteria 18992
1122 nmdc:mga0a205_562_c1 3300050515 Bacteria 29493
1123 Ga0495601_0171732 3300053077 Unclassified 1417
1124 Ga0495601_0504176 3300053077 Unclassified 781
1125 Ga0495612_0158105 3300053078 Bacteria 989
1126 Ga0501084_0166535 3300054114 Bacteria 1860
1127 Ga0587069_036659 3300059642 Bacteria 819
1128 Ga0587107_023162 3300059652 Bacteria 885
1129 Ga0501082_0035560 3300060353 Bacteria 4294
1130 Ga0466962_0111067 3300061719 Bacteria 1320
1131 nmdc:mga08x19_185444_c1
1132 MRS1b_contig_2926443
1133 JGI24752J21851_1004409
1134 JGI24737J22298_10021840
1135 JGI24034J26672_10009286
1136 JGI24751J29686_10000539
1137 rootH2_10166807
1138 rootH1_10207098
1139 Ga0058863_10015630
1140 Ga0058861_11818347
1141 Ga0058862_12695550
1142 Ga0065712_10073970
1143 Ga0065712_10097702
1144 Ga0065715_10155513
1145 Ga0065715_10181645
1146 Ga0070658_10023393
1147 Ga0070683_100022906
1148 Ga0070683_100043047
1149 Ga0070683_100109812
1150 Ga0070683_100338193
1151 Ga0070690_100807264
1152 Ga0070670_100006314
1153 Ga0070670_100215766
1154 Ga0070670_100264093
1155 Ga0070677_10001451
1156 Ga0068869_100026030
1157 Ga0068869_100031914
1158 Ga0068869_100226036
1159 Ga0070666_10016274
1160 Ga0070666_10211616
1161 Ga0070680_100010401
1162 Ga0070680_100018751
1163 Ga0070680_100070274
1164 Ga0070680_100427872
1165 Ga0070680_100880513
1166 Ga0070682_100044123
1167 Ga0068868_100000808
1168 Ga0068868_100012242
1169 Ga0068868_100019290
1170 Ga0068868_100041359
1171 Ga0068868_100055888
1172 Ga0068868_100069378
1173 Ga0068868_100170325
1174 Ga0070660_100000311
1175 Ga0070660_100003019
1176 Ga0070660_100634285
1177 Ga0070689_100026004
1178 Ga0070689_100288435
1179 Ga0070691_10021433
1180 Ga0070687_100073980
1181 Ga0070687_100186609
1182 Ga0070661_100098261
1183 Ga0070661_101025100
1184 Ga0070668_100232715
1185 Ga0070669_100159173
1186 Ga0070669_100773762
1187 Ga0070675_100009309
1188 Ga0070675_100249752
1189 Ga0070671_100004796
1190 Ga0070671_100068392
1191 Ga0070671_100125778
1192 Ga0070671_101134108
1193 Ga0070673_100195577
1194 Ga0070673_101084975
1195 Ga0070688_100000311
1196 Ga0070659_100005680
1197 Ga0070659_100025393
1198 Ga0070659_100071192
1199 Ga0070709_10003427
1200 Ga0070709_10003845
1201 Ga0070709_10055665
1202 Ga0070709_10145981
1203 Ga0070709_10226109
1204 Ga0070709_10320656
1205 Ga0070709_10508593
1206 Ga0070709_10563513
1207 Ga0070709_10678442
1208 Ga0070714_100001016
1209 Ga0070714_100025849
1210 Ga0070714_100044070
1211 Ga0070714_100052502
1212 Ga0070714_100219435
1213 Ga0070714_100229763
1214 Ga0070714_100246563
1215 Ga0070714_100379295
1216 Ga0070714_100384918
1217 Ga0070714_100529095
1218 Ga0070714_100674479
1219 Ga0070714_101031488
1220 Ga0070714_101033029
1221 Ga0070714_101548597
1222 Ga0070713_100000460
1223 Ga0070713_100000863
1224 Ga0070713_100009985
1225 Ga0070713_100012863
1226 Ga0070713_100022236
1227 Ga0070713_100035831
1228 Ga0070713_100047278
1229 Ga0070713_100055567
1230 Ga0070713_100083204
1231 Ga0070713_100104832
1232 Ga0070713_100121693
1233 Ga0070713_100219920
1234 Ga0070713_100231593
1235 Ga0070713_100235254
1236 Ga0070713_100244780
1237 Ga0070713_100306328
1238 Ga0070713_100372196
1239 Ga0070713_100407609
1240 Ga0070713_100413271
1241 Ga0070713_100453431
1242 Ga0070713_100485707
1243 Ga0070710_10007216
1244 Ga0070710_10110128
1245 Ga0070710_10190600
1246 Ga0070710_10267437
1247 Ga0070711_100000656
1248 Ga0070711_100022448
1249 Ga0070711_100063439
1250 Ga0070711_100089520
1251 Ga0070711_100128912
1252 Ga0070711_100394033
1253 Ga0070711_100953105
1254 Ga0070708_100002306
1255 Ga0070708_100022528
1256 Ga0070708_100038532
1257 Ga0070708_100074972
1258 Ga0070708_100120276
1259 Ga0070708_100487318
1260 Ga0070708_100845443
