F490392

General Info

Members Datasets Scaffolds Average Seq Length
1120 511 863 267

Family's Representative Sequence

Representative Sequence 3300042185|Ga0450909_001760|Ga0450909_001760_1900_2676
Length 258
Sequence MKLVLKQPFERLWAGRDAFTEVEALQGQVYRELEGRRTLRTEVEGRGYFVKIHRGIGWGEIAKNLLTAKVPVLGAGQEWTAIQRLHQAGSNPAQQHSFIVTEELAPTISLEDFCVDWLRNPPPPRLKWALIGEVARMTGTMHRAGVNHRDCYICHFLLHTERPVTADDFKLSLIDLHRAQTRAHTPRRWRDKDLAGLYFSALNIGLTQRDKLRFLKAYFRQPLRDVLRDEIGLLAWLEQKAASLMSRYERKYAGGEDA

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
6 2511231004 Pseudomonas sp. GM102 Isolate Nodule
7 2511231006 Pseudomonas sp. GM17 Isolate Nodule
8 2511231007 Pseudomonas sp. GM18 Isolate Nodule
9 2511231008 Pseudomonas sp. GM21 Isolate Nodule
10 2511231010 Pseudomonas sp. GM25 Isolate Nodule
11 2511231011 Pseudomonas sp. GM30 Isolate Nodule
12 2511231012 Pseudomonas sp. GM33 Isolate Nodule
13 2511231014 Pseudomonas sp. GM48 Isolate Nodule
14 2511231015 Pseudomonas sp. GM49 Isolate Nodule
15 2511231016 Pseudomonas sp. GM50 Isolate Nodule
16 2511231017 Pseudomonas sp. GM55 Isolate Nodule
17 2511231018 Pseudomonas sp. GM60 Isolate Nodule
18 2511231019 Pseudomonas sp. GM67 Isolate Nodule
19 2511231020 Pseudomonas sp. GM74 Isolate Nodule
20 2511231021 Pseudomonas sp. GM78 Isolate Nodule
21 2511231022 Pseudomonas sp. GM79 Isolate Nodule
22 2511231023 Pseudomonas sp. GM80 Isolate Nodule
23 2511231024 Pseudomonas sp. GM84 Isolate Nodule
24 2511231031 Pseudomonas sp. GM16 Isolate Nodule
25 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
26 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
27 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
28 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
29 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
30 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
31 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
32 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
33 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
34 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
35 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
36 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
37 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
38 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
39 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
40 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
41 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
42 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
43 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
44 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
45 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
46 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
47 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
48 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
49 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
50 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
51 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
52 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
53 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
54 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
55 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
56 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
57 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
58 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
59 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
60 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
61 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
62 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
63 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
64 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
65 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
66 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
67 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
68 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
69 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
70 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
71 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
72 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
73 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
74 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
75 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
76 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
77 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
78 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
79 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
80 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
81 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
82 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
83 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
84 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
85 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
86 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
87 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
88 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
89 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
90 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
91 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
92 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
93 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
94 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
95 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
96 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
97 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
98 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
99 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
100 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
101 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
102 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
103 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
104 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
105 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
106 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
107 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
108 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
109 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
110 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
111 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
112 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
113 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
114 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
115 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
116 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
117 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
118 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
119 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
120 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
121 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
122 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
123 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
124 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
125 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
126 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
127 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
128 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
129 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
130 2765235841 Pseudomonas putida AA7 Isolate Unclassified
131 2773857670 Pseudomonas sp. 478 Isolate Unclassified
132 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
133 2773857673 Pseudomonas sp. 443 Isolate Unclassified
134 2784132063 Pseudomonas sp. 424 Isolate Unclassified
135 2784132072 Pseudomonas sp. 460 Isolate Unclassified
136 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
137 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
138 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
139 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
140 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
141 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
142 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
143 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
144 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
145 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
146 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
147 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
148 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
149 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
150 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
151 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
152 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
153 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
154 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
155 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
156 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
157 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
158 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
159 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
160 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
161 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
162 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
163 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
164 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
165 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
166 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
167 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
168 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
169 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
170 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
171 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
172 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
173 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
174 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
175 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
176 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
177 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
178 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
179 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
180 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
181 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
182 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
183 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
184 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
185 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
186 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
187 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
188 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
189 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
190 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
191 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
192 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
193 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
194 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
195 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
196 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
197 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
198 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
199 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
200 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
201 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
202 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
203 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
204 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
205 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
206 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
207 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
208 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
209 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
210 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
211 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
212 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
213 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
214 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
215 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
216 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
217 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
218 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
219 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
220 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
221 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
222 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
223 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
224 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
225 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
226 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
227 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
228 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
229 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
230 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
231 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
232 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
233 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
234 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
235 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
236 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
237 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
238 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
239 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
240 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
241 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
242 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
243 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
244 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
245 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
246 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
247 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
248 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
249 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
250 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
251 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
252 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
253 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
254 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
255 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
256 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
257 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
258 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
259 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
260 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
261 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
262 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
263 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
264 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
265 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
266 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
267 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
268 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
269 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
270 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
271 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
272 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
273 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
274 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
275 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
276 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
277 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
278 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
279 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
280 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
281 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
282 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
283 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
284 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
285 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
286 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
287 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
291 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
292 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
293 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
294 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
296 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
297 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
299 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
300 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