1261 Ga0070663_100176318
1262 Ga0070678_100237862
1263 Ga0070678_100321402
1264 Ga0070662_100057613
1265 Ga0070662_100950663
1266 Ga0070681_10000304
1267 Ga0070681_10000804
1268 Ga0070681_10012167
1269 Ga0070681_10031578
1270 Ga0070681_10041573
1271 Ga0070681_10056600
1272 Ga0070681_10175459
1273 Ga0070681_10208763
1274 Ga0070681_10213647
1275 Ga0070681_10317009
1276 Ga0070681_10393837
1277 Ga0070681_10507145
1278 Ga0070681_10612933
1279 Ga0068867_100073940
1280 Ga0068867_100254141
1281 Ga0068867_100949769
1282 Ga0070706_100001345
1283 Ga0070706_100001630
1284 Ga0070706_100005850
1285 Ga0070706_100006393
1286 Ga0070706_100020891
1287 Ga0070706_100342903
1288 Ga0070707_100001066
1289 Ga0070707_100003999
1290 Ga0070707_100021280
1291 Ga0070707_100028348
1292 Ga0070707_100158512
1293 Ga0070707_100164194
1294 Ga0070707_100288346
1295 Ga0070707_100338552
1296 Ga0070707_100596575
1297 Ga0070698_100000247
1298 Ga0070698_100001098
1299 Ga0070698_100020529
1300 Ga0070698_100105362
1301 Ga0070698_100709849
1302 Ga0070699_100002044
1303 Ga0070699_100004004
1304 Ga0070699_100023250
1305 Ga0070699_100027660
1306 Ga0070699_100877918
1307 Ga0070679_100014420
1308 Ga0070679_100024151
1309 Ga0070679_100067059
1310 Ga0070679_100312675
1311 Ga0070679_100336724
1312 Ga0070679_100781920
1313 Ga0070684_100001116
1314 Ga0070684_100003411
1315 Ga0070684_100063033
1316 Ga0070684_100076893
1317 Ga0070684_100484636
1318 Ga0070684_100516914
1319 Ga0070697_100000463
1320 Ga0070697_100000758
1321 Ga0070697_100004218
1322 Ga0070697_100005905
1323 Ga0070697_100011766
1324 Ga0070697_100016515
1325 Ga0070697_100017118
1326 Ga0070697_100229408
1327 Ga0070697_100875742
1328 Ga0068853_100029743
1329 Ga0068853_100078145
1330 Ga0068853_100208413
1331 Ga0068853_100365811
1332 Ga0070672_100004674
1333 Ga0070686_100059757
1334 Ga0070695_100264147
1335 Ga0070693_100023182
1336 Ga0070693_100035108
1337 Ga0070693_100051789
1338 Ga0070693_100396859
1339 Ga0070693_100862530
1340 Ga0070665_100007099
1341 Ga0070665_100259765
1342 Ga0070665_100429823
1343 Ga0068855_100000563
1344 Ga0068855_100004163
1345 Ga0068855_100011625
1346 Ga0068855_100012802
1347 Ga0068855_100043564
1348 Ga0068855_100049412
1349 Ga0068855_100059059
1350 Ga0068855_100139903
1351 Ga0068855_100235912
1352 Ga0068855_100252692
1353 Ga0068855_100410746
1354 Ga0068855_100418114
1355 Ga0070664_100000879
1356 Ga0070664_100027623
1357 Ga0070664_100188302
1358 Ga0070664_100467501
1359 Ga0070664_101167491
1360 Ga0068857_100000022
1361 Ga0068857_100000880
1362 Ga0068857_100002691
1363 Ga0068857_100055123
1364 Ga0068857_100137570
1365 Ga0068857_100427623
1366 Ga0068857_100991849
1367 Ga0068854_100009080
1368 Ga0068854_100058520
1369 Ga0068854_100428803
1370 Ga0068854_100583818
1371 Ga0068856_100000448
1372 Ga0068856_100002645
1373 Ga0068856_100023133
1374 Ga0068856_100025330
1375 Ga0068856_100029764
1376 Ga0068856_100053508
1377 Ga0068856_100172826
1378 Ga0068856_100189611
1379 Ga0068856_100228017
1380 Ga0068856_100266573
1381 Ga0068856_100768003
1382 Ga0068856_101372361
1383 Ga0070702_100111738
1384 Ga0070702_100448427
1385 Ga0070702_100570247
1386 Ga0068852_100028082
1387 Ga0068852_100037467
1388 Ga0068852_100053376
1389 Ga0068852_100247218
1390 Ga0068859_100000885
1391 Ga0068859_100199301
1392 Ga0068864_100007383
1393 Ga0068864_100013662
1394 Ga0068864_100139812
1395 Ga0068864_100150760
1396 Ga0068864_100516958
1397 Ga0068866_10006754
1398 Ga0068866_10038191
1399 Ga0068866_10210292
1400 Ga0068866_10270163
1401 Ga0068861_100760985
1402 Ga0068851_10339463
1403 Ga0068851_10518329
1404 Ga0068870_10000641
1405 Ga0068863_100012164
1406 Ga0068863_100037948
1407 Ga0068863_100082470
1408 Ga0068863_100253000