301 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
302 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
303 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
321 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
322 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
323 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
324 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
325 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
326 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
327 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
329 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
330 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
331 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
332 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
333 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
334 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
335 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
336 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
337 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
338 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
339 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
340 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
341 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
342 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
343 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
344 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
345 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
346 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
347 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
348 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
349 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
350 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
351 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
352 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
353 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
354 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
355 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
356 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
357 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
358 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
359 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
360 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
361 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
362 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
363 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
364 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
365 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
366 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
367 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
368 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
369 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
370 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
371 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
372 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
373 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
374 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
375 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
376 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
377 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
378 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
379 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
380 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
381 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
382 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
383 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
384 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
385 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
386 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
387 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
388 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
389 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
390 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
391 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
392 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
393 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
394 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
395 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
396 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
397 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
398 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
399 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
400 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
401 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
402 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
403 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
404 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
405 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
406 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
407 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
408 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
409 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
410 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
411 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
412 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
413 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
414 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
415 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
416 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
417 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
418 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
419 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
420 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
421 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
422 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
423 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
424 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
425 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
426 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
427 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
428 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
429 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
430 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
431 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
432 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
433 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
434 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
435 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
436 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
437 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
438 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
439 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
440 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
441 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
442 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
443 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
444 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
445 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
446 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
447 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
448 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
449 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
450 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
451 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
452 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
453 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
454 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
455 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
456 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
457 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
458 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
459 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
460 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
461 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
462 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
463 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
464 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
465 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
466 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