1409 Ga0068863_101040830
1410 Ga0068858_100004455
1411 Ga0068858_100047139
1412 Ga0068858_100070184
1413 Ga0068860_100005346
1414 Ga0068860_100163095
1415 Ga0068860_100535099
1416 Ga0068862_100026563
1417 Ga0081540_1024261
1418 Ga0070717_10002868
1419 Ga0070717_10011716
1420 Ga0070717_10012576
1421 Ga0070717_10014948
1422 Ga0070717_10027218
1423 Ga0070717_10056258
1424 Ga0070717_10067301
1425 Ga0070717_10070734
1426 Ga0070717_10150529
1427 Ga0070717_10166834
1428 Ga0070717_10231654
1429 Ga0070717_10374817
1430 Ga0070717_10407691
1431 Ga0070717_10434388
1432 Ga0070717_10770460
1433 Ga0070715_10003724
1434 Ga0070715_10006827
1435 Ga0070715_10061334
1436 Ga0070715_10103761
1437 Ga0070716_100000337
1438 Ga0070716_100005134
1439 Ga0070716_100076275
1440 Ga0070716_100101316
1441 Ga0070716_100881452
1442 Ga0070712_100000117
1443 Ga0070712_100001060
1444 Ga0070712_100003616
1445 Ga0070712_100016517
1446 Ga0070712_100022864
1447 Ga0070712_100046445
1448 Ga0070712_100068359
1449 Ga0070712_100179972
1450 Ga0070712_100245775
1451 Ga0070712_100249283
1452 Ga0070712_100256615
1453 Ga0070712_100456631
1454 Ga0070712_100529470
1455 Ga0070712_100688103
1456 Ga0097621_100000279
1457 Ga0097621_100000712
1458 Ga0097621_100002496
1459 Ga0097621_100282120
1460 Ga0097621_100785347
1461 Ga0068871_100000304
1462 Ga0068871_100001868
1463 Ga0068871_100037189
1464 Ga0068871_100161874
1465 Ga0068871_100218018
1466 Ga0068871_100263372
1467 Ga0068871_100287775
1468 Ga0075433_10006367
1469 Ga0075433_10037506
1470 Ga0075434_100000005
1471 Ga0075434_100000969
1472 Ga0075434_100041426
1473 Ga0075434_100194236
1474 Ga0068865_100009244
1475 Ga0068865_100332053
1476 Ga0075436_100007285
1477 Ga0075436_100015313
1478 Ga0075436_100015445
1479 Ga0075436_100034652
1480 Ga0075436_100082200
1481 Ga0075436_100154951
1482 Ga0075436_100163032
1483 Ga0075436_100492305
1484 Ga0097620_100000885
1485 Ga0097620_100199331
1486 Ga0075435_100003087
1487 Ga0075435_100024980
1488 Ga0075435_100025274
1489 Ga0075435_100358707
1490 Ga0075435_100438932
1491 Ga0099795_10223978
1492 Ga0105240_10002552
1493 Ga0105240_10007213
1494 Ga0105240_10059972
1495 Ga0105240_10087608
1496 Ga0105240_10164930
1497 Ga0105240_10216653
1498 Ga0105240_10447771
1499 Ga0105240_10659300
1500 Ga0105240_10686379
1501 Ga0105240_11160122
1502 Ga0105240_11476431
1503 Ga0105245_10003405
1504 Ga0105245_10044347
1505 Ga0105245_10067028
1506 Ga0105245_10371530
1507 Ga0105247_10006854
1508 Ga0114129_10022771
1509 Ga0114129_10928432
1510 Ga0114129_11471842
1511 Ga0105241_10002278
1512 Ga0105241_10014672
1513 Ga0105241_10047441
1514 Ga0105241_10103498
1515 Ga0105241_10227672
1516 Ga0105241_10228395
1517 Ga0105241_10293617
1518 Ga0105241_10530602
1519 Ga0105242_10024992
1520 Ga0105242_10537825
1521 Ga0105248_10031636
1522 Ga0105248_10043691
1523 Ga0105248_10095323
1524 Ga0105248_10394575
1525 Ga0105248_10675500
1526 Ga0105237_10019037
1527 Ga0105237_10257336
1528 Ga0105237_10296892
1529 Ga0105237_10298370
1530 Ga0105237_10923841
1531 Ga0105237_11421464
1532 Ga0105238_10002919
1533 Ga0105238_10041603
1534 Ga0105238_10104051
1535 Ga0105238_10212205
1536 Ga0105249_10044335
1537 Ga0105249_10542083
1538 Ga0105249_11136323
1539 Ga0099796_10048775
1540 Ga0105239_10017824
1541 Ga0105239_10080832
1542 Ga0105239_10081568
1543 Ga0105239_10199907
1544 Ga0105239_10271004
1545 Ga0105239_11288240
1546 Ga0105246_10003185
1547 Ga0157373_10067274
1548 Ga0157373_10113101
1549 Ga0157373_10259488
1550 Ga0157373_10326479
1551 Ga0157371_10172086
1552 Ga0157370_10033829
1553 Ga0157370_10094369
1554 Ga0157370_10105410
1555 Ga0157369_10000243
1556 Ga0157369_10002120
1557 Ga0157369_10009538
1558 Ga0157369_10019842
1559 Ga0157369_10045930
1560 Ga0157369_10050031
1561 Ga0157369_10074211
1562 Ga0157369_10076892
1563 Ga0157369_10094000
1564 Ga0157369_10236466
1565 Ga0157369_10241931
1566 Ga0157369_10385930
1567 Ga0157369_10609448
1568 Ga0157374_10001216
1569 Ga0157374_10001860
1570 Ga0157374_10011248
1571 Ga0157374_10024826
1572 Ga0157374_10234055
1573 Ga0157374_10435143
1574 Ga0157374_10445337
1575 Ga0157374_10543456
1576 Ga0157374_10665714
1577 Ga0157374_10788276
1578 Ga0157378_10000325
1579 Ga0157378_10000925
1580 Ga0157378_10001581
1581 Ga0163162_10027862
1582 Ga0163162_10082571
1583 Ga0157372_10004045
1584 Ga0157372_10005315
1585 Ga0157372_10015124
1586 Ga0157372_10015924
1587 Ga0157372_10037114
1588 Ga0157372_10073579
1589 Ga0157372_10492405
1590 Ga0157372_11241877
1591 Ga0157372_11325405
1592 Ga0157372_11515255
1593 Ga0157375_10738840
1594 Ga0157375_11552976
1595 Ga0163163_10001425
1596 Ga0163163_10018723
1597 Ga0163163_10107681
1598 Ga0163163_10679059
1599 Ga0163163_10946111
1600 Ga0163163_11077830
1601 Ga0157380_10100323
1602 Ga0182008_10006237
1603 Ga0182008_10051708
1604 Ga0182008_10209395
1605 Ga0157377_10000286
1606 Ga0157379_10001394
1607 Ga0157379_10906224
1608 Ga0157376_10001475
1609 Ga0157376_10015440
1610 Ga0182006_1159862
1611 Ga0182007_10004788
1612 Ga0182005_1008641
1613 Ga0163161_10001313
1614 Ga0197907_10220925
1615 Ga0206350_10573770
1616 Ga0213874_10040258
1617 Ga0213874_10040613
1618 Ga0213874_10054554
1619 Ga0224712_10305312
1620 Ga0224569_101258
1621 Ga0224571_101242
1622 Ga0224572_1003199
1623 Ga0224572_1008880
1624 Ga0224572_1013734
1625 Ga0224572_1031482
1626 Ga0228598_1000263
1627 Ga0228598_1002110
1628 Ga0228598_1003378
1629 Ga0207426_1074058
1630 Ga0207697_10002666
1631 Ga0207697_10207581
1632 Ga0207656_10100183
1633 Ga0207682_10002185
1634 Ga0207692_10010027
1635 Ga0207692_10015954
1636 Ga0207692_10047958
1637 Ga0207692_10058174
1638 Ga0207692_10111873
1639 Ga0207692_10115646
1640 Ga0207692_10149360
1641 Ga0207692_10228683
1642 Ga0207642_10155439
1643 Ga0207642_10344192
1644 Ga0207710_10185767
1645 Ga0207688_10005547
1646 Ga0207688_10417374
1647 Ga0207680_10053144
1648 Ga0207680_10060920
1649 Ga0207647_10004334
1650 Ga0207647_10013289
1651 Ga0207647_10051423
1652 Ga0207685_10005994
1653 Ga0207685_10025564
1654 Ga0207699_10001626
1655 Ga0207699_10007448
1656 Ga0207699_10088650
1657 Ga0207699_10092673
1658 Ga0207699_10213230
1659 Ga0207699_10425255
1660 Ga0207699_10437583
1661 Ga0207699_10489705
1662 Ga0207699_10492797
1663 Ga0207699_10543877
1664 Ga0207699_10552193
1665 Ga0207645_10000781
1666 Ga0207643_10001078
1667 Ga0207705_10079407
1668 Ga0207705_10200191
1669 Ga0207684_10000081
1670 Ga0207684_10000762
1671 Ga0207684_10007088
1672 Ga0207684_10014384
1673 Ga0207684_10079249
1674 Ga0207684_10087488
1675 Ga0207684_10267387
1676 Ga0207684_10624608
1677 Ga0207654_10077294
1678 Ga0207654_10715517
1679 Ga0207707_10001814
1680 Ga0207707_10002624
1681 Ga0207707_10004912
1682 Ga0207707_10011466
1683 Ga0207707_10012005
1684 Ga0207707_10024968
1685 Ga0207707_10044157
1686 Ga0207707_10048740
1687 Ga0207707_10090931
1688 Ga0207707_10096339
1689 Ga0207707_10153392
1690 Ga0207707_10265629
1691 Ga0207695_10001570
1692 Ga0207695_10020694
1693 Ga0207695_10023851
1694 Ga0207695_10081445
1695 Ga0207695_10085477
1696 Ga0207695_10126032
1697 Ga0207695_10220829
1698 Ga0207695_11000864
1699 Ga0207671_10186478
1700 Ga0207671_10424299
1701 Ga0207693_10000019
1702 Ga0207693_10000158
1703 Ga0207693_10004951
1704 Ga0207693_10005955
1705 Ga0207693_10010174
1706 Ga0207693_10016464
1707 Ga0207693_10017284
1708 Ga0207693_10026910
1709 Ga0207693_10056311
1710 Ga0207693_10162560
1711 Ga0207693_10184687
1712 Ga0207693_10237810