467 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
468 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
469 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
470 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
471 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
472 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
473 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
474 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
475 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
476 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
477 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
478 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
479 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
480 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
481 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
482 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
483 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
484 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
485 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
486 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
487 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
488 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
489 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
490 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
491 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
492 8052494512 Pseudomonas putida LD6 Isolate Unclassified
493 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
494 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
495 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
496 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
497 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
498 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
499 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
500 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
501 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
502 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
503 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
504 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
505 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
506 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
507 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
508 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
509 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
510 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
511 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.05
Metatranscriptomes 0
Isolates 22.95

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 5.27
Nodule 2.77
Rhizoplane 6.79
Rhizosphere 71.52
Stem 0
Stem Tuber 0
Unclassified 13.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_87 2124908027 Bacteria 56496
2 SwRhRL2b_contig_288416 2162886007 Bacteria 2720
3 SwRhRL2b_contig_487482 2162886007 Bacteria 2856
4 JGI24741J21665_1006446 3300001915 Bacteria 2356
5 JGI25163J39215_1000534 3300002771 Bacteria 11173
6 JGI25163J39215_1001084 3300002771 Bacteria 5649
7 JGI25164J39214_1000145 3300002772 Bacteria 68307
8 JGI25164J39214_1000148 3300002772 Bacteria 67382
9 JGI25165J46597_1000266 3300003214 Bacteria 68307
10 JGI25165J46597_1000268 3300003214 Bacteria 67382
11 Ga0055539_1000048 3300003752 Bacteria 190238
12 Ga0055533_1000059 3300003756 Bacteria 190238
13 Ga0055532_1000096 3300003758 Bacteria 98889
14 Ga0055525_1000189 3300003759 Bacteria 75207
15 Ga0055536_1000615 3300003781 Bacteria 24257
16 Ga0055536_1002223 3300003781 Bacteria 11047
17 Ga0055530_10000374 3300003791 Bacteria 40490
18 Ga0055530_10000913 3300003791 Bacteria 24257
19 Ga0055540_1000337 3300003792 Bacteria 40512
20 Ga0055540_1000646 3300003792 Bacteria 24561
21 Ga0055540_1000657 3300003792 Bacteria 24257
22 Ga0055531_10000375 3300003794 Bacteria 43113
23 Ga0055541_1000035 3300003841 Bacteria 190238
24 Ga0065714_10000248 3300005288 Bacteria 6677
25 Ga0065714_10004567 3300005288 Bacteria 6014
26 Ga0065714_10016358 3300005288 Bacteria 1945
27 Ga0065714_10066037 3300005288 Bacteria 7777
28 Ga0065714_10067559 3300005288 Bacteria 5377
29 Ga0065714_10069151 3300005288 Bacteria 4367
30 Ga0065714_10075356 3300005288 Bacteria 2916
31 Ga0065714_10172978 3300005288 Bacteria 996
32 Ga0065704_10000791 3300005289 Bacteria 18680
33 Ga0065704_10001014 3300005289 Bacteria 15257
34 Ga0065704_10020956 3300005289 Bacteria 1076
35 Ga0065704_10090218 3300005289 Bacteria 2803
36 Ga0065712_10067752 3300005290 Bacteria 56880
37 Ga0065712_10069162 3300005290 Bacteria 7852
38 Ga0070670_100001434 3300005331 Bacteria 19186
39 Ga0070670_100014428 3300005331 Bacteria 6781
40 Ga0070661_100000078 3300005344 Bacteria 77449
41 Ga0070669_100001899 3300005353 Bacteria 15087
42 Ga0070714_100424047 3300005435 Bacteria 1261
43 Ga0070662_100003973 3300005457 Bacteria 9269
44 Ga0068853_100000210 3300005539 Bacteria 41425
45 Ga0070665_100370287 3300005548 Bacteria 1439
46 Ga0070665_100619819 3300005548 Bacteria 1095
47 Ga0070664_100007381 3300005564 Bacteria 8868
48 Ga0070664_100017832 3300005564 Bacteria 5830
49 Ga0068854_100002209 3300005578 Bacteria 11976
50 Ga0068851_10000004 3300005834 Bacteria 269685
51 Ga0075364_10056823 3300006051 Bacteria 2563
52 Ga0075364_10120441 3300006051 Bacteria 1756
53 Ga0075432_10001130 3300006058 Bacteria 8534
54 Ga0075432_10003524 3300006058 Bacteria 5305
55 Ga0075432_10037538 3300006058 Bacteria 1687
56 Ga0075432_10085681 3300006058 Bacteria 1147
57 Ga0075362_10009085 3300006177 Bacteria 3828
58 Ga0075362_10231875 3300006177 Bacteria 904
59 Ga0075436_100099306 3300006914 Bacteria 2026
60 Ga0099823_1013050 3300006944 Bacteria 8383
61 Ga0079104_1000638 3300006946 Bacteria 34050
62 Ga0079104_1000654 3300006946 Bacteria 33184
63 Ga0079104_1002562 3300006946 Bacteria 9569
64 Ga0079104_1033089 3300006946 Bacteria 1268
65 Ga0099826_10018533 3300006948 Bacteria 5251
66 Ga0105251_10001807 3300009011 Bacteria 17747
67 Ga0105251_10002054 3300009011 Bacteria 16284
68 Ga0105251_10003211 3300009011 Bacteria 12053
69 Ga0105251_10003431 3300009011 Bacteria 11494
70 Ga0105251_10004126 3300009011 Bacteria 10143
71 Ga0105251_10004337 3300009011 Bacteria 9705
72 Ga0105251_10020559 3300009011 Bacteria 3465
73 Ga0105251_10027160 3300009011 Bacteria 2906
74 Ga0105251_10125409 3300009011 Bacteria 1165
75 Ga0105244_10000133 3300009036 Bacteria 76114
76 Ga0105244_10002007 3300009036 Bacteria 15687
77 Ga0105244_10002116 3300009036 Bacteria 15263
78 Ga0105244_10004326 3300009036 Bacteria 9821
79 Ga0105244_10008580 3300009036 Bacteria 6374
80 Ga0105244_10016377 3300009036 Bacteria 4223
81 Ga0105244_10016789 3300009036 Bacteria 4159
82 Ga0105244_10022008 3300009036 Bacteria 3515
83 Ga0105244_10025650 3300009036 Bacteria 3201
84 Ga0105244_10056930 3300009036 Bacteria 1977
85 Ga0105244_10065634 3300009036 Bacteria 1818
86 Ga0105244_10091443 3300009036 Bacteria 1496
87 Ga0105244_10093117 3300009036 Bacteria 1480
88 Ga0105250_10000423 3300009092 Bacteria 30845
89 Ga0105250_10002533 3300009092 Bacteria 9139
90 Ga0105250_10002789 3300009092 Bacteria 8571
91 Ga0105250_10006222 3300009092 Bacteria 5239
92 Ga0105250_10011389 3300009092 Bacteria 3690
93 Ga0105250_10033549 3300009092 Bacteria 2062
94 Ga0105243_10001058 3300009148 Bacteria 25181
95 Ga0105243_10001664 3300009148 Bacteria 19255
96 Ga0105243_10002290 3300009148 Bacteria 16053
97 Ga0105243_10007323 3300009148 Bacteria 8485
98 Ga0105243_10029807 3300009148 Bacteria 4198
99 Ga0105243_10032432 3300009148 Bacteria 4036
100 Ga0105243_10036011 3300009148 Bacteria 3839
101 Ga0105242_10004878 3300009176 Bacteria 10384
102 Ga0105237_10007904 3300009545 Bacteria 11590
103 Ga0105237_10149704 3300009545 Bacteria 2330
104 Ga0105249_10055939 3300009553 Bacteria 3611
105 Ga0105246_10000489 3300011119 Bacteria 21461
106 Ga0105246_10005406 3300011119 Bacteria 7779
107 Ga0105246_10077933 3300011119 Bacteria 2352
108 Ga0105246_10083769 3300011119 Bacteria 2279
109 Ga0157345_1000037 3300012498 Bacteria 32065
110 Ga0157373_10008180 3300013100 Bacteria 7780
111 Ga0157373_10012146 3300013100 Bacteria 6332
112 Ga0157373_10022539 3300013100 Bacteria 4568
113 Ga0157373_10029077 3300013100 Bacteria 3984
114 Ga0157373_10032871 3300013100 Bacteria 3733
115 Ga0157373_10037056 3300013100 Bacteria 3499
116 Ga0157373_10044899 3300013100 Bacteria 3155
117 Ga0157373_10096805 3300013100 Bacteria 2078
118 Ga0157373_10219535 3300013100 Bacteria 1341
119 Ga0157373_10331575 3300013100 Bacteria 1083
120 Ga0157371_10000839 3300013102 Bacteria 35135