1713 Ga0207693_10423031
1714 Ga0207693_10806600
1715 Ga0207663_10000394
1716 Ga0207663_10003222
1717 Ga0207663_10032413
1718 Ga0207663_10064412
1719 Ga0207663_10123226
1720 Ga0207663_10146699
1721 Ga0207663_10197602
1722 Ga0207663_10453994
1723 Ga0207660_10004717
1724 Ga0207660_10030153
1725 Ga0207660_10099605
1726 Ga0207660_10472762
1727 Ga0207660_10812024
1728 Ga0207662_10004934
1729 Ga0207657_10000311
1730 Ga0207657_10001224
1731 Ga0207657_10013003
1732 Ga0207649_10002645
1733 Ga0207649_10285714
1734 Ga0207649_10379415
1735 Ga0207649_10398888
1736 Ga0207649_10910217
1737 Ga0207652_10008939
1738 Ga0207652_10066816
1739 Ga0207652_10322451
1740 Ga0207652_10510132
1741 Ga0207652_10539200
1742 Ga0207646_10000334
1743 Ga0207646_10004011
1744 Ga0207646_10005419
1745 Ga0207646_10008546
1746 Ga0207646_10014759
1747 Ga0207646_10025466
1748 Ga0207646_10089627
1749 Ga0207646_10620516
1750 Ga0207646_10682214
1751 Ga0207681_10063854
1752 Ga0207681_10893518
1753 Ga0207694_10000896
1754 Ga0207694_10026092
1755 Ga0207694_10090793
1756 Ga0207694_10124758
1757 Ga0207694_10350570
1758 Ga0207694_10641146
1759 Ga0207650_10000063
1760 Ga0207650_10040526
1761 Ga0207650_10200591
1762 Ga0207650_10270125
1763 Ga0207659_10198885
1764 Ga0207659_10486190
1765 Ga0207687_10001952
1766 Ga0207687_10041927
1767 Ga0207687_10158728
1768 Ga0207700_10000129
1769 Ga0207700_10000233
1770 Ga0207700_10000348
1771 Ga0207700_10027210
1772 Ga0207700_10042188
1773 Ga0207700_10073121
1774 Ga0207700_10084711
1775 Ga0207700_10087348
1776 Ga0207700_10110841
1777 Ga0207700_10136524
1778 Ga0207700_10221476
1779 Ga0207700_10230801
1780 Ga0207700_10279530
1781 Ga0207700_10438623
1782 Ga0207700_10497961
1783 Ga0207700_10628283
1784 Ga0207700_10675797
1785 Ga0207700_10791731
1786 Ga0207700_10950828
1787 Ga0207664_10000284
1788 Ga0207664_10022822
1789 Ga0207664_10065466
1790 Ga0207664_10104533
1791 Ga0207664_10196730
1792 Ga0207664_10278299
1793 Ga0207664_10290809
1794 Ga0207664_10357885
1795 Ga0207664_10417528
1796 Ga0207664_10770535
1797 Ga0207644_10004369
1798 Ga0207644_10037893
1799 Ga0207644_10165591
1800 Ga0207644_10803086
1801 Ga0207644_10897068
1802 Ga0207690_10507293
1803 Ga0207690_10900353
1804 Ga0207706_10001937
1805 Ga0207706_10119693
1806 Ga0207670_10099607
1807 Ga0207670_10422801
1808 Ga0207704_10271304
1809 Ga0207665_10000109
1810 Ga0207665_10013403
1811 Ga0207665_10016509
1812 Ga0207665_10086268
1813 Ga0207665_10122953
1814 Ga0207665_10124518
1815 Ga0207665_10129107
1816 Ga0207665_10201787
1817 Ga0207665_10438103
1818 Ga0207665_10739481
1819 Ga0207665_10958087
1820 Ga0207691_10001123
1821 Ga0207711_10043977
1822 Ga0207711_10115246
1823 Ga0207711_10135993
1824 Ga0207711_10542172
1825 Ga0207689_10001298
1826 Ga0207689_10130321
1827 Ga0207689_10483165
1828 Ga0207661_10000156
1829 Ga0207661_10024048
1830 Ga0207661_10053000
1831 Ga0207661_10749830
1832 Ga0207679_10000588
1833 Ga0207679_10001790
1834 Ga0207667_10000188
1835 Ga0207667_10000302
1836 Ga0207667_10009252
1837 Ga0207667_10013037
1838 Ga0207667_10027559
1839 Ga0207667_10034008
1840 Ga0207667_10081567
1841 Ga0207667_10175356
1842 Ga0207667_10352037
1843 Ga0207667_10435883
1844 Ga0207667_10524281
1845 Ga0207667_10529480
1846 Ga0207667_10811916
1847 Ga0207667_10817611
1848 Ga0207667_11027943
1849 Ga0207651_10072540
1850 Ga0207651_10082588
1851 Ga0207651_10966899
1852 Ga0207712_10100024
1853 Ga0207668_10069067
1854 Ga0207640_10006509
1855 Ga0207640_10014840
1856 Ga0207640_10070946
1857 Ga0207640_10171438
1858 Ga0207658_10320430
1859 Ga0207658_10320467
1860 Ga0207658_11403314
1861 Ga0207677_10012203
1862 Ga0207677_10018172
1863 Ga0207677_10082030
1864 Ga0207677_10098027
1865 Ga0207677_10570310
1866 Ga0207703_10001842
1867 Ga0207703_10049928
1868 Ga0207703_10137491
1869 Ga0207703_10274595
1870 Ga0207639_10117177
1871 Ga0207639_10208331
1872 Ga0207639_10255343
1873 Ga0207639_10458632
1874 Ga0207678_10000443
1875 Ga0207702_10000120
1876 Ga0207702_10001675
1877 Ga0207702_10009760
1878 Ga0207702_10036655
1879 Ga0207702_10062637
1880 Ga0207702_10083250
1881 Ga0207702_10327015
1882 Ga0207702_10521314
1883 Ga0207702_10527538
1884 Ga0207641_10000131
1885 Ga0207641_10016212
1886 Ga0207641_10072350
1887 Ga0207641_10317002
1888 Ga0207641_10895527
1889 Ga0207648_10000403
1890 Ga0207648_10091189
1891 Ga0207676_10000517
1892 Ga0207676_10002843
1893 Ga0207676_10012744
1894 Ga0207676_10017081
1895 Ga0207676_10729253
1896 Ga0207676_10936319
1897 Ga0207674_10000056
1898 Ga0207674_10000201
1899 Ga0207674_10010860
1900 Ga0207683_10000848
1901 Ga0207683_10217698
1902 Ga0207683_10301977
1903 Ga0207683_10622655
1904 Ga0207698_10041264
1905 Ga0207698_10071903
1906 Ga0207698_10269322
1907 Ga0268266_10002994
1908 Ga0268266_10024815
1909 Ga0268266_10031914
1910 Ga0268265_10001656
1911 Ga0268264_10003976
1912 Ga0268264_10129387
1913 Ga0268264_10502990
1914 Ga0265336_10002308
1915 Ga0265336_10006115
1916 Ga0265338_10008619
1917 Ga0265338_10045200
1918 Ga0265338_10049670
1919 Ga0265338_10079931
1920 Ga0265338_10122311
1921 Ga0265338_10504030
1922 Ga0265324_10071311
1923 Ga0265324_10151339
1924 Ga0265762_1000263
1925 Ga0265762_1031420
1926 Ga0265765_1003039
1927 Ga0265760_10003581
1928 Ga0265760_10013154
1929 Ga0265330_10000216
1930 Ga0265330_10107139
1931 Ga0265328_10002261
1932 Ga0265325_10000249
1933 Ga0265325_10001092
1934 Ga0265325_10002613
1935 Ga0265325_10004469
1936 Ga0265325_10027277
1937 Ga0265325_10115609
1938 Ga0265329_10006633
1939 Ga0265340_10001240
1940 Ga0265340_10005066
1941 Ga0265340_10011713
1942 Ga0265340_10058024
1943 Ga0265340_10283011
1944 Ga0265339_10002285
1945 Ga0265339_10007283
1946 Ga0265339_10007957
1947 Ga0265339_10018564
1948 Ga0265339_10062462
1949 Ga0265339_10081517
1950 Ga0265339_10087663
1951 Ga0265339_10091987
1952 Ga0265339_10106662
1953 Ga0265339_10166709
1954 Ga0265316_10006447
1955 Ga0265316_10012816
1956 Ga0265316_10014051
1957 Ga0265316_10018325
1958 Ga0265316_10033744
1959 Ga0265316_10061602
1960 Ga0265316_10075358
1961 Ga0265316_10138143
1962 Ga0265316_10212805
1963 Ga0307408_100606656
1964 Ga0265313_10028796
1965 Ga0265313_10061217
1966 Ga0265313_10187707
1967 Ga0265314_10000239
1968 Ga0265314_10024977
1969 Ga0265314_10026822
1970 Ga0265342_10089547
1971 Ga0265342_10101518
1972 Ga0265342_10126090
1973 Ga0265342_10135676
1974 Ga0265342_10312068
1975 Ga0307405_10396682
1976 Ga0307410_10841835
1977 Ga0307407_10061760
1978 Ga0307409_100000830
1979 Ga0307409_100178699
1980 Ga0307416_100096091
1981 Ga0307411_10126790
1982 Ga0307415_100057830
1983 Ga0307415_101287575
1984 Ga0373938_0088007
1985 Ga0373926_0010000
1986 Ga0373926_0020347
1987 Ga0373926_0105118
1988 Ga0373934_0004411
1989 Ga0373934_0160448
1990 Ga0373944_0109097
1991 Ga0373923_0034945
1992 Ga0373923_0048753
1993 Ga0373936_0001435
1994 Ga0373936_0033081
1995 Ga0373936_0132501
1996 Ga0373936_0280289
1997 Ga0373945_0001479
1998 Ga0373945_0069093
1999 Ga0373945_0099123
2000 Ga0373945_0207116
2001 Ga0373953_0087301
2002 Ga0373954_0008005
2003 Ga0373954_0312806
2004 Ga0373956_0185992
2005 Ga0373956_0258463
2006 Ga0373957_0052285
2007 Ga0373943_0000141
2008 Ga0373943_0002710
2009 Ga0373943_0029568
2010 Ga0373943_0239179
2011 Ga0373943_0306472
2012 Ga0373946_0157980
2013 Ga0373955_0030154
2014 Ga0373955_0069620
2015 Ga0373955_0154660
2016 Ga0373924_0000021
2017 Ga0373924_0008113
2018 Ga0373935_0002090
2019 Ga0373935_0018584
2020 Ga0373935_0271557