121 Ga0157371_10002020 3300013102 Bacteria 20047
122 Ga0157371_10002513 3300013102 Bacteria 17424
123 Ga0157371_10004811 3300013102 Bacteria 11616
124 Ga0157371_10051956 3300013102 Bacteria 2912
125 Ga0157371_10435411 3300013102 Bacteria 963
126 Ga0157370_10000388 3300013104 Bacteria 55229
127 Ga0157370_10014921 3300013104 Bacteria 7924
128 Ga0157370_10104635 3300013104 Bacteria 2649
129 Ga0157370_10162376 3300013104 Bacteria 2078
130 Ga0157370_10192583 3300013104 Bacteria 1893
131 Ga0157370_10246484 3300013104 Bacteria 1653
132 Ga0157370_10246485 3300013104 Bacteria 1653
133 Ga0157369_10000184 3300013105 Bacteria 86626
134 Ga0157369_10001610 3300013105 Bacteria 27627
135 Ga0157369_10002373 3300013105 Bacteria 22629
136 Ga0157369_10008368 3300013105 Bacteria 11864
137 Ga0157369_10018752 3300013105 Bacteria 7756
138 Ga0157369_10040248 3300013105 Bacteria 5103
139 Ga0157369_10478173 3300013105 Bacteria 1289
140 Ga0157369_10662021 3300013105 Bacteria 1076
141 Ga0163162_10159342 3300013306 Bacteria 2378
142 Ga0157372_10000062 3300013307 Bacteria 119721
143 Ga0157372_10000947 3300013307 Bacteria 31672
144 Ga0157372_10006103 3300013307 Bacteria 12802
145 Ga0157372_10046612 3300013307 Bacteria 4812
146 Ga0157372_10374368 3300013307 Bacteria 1659
147 Ga0157375_10001804 3300013308 Bacteria 18354
148 Ga0157375_10008927 3300013308 Bacteria 8771
149 Ga0157375_10015868 3300013308 Bacteria 6750
150 Ga0182008_10000659 3300014497 Bacteria 25061
151 Ga0182008_10005131 3300014497 Bacteria 7514
152 Ga0182008_10012107 3300014497 Bacteria 4562
153 Ga0182008_10022943 3300014497 Bacteria 3193
154 Ga0182008_10036559 3300014497 Bacteria 2457
155 Ga0182008_10053683 3300014497 Bacteria 1995
156 Ga0182006_1003235 3300015261 Bacteria 8456
157 Ga0182006_1003547 3300015261 Bacteria 7954
158 Ga0182006_1003616 3300015261 Bacteria 7855
159 Ga0182006_1008819 3300015261 Bacteria 4557
160 Ga0182006_1012301 3300015261 Bacteria 3741
161 Ga0182006_1012616 3300015261 Bacteria 3695
162 Ga0182006_1020170 3300015261 Bacteria 2796
163 Ga0182006_1046602 3300015261 Bacteria 1684
164 Ga0182007_10003898 3300015262 Bacteria 6919
165 Ga0182007_10007513 3300015262 Bacteria 4563
166 Ga0182005_1004207 3300015265 Bacteria 4703
167 Ga0182005_1004402 3300015265 Bacteria 4563
168 Ga0182005_1009233 3300015265 Bacteria 2876
169 Ga0182005_1016613 3300015265 Bacteria 2045
170 Ga0182005_1024350 3300015265 Bacteria 1653
171 Ga0163161_10000624 3300017792 Bacteria 28312
172 Ga0163161_10005035 3300017792 Bacteria 9192
173 Ga0163161_10013791 3300017792 Bacteria 5628
174 Ga0163161_10026264 3300017792 Bacteria 4126
175 Ga0163161_10171325 3300017792 Bacteria 1660
176 Ga0163161_10405035 3300017792 Bacteria 1094
177 Ga0163161_10482035 3300017792 Bacteria 1007
178 Ga0209435_100864 3300025206 Bacteria 4664
179 Ga0209760_100181 3300025207 Bacteria 33125
180 Ga0209760_100215 3300025207 Bacteria 25872
181 Ga0209784_100028 3300025224 Bacteria 357464
182 Ga0209566_100028 3300025225 Bacteria 357464
183 Ga0209674_100047 3300025226 Bacteria 357464
184 Ga0209147_100031 3300025229 Bacteria 357464
185 Ga0209563_100050 3300025230 Bacteria 357464
186 Ga0209563_100488 3300025230 Bacteria 13416
187 Ga0207427_100014 3300025231 Bacteria 561361
188 Ga0207427_100016 3300025231 Bacteria 538697
189 Ga0209437_100011 3300025233 Bacteria 818520
190 Ga0209437_100016 3300025233 Bacteria 710118
191 Ga0209258_100150 3300025242 Bacteria 161813
192 Ga0207425_1001697 3300025245 Bacteria 8748
193 Ga0209646_1000165 3300025246 Bacteria 88117
194 Ga0209677_100029 3300025253 Bacteria 357464
195 Ga0209759_1011972 3300025256 Bacteria 2428
196 Ga0209129_1000021 3300025258 Bacteria 445018
197 Ga0209233_1000019 3300025261 Bacteria 818520
198 Ga0209233_1000036 3300025261 Bacteria 561361
199 Ga0209675_1002284 3300025291 Bacteria 9970
200 Ga0209676_1000025 3300025292 Bacteria 577569
201 Ga0209676_1000032 3300025292 Bacteria 469558
202 Ga0209676_1000326 3300025292 Bacteria 91787
203 Ga0209676_1001232 3300025292 Bacteria 27033
204 Ga0209676_1001980 3300025292 Bacteria 16312
205 Ga0209676_1015080 3300025292 Bacteria 2866
206 Ga0209050_1000025 3300025298 Bacteria 528225
207 Ga0209050_1000028 3300025298 Bacteria 477133
208 Ga0209050_1001079 3300025298 Bacteria 33360
209 Ga0209050_1001508 3300025298 Bacteria 24613
210 Ga0209051_1000026 3300025303 Bacteria 413311
211 Ga0209051_1000080 3300025303 Bacteria 199694
212 Ga0209051_1000334 3300025303 Bacteria 70713
213 Ga0209051_1003650 3300025303 Bacteria 9967
214 Ga0209257_1000034 3300025304 Bacteria 662719
215 Ga0207656_10000007 3300025321 Bacteria 289154
216 Ga0207696_1000020 3300025711 Bacteria 434998
217 Ga0207696_1000057 3300025711 Bacteria 249404
218 Ga0207696_1000064 3300025711 Bacteria 238379
219 Ga0207696_1000229 3300025711 Bacteria 79025
220 Ga0207696_1003169 3300025711 Bacteria 7631
221 Ga0207696_1003440 3300025711 Bacteria 7219
222 Ga0207696_1014985 3300025711 Bacteria 2640
223 Ga0207696_1020002 3300025711 Bacteria 2166
224 Ga0207655_1000014 3300025728 Bacteria 607124
225 Ga0207655_1000406 3300025728 Bacteria 59327
226 Ga0207655_1000565 3300025728 Bacteria 45949
227 Ga0207655_1000815 3300025728 Bacteria 33730
228 Ga0207655_1000922 3300025728 Bacteria 30542
229 Ga0207655_1001160 3300025728 Bacteria 25632
230 Ga0207655_1001818 3300025728 Bacteria 18454
231 Ga0207655_1002188 3300025728 Bacteria 16227
232 Ga0207655_1002787 3300025728 Bacteria 13583
233 Ga0207655_1003594 3300025728 Bacteria 11465
234 Ga0207655_1003980 3300025728 Bacteria 10681
235 Ga0207655_1004144 3300025728 Bacteria 10411
236 Ga0207655_1005546 3300025728 Bacteria 8554
237 Ga0207655_1006369 3300025728 Bacteria 7834
238 Ga0207655_1010151 3300025728 Bacteria 5750
239 Ga0207655_1010822 3300025728 Bacteria 5497
240 Ga0207655_1017130 3300025728 Bacteria 3921
241 Ga0207655_1051225 3300025728 Bacteria 1671
242 Ga0207655_1056487 3300025728 Bacteria 1547
243 Ga0207655_1057153 3300025728 Bacteria 1534
244 Ga0207655_1061236 3300025728 Bacteria 1454
245 Ga0207655_1123231 3300025728 Bacteria 855
246 Ga0207713_1000031 3300025735 Bacteria 283971
247 Ga0207713_1000759 3300025735 Bacteria 30004
248 Ga0207713_1001119 3300025735 Bacteria 22843
249 Ga0207713_1001550 3300025735 Bacteria 18076
250 Ga0207713_1001809 3300025735 Bacteria 16343
251 Ga0207713_1001942 3300025735 Bacteria 15635
252 Ga0207713_1002040 3300025735 Bacteria 15118
253 Ga0207713_1003833 3300025735 Bacteria 10057
254 Ga0207713_1004233 3300025735 Bacteria 9386
255 Ga0207713_1005577 3300025735 Bacteria 7836
256 Ga0207713_1006802 3300025735 Bacteria 6897
257 Ga0207713_1008147 3300025735 Bacteria 6074
258 Ga0207713_1024439 3300025735 Bacteria 2818
259 Ga0207713_1024754 3300025735 Bacteria 2790
260 Ga0207713_1034429 3300025735 Bacteria 2200
261 Ga0207713_1034499 3300025735 Bacteria 2197
262 Ga0207713_1104116 3300025735 Bacteria 975
263 Ga0207671_10000015 3300025914 Bacteria 439607
264 Ga0207649_10000001 3300025920 Bacteria 537851
265 Ga0207681_10000480 3300025923 Bacteria 27941
266 Ga0207650_10000868 3300025925 Bacteria 22902
267 Ga0207650_10001058 3300025925 Bacteria 20465
268 Ga0207664_10210444 3300025929 Bacteria 1682
269 Ga0207706_10000624 3300025933 Bacteria 37622
270 Ga0207706_10006689 3300025933 Bacteria 10660
271 Ga0207706_10355067 3300025933 Bacteria 1274
272 Ga0207686_10001543 3300025934 Bacteria 12987
273 Ga0207709_10000022 3300025935 Bacteria 383573
274 Ga0207709_10000578 3300025935 Bacteria 30734
275 Ga0207709_10000971 3300025935 Bacteria 21405
276 Ga0207709_10006325 3300025935 Bacteria 6648
277 Ga0207709_10009944 3300025935 Bacteria 5239
278 Ga0207709_10017283 3300025935 Bacteria 4024
279 Ga0207709_10177570 3300025935 Bacteria 1500
280 Ga0207679_10000011 3300025945 Bacteria 346112
281 Ga0207679_10056642 3300025945 Bacteria 2895
282 Ga0207639_10000706 3300026041 Bacteria 22900
283 Ga0209281_1000026 3300027111 Bacteria 465877
284 Ga0209281_1000033 3300027111 Bacteria 383539
285 Ga0209281_1004548 3300027111 Bacteria 4125
286 Ga0209389_1000095 3300027296 Bacteria 80518
287 Ga0209389_1093364 3300027296 Bacteria 1218
288 Ga0209371_1000029 3300027312 Bacteria 424797
289 Ga0209371_1000217 3300027312 Bacteria 77949
290 Ga0209371_1000380 3300027312 Bacteria 47577
291 Ga0209371_1014099 3300027312 Bacteria 2207
292 Ga0209371_1018226 3300027312 Bacteria 1790
293 Ga0209995_1012455 3300027471 Bacteria 1388
294 Ga0209983_1012794 3300027665 Bacteria 1723
295 Ga0209974_10027040 3300027876 Bacteria 1898
296 Ga0207428_10018345 3300027907 Bacteria 5979
297 Ga0207428_10084951 3300027907 Bacteria 2466
298 Ga0207428_10107357 3300027907 Bacteria 2151