2021 Ga0373935_0404909
2022 Ga0373927_0003981
2023 Ga0373927_0005726
2024 Ga0373927_0010171
2025 Ga0373927_0096655
2026 Ga0373927_0309430
2027 Ga0373927_0327525
2028 Ga0373927_0357412
2029 Ga0373933_0062465
2030 Ga0373933_0078091
2031 Ga0373933_0087060
2032 Ga0373933_0650431
2033 Ga0373947_0001591
2034 Ga0373947_0002655
2035 Ga0373947_0023446
2036 Ga0373947_0120009
2037 Ga0373947_0259633
2038 Ga0373947_0307181
2039 Ga0373937_0000090
2040 Ga0373937_0012656
2041 Ga0373937_0037458
2042 Ga0373937_0084735
2043 Ga0373937_0178364
2044 Ga0373937_0220053
2045 Ga0373937_0253273
2046 Ga0373937_0799166
2047 Ga0373925_0002098
2048 Ga0373925_0003638
2049 Ga0373925_0024365
2050 Ga0373925_0031436
2051 Ga0373925_0065788
2052 Ga0373925_0244951
2053 Ga0373925_0995700
2054 Ga0373925_1061151
2055 Ga0395900_0754843
2056 Ga0395900_1085604
2057 Ga0395898_0145777
2058 Ga0395905_0152499
2059 Ga0395905_0447297
2060 Ga0395905_1177096
2061 Ga0436364_1537985
2062 Ga0436365_0369277
2063 Ga0436365_0589729
2064 Ga0436365_1128997
2065 Ga0436363_0075211
2066 Ga0436363_0405112
2067 Ga0436363_0631224
2068 Ga0436363_1002749
2069 Ga0436363_1108521
2070 Ga0436363_1316118
2071 Ga0436363_1636503
2072 Ga0436362_0059665
2073 Ga0436362_0893348
2074 Ga0453683_0038993
2075 Ga0466965_0281811
2076 Ga0466966_0074360
2077 Ga0466966_0145684
2078 Ga0466963_0001401
2079 Ga0466963_0054616
2080 Ga0466963_0130099
2081 Ga0466963_0629341
2082 Ga0453684_0672333
2083 Ga0466957_0000027
2084 Ga0466957_0204542
2085 Ga0466959_0027847
2086 Ga0451576_0559213
2087 Ga0451576_1068463
2088 Ga0451576_1209917
2089 Ga0466958_0018139
2090 Ga0466958_0148741
2091 Ga0466958_0189949
2092 Ga0466958_0319408
2093 Ga0466958_0579904
2094 Ga0466967_0001298
2095 Ga0466967_0007522
2096 Ga0466967_0070250
2097 Ga0466967_0119616
2098 Ga0466967_0150997
2099 Ga0466967_0208456
2100 Ga0466967_0352802
2101 Ga0466967_0435095
2102 Ga0466967_1212748
2103 Ga0495629_0153744
2104 Ga0495629_0198735
2105 Ga0495651_0180618
2106 Ga0495580_0001084
2107 Ga0495580_0001209
2108 Ga0495580_0002030
2109 Ga0495580_0013824
2110 Ga0495580_0022266
2111 Ga0495580_0071927
2112 Ga0495580_0238748
2113 Ga0495580_0323558
2114 Ga0495580_0689260
2115 Ga0495582_0001249
2116 Ga0495582_0005964
2117 Ga0495582_0162835
2118 Ga0495582_0243630
2119 Ga0495639_0088124
2120 Ga0495639_0188868
2121 Ga0495639_0263263
2122 Ga0495662_0250245
2123 Ga0495664_0045558
2124 Ga0495664_0124142
2125 Ga0495594_0011591
2126 Ga0495606_0225889
2127 Ga0495606_0263913
2128 Ga0495608_0140966
2129 Ga0495608_0326312
2130 Ga0495630_0127662
2131 Ga0495643_0022688
2132 Ga0495665_0005328
2133 Ga0495665_0021444
2134 Ga0495665_0052401
2135 Ga0495665_0067337
2136 Ga0495665_0087833
2137 Ga0495665_0250377
2138 Ga0495622_0076036
2139 Ga0495667_0227907
2140 Ga0495656_0060580
2141 Ga0495668_0246029
2142 Ga0495625_0025076
2143 Ga0495635_0141449
2144 Ga0495659_0002349
2145 Ga0495588_0291694
2146 Ga0495588_0437694
2147 Ga0495657_0247375
2148 Ga0495657_0305658
2149 Ga0495657_0317654
2150 Ga0495599_0290322
2151 Ga0495623_0056265
2152 Ga0495623_0135734
2153 Ga0495623_0298431
2154 Ga0495623_0416915
2155 Ga0495658_0170604
2156 Ga0495658_0296412
2157 Ga0495669_0035537
2158 Ga0495669_0225250
2159 Ga0495669_0384719
2160 Ga0495613_0002395
2161 Ga0495613_0767043
2162 Ga0495649_0012383
2163 Ga0495581_0101977
2164 Ga0495636_0111760
2165 Ga0495674_0457238
2166 Ga0495674_0663367
2167 Ga0495676_0229278
2168 Ga0495683_0038696
2169 Ga0495675_0045855
2170 Ga0495675_0125230
2171 Ga0495684_0124046
2172 Ga0495593_0193732
2173 Ga0495602_0252774
2174 Ga0495602_0348465
2175 Ga0495614_0010578
2176 Ga0496100_0150797
2177 Ga0496101_0747996
2178 Ga0496101_0929613
2179 Ga0496102_0032273
2180 Ga0496102_0201211