299 Ga0207428_10110397 3300027907 Bacteria 2118
300 Ga0268266_10007054 3300028379 Bacteria 10203
301 Ga0268266_10223110 3300028379 Bacteria 1733
302 Ga0268266_10359174 3300028379 Bacteria 1370
303 Ga0307517_10046926 3300028786 Bacteria 4493
304 Ga0268256_1000032 3300030500 Bacteria 424603
305 Ga0268256_1000173 3300030500 Bacteria 77949
306 Ga0268256_1000428 3300030500 Bacteria 37773
307 Ga0268256_1005448 3300030500 Bacteria 4988
308 Ga0268256_1015628 3300030500 Bacteria 2207
309 Ga0316177_1136448 3300030731 Bacteria 3328
310 Ga0314311_1115640 3300030733 Bacteria 10318
311 Ga0316179_1116990 3300030734 Bacteria 5843
312 Ga0316178_1078135 3300030735 Bacteria 17093
313 Ga0316183_1053680 3300030742 Bacteria 4925
314 Ga0316181_1247226 3300030744 Bacteria 3249
315 Ga0265316_10053330 3300031344 Bacteria 3169
316 Ga0307408_100000002 3300031548 Bacteria 827227
317 Ga0307408_100013668 3300031548 Bacteria 5391
318 Ga0307408_100032095 3300031548 Bacteria 3661
319 Ga0307408_100129270 3300031548 Bacteria 1968
320 Ga0307408_100241922 3300031548 Bacteria 1483
321 Ga0265342_10095268 3300031712 Bacteria 1702
322 Ga0307405_10000474 3300031731 Bacteria 15078
323 Ga0307405_10009426 3300031731 Bacteria 5005
324 Ga0307405_10013191 3300031731 Bacteria 4402
325 Ga0307405_10065543 3300031731 Bacteria 2312
326 Ga0307413_10052144 3300031824 Bacteria 2469
327 Ga0307413_10564500 3300031824 Bacteria 925
328 Ga0307406_10357606 3300031901 Bacteria 1143
329 Ga0307406_10417033 3300031901 Bacteria 1068
330 Ga0307407_10038970 3300031903 Bacteria 2638
331 Ga0307412_10006654 3300031911 Bacteria 6549
332 Ga0307412_10012666 3300031911 Bacteria 4921
333 Ga0307412_10014146 3300031911 Bacteria 4698
334 Ga0307412_10016071 3300031911 Bacteria 4448
335 Ga0307412_10108365 3300031911 Bacteria 1978
336 Ga0307412_10202814 3300031911 Bacteria 1507
337 Ga0307412_10474972 3300031911 Bacteria 1035
338 Ga0307409_100015570 3300031995 Bacteria 4996
339 Ga0307409_100017296 3300031995 Bacteria 4801
340 Ga0307416_100070455 3300032002 Bacteria 2899
341 Ga0307416_100456033 3300032002 Bacteria 1332
342 Ga0307416_100941339 3300032002 Bacteria 965
343 Ga0307414_10002568 3300032004 Bacteria 9551
344 Ga0307414_10015030 3300032004 Bacteria 4662
345 Ga0307414_10054038 3300032004 Bacteria 2804
346 Ga0307414_10064819 3300032004 Bacteria 2603
347 Ga0307411_10010536 3300032005 Bacteria 4934
348 Ga0307411_10036524 3300032005 Bacteria 3079
349 Ga0307510_10003578 3300033180 Bacteria 18148
350 Ga0237819_01318 3300038705 Bacteria 6640
351 Ga0436363_0281375 3300039450 Bacteria 2811
352 Ga0439436_0012268 3300041404 Bacteria 2600
353 Ga0439438_000621 3300041405 Bacteria 15979
354 Ga0439438_001072 3300041405 Bacteria 12221
355 Ga0439438_001956 3300041405 Bacteria 8999
356 Ga0439438_003204 3300041405 Bacteria 6688
357 Ga0439438_005713 3300041405 Bacteria 4527
358 Ga0439438_006379 3300041405 Bacteria 4174
359 Ga0439438_006390 3300041405 Bacteria 4168
360 Ga0439438_011071 3300041405 Bacteria 2826
361 Ga0439438_044002 3300041405 Bacteria 1151
362 Ga0439447_000763 3300041407 Bacteria 11929
363 Ga0439447_003053 3300041407 Bacteria 5975
364 Ga0439447_004183 3300041407 Bacteria 5009
365 Ga0439447_004452 3300041407 Bacteria 4813
366 Ga0439447_054544 3300041407 Bacteria 948
367 Ga0439466_0001219 3300041411 Bacteria 10013
368 Ga0439466_0001604 3300041411 Bacteria 8821
369 Ga0439466_0002254 3300041411 Bacteria 7557
370 Ga0439466_0003680 3300041411 Bacteria 5918
371 Ga0439466_0012145 3300041411 Bacteria 3178
372 Ga0439466_0013185 3300041411 Bacteria 3028
373 Ga0439466_0013468 3300041411 Bacteria 2993
374 Ga0439466_0014147 3300041411 Bacteria 2910
375 Ga0439466_0023139 3300041411 Bacteria 2187
376 Ga0439466_0029925 3300041411 Bacteria 1870
377 Ga0439432_000649 3300042006 Bacteria 13007
378 Ga0439432_001572 3300042006 Bacteria 8573
379 Ga0439432_001927 3300042006 Bacteria 7839
380 Ga0439432_002096 3300042006 Bacteria 7532
381 Ga0439432_004987 3300042006 Bacteria 4804
382 Ga0439432_018571 3300042006 Bacteria 2322
383 Ga0439451_002023 3300042009 Bacteria 4066
384 Ga0439451_004014 3300042009 Bacteria 2992
385 Ga0439451_004974 3300042009 Bacteria 2705
386 Ga0439452_000012 3300042010 Bacteria 412478
387 Ga0439452_000992 3300042010 Bacteria 12691
388 Ga0439452_002398 3300042010 Bacteria 6946
389 Ga0439452_003343 3300042010 Bacteria 5637
390 Ga0439452_006422 3300042010 Bacteria 3683
391 Ga0439452_006430 3300042010 Bacteria 3680
392 Ga0439452_014092 3300042010 Bacteria 2227
393 Ga0439455_0019459 3300042012 Bacteria 1601
394 Ga0439456_001110 3300042013 Bacteria 5341
395 Ga0439463_000057 3300042016 Bacteria 23866
396 Ga0439463_001908 3300042016 Bacteria 5409
397 Ga0439463_006113 3300042016 Bacteria 2988
398 Ga0450911_000012 3300042115 Bacteria 129546
399 Ga0450911_000192 3300042115 Bacteria 24155
400 Ga0450911_001957 3300042115 Bacteria 4308
401 Ga0450923_006474 3300042125 Bacteria 1944
402 Ga0450890_000220 3300042127 Bacteria 8570
403 Ga0450900_000138 3300042136 Bacteria 4361
404 Ga0450902_000850 3300042137 Bacteria 3986
405 Ga0450902_014050 3300042137 Bacteria 1292
406 Ga0450902_015131 3300042137 Bacteria 1250
407 Ga0450903_004454 3300042138 Bacteria 2387
408 Ga0450903_016216 3300042138 Bacteria 1169
409 Ga0450904_000331 3300042139 Bacteria 9989
410 Ga0450904_003722 3300042139 Bacteria 1627
411 Ga0450905_000034 3300042142 Bacteria 11627
412 Ga0450889_009463 3300042144 Bacteria 999
413 Ga0450906_002807 3300042145 Bacteria 3795
414 Ga0450907_000627 3300042146 Bacteria 9351
415 Ga0450907_000768 3300042146 Bacteria 8074
416 Ga0450907_039522 3300042146 Bacteria 807
417 Ga0450910_001269 3300042147 Bacteria 3146
418 Ga0439446_0002361 3300042156 Bacteria 4519
419 Ga0439446_0009053 3300042156 Bacteria 2657
420 Ga0450908_007196 3300042184 Bacteria 2102
421 Ga0450908_008314 3300042184 Bacteria 1945
422 Ga0450909_001760 3300042185 Bacteria 3048
423 Ga0450909_002673 3300042185 Bacteria 2529
424 Ga0439434_0002067 3300042435 Bacteria 5797
425 Ga0439434_0002931 3300042435 Bacteria 4983
426 Ga0439464_0000082 3300042439 Bacteria 13705
427 Ga0439464_0001991 3300042439 Bacteria 4949
428 Ga0439464_0004794 3300042439 Bacteria 3466
429 Ga0439464_0035080 3300042439 Bacteria 1415
430 Ga0439460_0002166 3300042461 Bacteria 4710
431 Ga0439460_0002435 3300042461 Bacteria 4482
432 Ga0439460_0030234 3300042461 Bacteria 1538
433 Ga0450918_001781 3300042531 Bacteria 4199
434 Ga0450901_000124 3300042533 Bacteria 8452
435 Ga0439440_0000861 3300042993 Bacteria 5303
436 Ga0439440_0004862 3300042993 Bacteria 2649
437 Ga0451576_0490605 3300045051 Bacteria 1290
438 Ga0495617_000900 3300046452 Bacteria 13927
439 Ga0495617_001444 3300046452 Bacteria 10436
440 Ga0495617_046413 3300046452 Bacteria 1447
441 Ga0495627_000529 3300046453 Bacteria 31618
442 Ga0495627_000662 3300046453 Bacteria 26550
443 Ga0495627_000811 3300046453 Bacteria 22857
444 Ga0495627_003516 3300046453 Bacteria 6866
445 Ga0495627_007132 3300046453 Bacteria 4319
446 Ga0495627_038585 3300046453 Bacteria 1475
447 Ga0495603_0037506 3300046455 Bacteria 2908
448 Ga0495590_0002060 3300046457 Bacteria 8435
449 Ga0495590_0015849 3300046457 Bacteria 2727
450 Ga0495591_000417 3300046458 Bacteria 35343
451 Ga0495591_000692 3300046458 Bacteria 24631
452 Ga0495591_002059 3300046458 Bacteria 11640
453 Ga0495591_004076 3300046458 Bacteria 7277
454 Ga0495591_004675 3300046458 Bacteria 6580
455 Ga0495591_005356 3300046458 Bacteria 5961
456 Ga0495591_006073 3300046458 Bacteria 5429
457 Ga0495591_006221 3300046458 Bacteria 5323
458 Ga0495591_007818 3300046458 Bacteria 4470
459 Ga0495591_008359 3300046458 Bacteria 4248
460 Ga0495591_028006 3300046458 Bacteria 1728
461 Ga0495629_0021447 3300046459 Bacteria 4610
462 Ga0495638_0006393 3300046460 Bacteria 8578
463 Ga0495638_0019097 3300046460 Bacteria 4538
464 Ga0495638_0029363 3300046460 Bacteria 3545
465 Ga0495638_0062755 3300046460 Bacteria 2292
466 Ga0495638_0066091 3300046460 Bacteria 2223
467 Ga0495638_0124315 3300046460 Bacteria 1521
468 Ga0495638_0165525 3300046460 Bacteria 1272
469 Ga0495653_0008338 3300046463 Bacteria 8493
470 Ga0495653_0023867 3300046463 Bacteria 4936
471 Ga0495653_0095792 3300046463 Bacteria 2159
472 Ga0495650_0008803 3300046471 Bacteria 5833
473 Ga0495650_0012860 3300046471 Bacteria 4470
474 Ga0495650_0037161 3300046471 Bacteria 2123
475 Ga0495650_0059434 3300046471 Bacteria 1540
476 Ga0495650_0079877 3300046471 Bacteria 1263
477 Ga0495582_0029428 3300046473 Bacteria 3015
478 Ga0495605_0000062 3300046474 Bacteria 143176
479 Ga0495605_0001077 3300046474 Bacteria 18170
480 Ga0495605_0001339 3300046474 Bacteria 16304