2181 Ga0496102_0356990
2182 Ga0496102_0416269
2183 Ga0496103_0456048
2184 Ga0496104_0054494
2185 Ga0496104_0073409
2186 Ga0496104_0075975
2187 Ga0496104_0161770
2188 Ga0496104_0243639
2189 Ga0496104_0314795
2190 Ga0496104_0774529
2191 Ga0496104_1285055
2192 Ga0496105_0729509
2193 Ga0496106_0124154
2194 Ga0496106_0219808
2195 Ga0496108_0000038
2196 Ga0496109_0000082
2197 Ga0496109_0099379
2198 Ga0496109_0164501
2199 Ga0496109_0684208
2200 Ga0496109_1068779
2201 Ga0496110_0000195
2202 Ga0496110_0077168
2203 Ga0496110_0225750
2204 Ga0496110_0542211
2205 Ga0496111_0002758
2206 Ga0496111_0008810
2207 Ga0496112_0000032
2208 Ga0496112_0001293
2209 Ga0496112_0032363
2210 Ga0496112_0057628
2211 Ga0496112_0062423
2212 Ga0496112_0067290
2213 Ga0496112_0145945
2214 Ga0496112_0151886
2215 Ga0496112_0313995
2216 Ga0496112_0499326
2217 Ga0496112_0800059
2218 Ga0496113_0000094
2219 Ga0496113_0036480
2220 Ga0496113_0038073
2221 Ga0496115_0009730
2222 Ga0496115_0019473
2223 Ga0496115_0163263
2224 Ga0496115_0204328
2225 Ga0496115_0599531
2226 Ga0495682_0010495
2227 Ga0501293_007088
2228 Ga0501299_070855
2229 Ga0501300_006705
2230 Ga0501233_020731
2231 Ga0501271_040855
2232 nmdc:mga05p37_196867_c1
2233 nmdc:mga0n895_1076829_c1
2234 nmdc:mga0n895_2935_c1
2235 nmdc:mga0n895_31_c1
2236 nmdc:mga0n895_40130_c1
2237 nmdc:mga0n895_602194_c1
2238 nmdc:mga0rr50_138451_c1
2239 nmdc:mga0rr50_1416_c1
2240 nmdc:mga0rr50_292208_c1
2241 nmdc:mga0rr50_355538_c1
2242 nmdc:mga0rr50_437849_c1
2243 nmdc:mga0rr50_451970_c1
2244 nmdc:mga0rr50_777501_c1
2245 nmdc:mga08x19_1455_c1
2246 nmdc:mga08x19_16655_c2
2247 nmdc:mga08x19_200950_c1
2248 nmdc:mga08x19_284573_c1
2249 nmdc:mga08x19_5358_c1
2250 nmdc:mga08x19_65722_c1
2251 nmdc:mga0a205_1702_c1
2252 nmdc:mga0a205_562_c1
2253 Ga0495601_0171732
2254 Ga0495601_0504176
2255 Ga0495612_0158105
2256 Ga0501084_0166535
2257 Ga0587069_036659
2258 Ga0587107_023162
2259 Ga0501082_0035560
2260 Ga0466962_0111067

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01765

RRF

Ribosome recycling factor

69

199

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vud-assembly1.cif.gz_B crystal structure of a ribosome recycling factor from ehrlichia chaffeensis 0.8982 13 160
7xge-assembly3.cif.gz_E crystal structure of mcl-1 in complex with computationally designed inhibitor protein 0.8717 115 160
1ge9-assembly1.cif.gz_A solution structure of the ribosome recycling factor 0.8689 13 162
4woi-assembly1.cif.gz_AV 4,5-linked aminoglycoside antibiotics regulate the bacterial ribosome by targeting dynamic conformational processes within intersubunit bridge b2 0.8194 18 162
4v9d-assembly1.cif.gz_AY structures of the bacterial ribosome in classical and hybrid states of trna binding 0.8188 13 160
ID Description Score Start End Superfamily
af_P9WGY1_31_105_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9729 41 115 3.30.1360.40
af_P0A805_31_105_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9719 41 115 3.30.1360.40
af_B6TAV8_107_177_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9668 41 110 3.30.1360.40
af_P9WGY1_31_105_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9605 41 115 3.30.1360.40
af_P0A805_31_105_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9594 41 115 3.30.1360.40
ID Description Score Start End GO Terms
AF-A0A522YRR8-F1-model_v4 Ribosome recycling factor 0.9133 41 160 GO:0006412
GO:0043023
AF-A0A2D6INI1-F1-model_v4 Ribosome recycling factor 0.909 46 162 GO:0006412
GO:0043023
AF-A0A287IQI7-F1-model_v4 deleted 0.9032 46 145
AF-X1LF43-F1-model_v4 Ribosome recycling factor domain-containing protein 0.8965 38 121 GO:0006412
GO:0043023
AF-A0A287IQI7-F1-model_v4 deleted 0.8869 46 145

Map