481 Ga0495605_0001776 3300046474 Bacteria 13827
482 Ga0495605_0006187 3300046474 Bacteria 6903
483 Ga0495605_0009458 3300046474 Bacteria 5476
484 Ga0495605_0018090 3300046474 Bacteria 3784
485 Ga0495605_0120680 3300046474 Bacteria 1188
486 Ga0495605_0129347 3300046474 Bacteria 1139
487 Ga0495605_0173483 3300046474 Bacteria 951
488 Ga0495639_0001422 3300046475 Bacteria 10699
489 Ga0495584_0002039 3300046491 Bacteria 11608
490 Ga0495584_0002652 3300046491 Bacteria 10067
491 Ga0495584_0002719 3300046491 Bacteria 9917
492 Ga0495584_0005232 3300046491 Bacteria 6881
493 Ga0495584_0012017 3300046491 Bacteria 4426
494 Ga0495585_0002838 3300046492 Bacteria 12065
495 Ga0495585_0017841 3300046492 Bacteria 4096
496 Ga0495585_0102598 3300046492 Bacteria 1528
497 Ga0495594_0001089 3300046499 Bacteria 14172
498 Ga0495594_0042261 3300046499 Bacteria 2496
499 Ga0495607_0000535 3300046501 Bacteria 37269
500 Ga0495607_0001879 3300046501 Bacteria 17817
501 Ga0495607_0002217 3300046501 Bacteria 16098
502 Ga0495607_0003116 3300046501 Bacteria 12867
503 Ga0495607_0003678 3300046501 Bacteria 11635
504 Ga0495607_0004041 3300046501 Bacteria 10998
505 Ga0495607_0005538 3300046501 Bacteria 9009
506 Ga0495607_0008397 3300046501 Bacteria 7061
507 Ga0495607_0016897 3300046501 Bacteria 4698
508 Ga0495607_0089273 3300046501 Bacteria 1673
509 Ga0495607_0101039 3300046501 Bacteria 1544
510 Ga0495607_0118852 3300046501 Bacteria 1390
511 Ga0495607_0149014 3300046501 Bacteria 1199
512 Ga0495583_0000015 3300046506 Bacteria 316392
513 Ga0495583_0000821 3300046506 Bacteria 38030
514 Ga0495583_0001917 3300046506 Bacteria 19233
515 Ga0495583_0002771 3300046506 Bacteria 14454
516 Ga0495583_0002903 3300046506 Bacteria 13863
517 Ga0495583_0003231 3300046506 Bacteria 12739
518 Ga0495583_0003968 3300046506 Bacteria 10927
519 Ga0495583_0006370 3300046506 Bacteria 7736
520 Ga0495583_0094592 3300046506 Bacteria 1282
521 Ga0495606_0000214 3300046507 Bacteria 103149
522 Ga0495606_0000352 3300046507 Bacteria 78743
523 Ga0495606_0000892 3300046507 Bacteria 44530
524 Ga0495606_0008494 3300046507 Bacteria 8911
525 Ga0495606_0010283 3300046507 Bacteria 7788
526 Ga0495606_0017442 3300046507 Bacteria 5429
527 Ga0495606_0018966 3300046507 Bacteria 5139
528 Ga0495606_0045423 3300046507 Bacteria 2911
529 Ga0495606_0105917 3300046507 Bacteria 1703
530 Ga0495606_0117649 3300046507 Bacteria 1595
531 Ga0495610_0001409 3300046512 Bacteria 21314
532 Ga0495610_0014812 3300046512 Bacteria 4562
533 Ga0495610_0057894 3300046512 Bacteria 1856
534 Ga0495610_0066729 3300046512 Bacteria 1693
535 Ga0495616_0002776 3300046513 Bacteria 11437
536 Ga0495616_0004870 3300046513 Bacteria 8399
537 Ga0495616_0006934 3300046513 Bacteria 6821
538 Ga0495616_0007447 3300046513 Bacteria 6552
539 Ga0495616_0012671 3300046513 Bacteria 4776
540 Ga0495616_0014475 3300046513 Bacteria 4414
541 Ga0495616_0088491 3300046513 Bacteria 1470
542 Ga0495620_0000033 3300046515 Bacteria 118157
543 Ga0495620_0000050 3300046515 Bacteria 105651
544 Ga0495620_0001299 3300046515 Bacteria 15205
545 Ga0495620_0001883 3300046515 Bacteria 12333
546 Ga0495620_0001955 3300046515 Bacteria 12067
547 Ga0495620_0018478 3300046515 Bacteria 3451
548 Ga0495620_0034133 3300046515 Bacteria 2302
549 Ga0495630_0015738 3300046517 Bacteria 5526
550 Ga0495631_0001124 3300046518 Bacteria 16576
551 Ga0495631_0002205 3300046518 Bacteria 11203
552 Ga0495631_0004919 3300046518 Bacteria 7041
553 Ga0495631_0037240 3300046518 Bacteria 2168
554 Ga0495632_0000919 3300046519 Bacteria 25838
555 Ga0495632_0005948 3300046519 Bacteria 7949
556 Ga0495632_0008767 3300046519 Bacteria 6163
557 Ga0495632_0012508 3300046519 Bacteria 4893
558 Ga0495632_0017772 3300046519 Bacteria 3917
559 Ga0495632_0031838 3300046519 Bacteria 2722
560 Ga0495632_0066278 3300046519 Bacteria 1742
561 Ga0495632_0079607 3300046519 Bacteria 1564
562 Ga0495632_0132364 3300046519 Bacteria 1160
563 Ga0495632_0167143 3300046519 Bacteria 1011
564 Ga0495637_0000020 3300046520 Bacteria 181611
565 Ga0495637_0001280 3300046520 Bacteria 15160
566 Ga0495637_0001968 3300046520 Bacteria 11609
567 Ga0495637_0002004 3300046520 Bacteria 11488
568 Ga0495637_0006061 3300046520 Bacteria 6105
569 Ga0495637_0006923 3300046520 Bacteria 5656
570 Ga0495637_0014561 3300046520 Bacteria 3709
571 Ga0495637_0014633 3300046520 Bacteria 3697
572 Ga0495637_0018213 3300046520 Bacteria 3259
573 Ga0495637_0019161 3300046520 Bacteria 3165
574 Ga0495637_0041022 3300046520 Bacteria 1988
575 Ga0495637_0058463 3300046520 Bacteria 1589
576 Ga0495637_0059719 3300046520 Bacteria 1568
577 Ga0495637_0084697 3300046520 Bacteria 1259
578 Ga0495643_0000320 3300046522 Bacteria 66010
579 Ga0495643_0001218 3300046522 Bacteria 24887
580 Ga0495643_0001318 3300046522 Bacteria 23490
581 Ga0495643_0002020 3300046522 Bacteria 16923
582 Ga0495643_0090811 3300046522 Bacteria 1575
583 Ga0495644_0004800 3300046523 Bacteria 5311
584 Ga0495644_0005221 3300046523 Bacteria 5077
585 Ga0495644_0073001 3300046523 Bacteria 1290
586 Ga0495648_0001594 3300046524 Bacteria 22104
587 Ga0495648_0003563 3300046524 Bacteria 13621
588 Ga0495648_0005817 3300046524 Bacteria 10157
589 Ga0495648_0011636 3300046524 Bacteria 6610
590 Ga0495648_0016613 3300046524 Bacteria 5299
591 Ga0495648_0017390 3300046524 Bacteria 5141
592 Ga0495648_0021864 3300046524 Bacteria 4417
593 Ga0495648_0024558 3300046524 Bacteria 4101
594 Ga0495648_0071572 3300046524 Bacteria 2009
595 Ga0495648_0083163 3300046524 Bacteria 1814
596 Ga0495666_0017492 3300046526 Bacteria 3569
597 Ga0495666_0032216 3300046526 Bacteria 2566
598 Ga0495642_0001037 3300046528 Bacteria 12902
599 Ga0495642_0004922 3300046528 Bacteria 5149
600 Ga0495654_0001141 3300046530 Bacteria 19059
601 Ga0495654_0001487 3300046530 Bacteria 16035
602 Ga0495654_0003927 3300046530 Bacteria 8978
603 Ga0495654_0004238 3300046530 Bacteria 8572
604 Ga0495654_0004593 3300046530 Bacteria 8153
605 Ga0495654_0005161 3300046530 Bacteria 7619
606 Ga0495654_0009894 3300046530 Bacteria 5212
607 Ga0495654_0010887 3300046530 Bacteria 4941
608 Ga0495654_0017900 3300046530 Bacteria 3718
609 Ga0495654_0040169 3300046530 Bacteria 2332
610 Ga0495654_0053300 3300046530 Bacteria 1966
611 Ga0495654_0053304 3300046530 Bacteria 1966
612 Ga0495654_0064706 3300046530 Bacteria 1747
613 Ga0495587_0046123 3300046536 Bacteria 2587
614 Ga0495609_0000143 3300046538 Bacteria 74412
615 Ga0495609_0000372 3300046538 Bacteria 38530
616 Ga0495609_0000461 3300046538 Bacteria 33185
617 Ga0495609_0007912 3300046538 Bacteria 5253
618 Ga0495609_0009727 3300046538 Bacteria 4637
619 Ga0495609_0041131 3300046538 Bacteria 2078
620 Ga0495597_0001205 3300046542 Bacteria 19346
621 Ga0495597_0001312 3300046542 Bacteria 18248
622 Ga0495597_0012872 3300046542 Bacteria 4025
623 Ga0495597_0020876 3300046542 Bacteria 3046
624 Ga0495597_0032407 3300046542 Bacteria 2372
625 Ga0495597_0094475 3300046542 Bacteria 1266
626 Ga0495645_0235516 3300046543 Bacteria 1224
627 Ga0495622_0003131 3300046557 Bacteria 7835
628 Ga0495622_0003397 3300046557 Bacteria 7508
629 Ga0495622_0093076 3300046557 Bacteria 1384
630 Ga0495633_0000084 3300046558 Bacteria 124972
631 Ga0495633_0002008 3300046558 Bacteria 14726
632 Ga0495656_0013901 3300046615 Bacteria 3006
633 Ga0495668_0013703 3300046616 Bacteria 4771
634 Ga0495668_0062086 3300046616 Bacteria 2059
635 Ga0495668_0117973 3300046616 Bacteria 1451
636 Ga0495634_0016154 3300046642 Bacteria 5342
637 Ga0495634_0077836 3300046642 Bacteria 2174
638 Ga0495611_0000246 3300046648 Bacteria 37614
639 Ga0495611_0000318 3300046648 Bacteria 32266
640 Ga0495611_0000910 3300046648 Bacteria 16008
641 Ga0495611_0008333 3300046648 Bacteria 4389
642 Ga0495625_0000133 3300046660 Bacteria 115381
643 Ga0495625_0002266 3300046660 Bacteria 21142
644 Ga0495625_0016901 3300046660 Bacteria 5727
645 Ga0495635_0003150 3300046663 Bacteria 11355
646 Ga0495659_0000898 3300046664 Bacteria 10597
647 Ga0495661_0000027 3300046665 Bacteria 184297
648 Ga0495661_0000065 3300046665 Bacteria 129298
649 Ga0495661_0000370 3300046665 Bacteria 48701
650 Ga0495661_0000542 3300046665 Bacteria 39039
651 Ga0495661_0002713 3300046665 Bacteria 13493
652 Ga0495661_0027979 3300046665 Bacteria 3615
653 Ga0495661_0149018 3300046665 Bacteria 1265
654 Ga0495588_0026370 3300046674 Bacteria 2900
655 Ga0495588_0107371 3300046674 Bacteria 1469
656 Ga0495623_0011845 3300046679 Bacteria 5650
657 Ga0495623_0014638 3300046679 Bacteria 5074
658 Ga0495646_0042505 3300046680 Bacteria 2788
659 Ga0495669_0009945 3300046684 Bacteria 4022
660 Ga0495613_0012854 3300046689 Bacteria 6223
661 Ga0495670_0000196 3300046691 Bacteria 27094
662 Ga0495670_0007919 3300046691 Bacteria 5224
663 Ga0495670_0008804 3300046691 Bacteria 4968
664 Ga0495670_0023771 3300046691 Bacteria 3025
665 Ga0495671_0001993 3300046692 Bacteria 13125
666 Ga0495671_0005998 3300046692 Bacteria 7061
667 Ga0495671_0010036 3300046692 Bacteria 5266
668 Ga0495671_0011636 3300046692 Bacteria 4829
669 Ga0495671_0019714 3300046692 Bacteria 3560
670 Ga0495671_0076149 3300046692 Bacteria 1645
671 Ga0495671_0094070 3300046692 Bacteria 1466
672 Ga0495671_0110951 3300046692 Bacteria 1339
673 Ga0495671_0110977 3300046692 Bacteria 1339
674 Ga0495649_0001378 3300046694 Bacteria 18389
675 Ga0495649_0001797 3300046694 Bacteria 15774
676 Ga0495649_0005095 3300046694 Bacteria 8437
677 Ga0495649_0005670 3300046694 Bacteria 7882
678 Ga0495649_0054487 3300046694 Bacteria 2162
679 Ga0495589_0000779 3300046794 Bacteria 20247
680 Ga0495589_0001384 3300046794 Bacteria 14107
681 Ga0495589_0001986 3300046794 Bacteria 11576
682 Ga0495589_0005362 3300046794 Bacteria 6767
683 Ga0495589_0051631 3300046794 Bacteria 2032
684 Ga0495589_0082943 3300046794 Bacteria 1558
685 Ga0495600_0028678 3300046809 Bacteria 3601
686 Ga0495600_0092650 3300046809 Bacteria 1971
687 Ga0495660_0000797 3300046810 Bacteria 23640
688 Ga0495660_0002243 3300046810 Bacteria 12441
689 Ga0495660_0002803 3300046810 Bacteria 10979
690 Ga0495660_0008873 3300046810 Bacteria 5874
691 Ga0495660_0010257 3300046810 Bacteria 5447
692 Ga0495660_0026092 3300046810 Bacteria 3315
693 Ga0495660_0046539 3300046810 Bacteria 2378
694 Ga0495660_0179948 3300046810 Bacteria 1023
695 Ga0495604_0046093 3300047317 Bacteria 3399
696 Ga0495636_0005482 3300047318 Bacteria 4985
697 Ga0495636_0026308 3300047318 Bacteria 2366
698 Ga0495674_0026203 3300047319 Bacteria 5336
699 Ga0495672_0000763 3300047320 Bacteria 35066
700 Ga0495672_0006798 3300047320 Bacteria 8751
701 Ga0495672_0007247 3300047320 Bacteria 8366
702 Ga0495672_0016835 3300047320 Bacteria 4906
703 Ga0495672_0026376 3300047320 Bacteria 3708
704 Ga0495672_0033865 3300047320 Bacteria 3162
705 Ga0495672_0036556 3300047320 Bacteria 3014
706 Ga0495672_0038784 3300047320 Bacteria 2903
707 Ga0495672_0051139 3300047320 Bacteria 2435
708 Ga0495672_0088989 3300047320 Bacteria 1700
709 Ga0495672_0162519 3300047320 Bacteria 1146
710 Ga0495672_0192815 3300047320 Bacteria 1023
711 Ga0495676_0000181 3300047321 Bacteria 49744
712 Ga0495676_0027747 3300047321 Bacteria 4850
713 Ga0495676_0106745 3300047321 Bacteria 2062
714 Ga0495680_0019387 3300047322 Bacteria 5741
715 Ga0495680_0023975 3300047322 Bacteria 5068
716 Ga0495680_0029539 3300047322 Bacteria 4488
717 Ga0495680_0133411 3300047322 Bacteria 1822
718 Ga0495683_0000044 3300047323 Bacteria 133747
719 Ga0495683_0000109 3300047323 Bacteria 84488
720 Ga0495683_0011206 3300047323 Bacteria 4723
721 Ga0495683_0014543 3300047323 Bacteria 4100
722 Ga0495683_0028365 3300047323 Bacteria 2861
723 Ga0495687_002205 3300047443 Bacteria 16130
724 Ga0495687_011346 3300047443 Bacteria 4801
725 Ga0495687_011390 3300047443 Bacteria 4789
726 Ga0495675_0022378 3300047444 Bacteria 4028
727 Ga0495675_0023506 3300047444 Bacteria 3927
728 Ga0495675_0069292 3300047444 Bacteria 2227
729 Ga0495677_0007558 3300047445 Bacteria 4055
730 Ga0495679_000132 3300047446 Bacteria 66186
731 Ga0495679_001170 3300047446 Bacteria 15609
732 Ga0495679_001404 3300047446 Bacteria 13752
733 Ga0495685_006140 3300047447 Bacteria 3929
734 Ga0495673_0001604 3300047469 Bacteria 17602
735 Ga0495673_0002244 3300047469 Bacteria 13877
736 Ga0495673_0002585 3300047469 Bacteria 12600
737 Ga0495673_0002792 3300047469 Bacteria 11930
738 Ga0495673_0002908 3300047469 Bacteria 11620
739 Ga0495673_0003031 3300047469 Bacteria 11314
740 Ga0495673_0007528 3300047469 Bacteria 6239
741 Ga0495673_0010899 3300047469 Bacteria 4918
742 Ga0495673_0012700 3300047469 Bacteria 4450
743 Ga0495673_0017586 3300047469 Bacteria 3624
744 Ga0495673_0030699 3300047469 Bacteria 2522
745 Ga0495673_0037657 3300047469 Bacteria 2207
746 Ga0495673_0127127 3300047469 Bacteria 1004
747 Ga0495681_0000608 3300047470 Bacteria 27382
748 Ga0495681_0001925 3300047470 Bacteria 15221
749 Ga0495681_0004457 3300047470 Bacteria 9553
750 Ga0495681_0005164 3300047470 Bacteria 8786
751 Ga0495681_0006396 3300047470 Bacteria 7753
752 Ga0495681_0009549 3300047470 Bacteria 5960
753 Ga0495681_0010826 3300047470 Bacteria 5488
754 Ga0495681_0013946 3300047470 Bacteria 4635
755 Ga0495681_0024547 3300047470 Bacteria 3172
756 Ga0495681_0035166 3300047470 Bacteria 2489
757 Ga0495686_0042794 3300047472 Bacteria 2876
758 Ga0495626_0000218 3300048091 Bacteria 68820
759 Ga0495626_0002818 3300048091 Bacteria 11625
760 Ga0495626_0002988 3300048091 Bacteria 11209
761 Ga0495626_0003946 3300048091 Bacteria 9273
762 Ga0495626_0004767 3300048091 Bacteria 8192
763 Ga0495626_0006156 3300048091 Bacteria 6865
764 Ga0495626_0007349 3300048091 Bacteria 6138
765 Ga0495626_0008938 3300048091 Bacteria 5438
766 Ga0496102_0022878 3300048905 Bacteria 5542
767 Ga0496102_0134315 3300048905 Bacteria 2318
768 Ga0496103_0014475 3300048906 Bacteria 4683
769 Ga0496111_0072322 3300048914 Bacteria 2510
770 Ga0496112_0514685 3300048915 Bacteria 1132
771 Ga0496114_0037332 3300048917 Bacteria 4018
772 Ga0496115_0196029 3300048918 Bacteria 1669
773 Ga0496116_0000567 3300048919 Bacteria 49501
774 Ga0496116_0000699 3300048919 Bacteria 43452
775 Ga0496116_0005627 3300048919 Bacteria 11541
776 Ga0496116_0018115 3300048919 Bacteria 5440
777 Ga0496116_0021247 3300048919 Bacteria 4900
778 Ga0496116_0069230 3300048919 Bacteria 2244
779 Ga0496116_0070321 3300048919 Bacteria 2221
780 Ga0496117_0000970 3300048920 Bacteria 43943
781 Ga0496117_0003533 3300048920 Bacteria 18073
782 Ga0496117_0004559 3300048920 Bacteria 15176
783 Ga0496117_0005390 3300048920 Bacteria 13467
784 Ga0496117_0005662 3300048920 Bacteria 13025
785 Ga0496117_0019503 3300048920 Bacteria 5565
786 Ga0496117_0047121 3300048920 Bacteria 3094
787 Ga0496117_0140940 3300048920 Bacteria 1444
788 Ga0496118_0003741 3300048921 Bacteria 18811
789 Ga0496118_0005061 3300048921 Bacteria 15176
790 Ga0496118_0013161 3300048921 Bacteria 7850
791 Ga0496118_0083435 3300048921 Bacteria 2234
792 Ga0496118_0128436 3300048921 Bacteria 1633
793 Ga0496118_0145131 3300048921 Bacteria 1496
794 Ga0496119_0000071 3300048922 Bacteria 153652
795 Ga0496120_0001138 3300048923 Bacteria 34316
796 Ga0496120_0010521 3300048923 Bacteria 6446
797 Ga0496121_0001560 3300048924 Bacteria 38266
798 Ga0496121_0001800 3300048924 Bacteria 34643
799 Ga0496121_0002238 3300048924 Bacteria 30164
800 Ga0496121_0017913 3300048924 Bacteria 7185
801 Ga0496121_0145800 3300048924 Bacteria 1749
802 Ga0496121_0179755 3300048924 Bacteria 1528
803 Ga0496121_0195128 3300048924 Bacteria 1448
804 Ga0496122_0001196 3300048925 Bacteria 44299
805 Ga0496122_0002157 3300048925 Bacteria 28836
806 Ga0496122_0010986 3300048925 Bacteria 9253
807 Ga0496122_0013092 3300048925 Bacteria 8165
808 Ga0496122_0018001 3300048925 Bacteria 6554
809 Ga0496122_0086068 3300048925 Bacteria 2165
810 Ga0496122_0099867 3300048925 Bacteria 1944
811 Ga0496122_0179970 3300048925 Bacteria 1262
812 Ga0496123_0000594 3300048926 Bacteria 61368
813 Ga0496123_0001464 3300048926 Bacteria 32764
814 Ga0496123_0010203 3300048926 Bacteria 8335
815 Ga0496123_0014657 3300048926 Bacteria 6479
816 Ga0496123_0014856 3300048926 Bacteria 6426
817 Ga0496123_0052115 3300048926 Bacteria 2718
818 Ga0496123_0139600 3300048926 Bacteria 1327
819 Ga0496124_0001266 3300048927 Bacteria 38461
820 Ga0496124_0004151 3300048927 Bacteria 17099
821 Ga0496124_0007109 3300048927 Bacteria 11986
822 Ga0496124_0011281 3300048927 Bacteria 8945
823 Ga0496124_0013081 3300048927 Bacteria 8127
824 Ga0496124_0015327 3300048927 Bacteria 7355
825 Ga0496124_0054961 3300048927 Bacteria 3367
826 Ga0496124_0058314 3300048927 Bacteria 3248
827 Ga0496124_0066815 3300048927 Bacteria 2993
828 Ga0496125_0003386 3300048928 Bacteria 19397
829 Ga0496125_0005700 3300048928 Bacteria 13731
830 Ga0496125_0006235 3300048928 Bacteria 12966
831 Ga0496125_0015371 3300048928 Bacteria 7408
832 Ga0496125_0015837 3300048928 Bacteria 7264
833 Ga0496125_0016542 3300048928 Bacteria 7077
834 Ga0496125_0041345 3300048928 Bacteria 3942
835 Ga0496125_0113390 3300048928 Bacteria 1956
836 Ga0496126_0017913 3300048929 Bacteria 7046
837 Ga0496126_0033815 3300048929 Bacteria 4808
838 Ga0496126_0045794 3300048929 Bacteria 4018
839 Ga0496126_0072120 3300048929 Bacteria 3072
840 Ga0496126_0234549 3300048929 Bacteria 1536
841 Ga0495678_000017 3300049459 Bacteria 282592
842 Ga0495678_002786 3300049459 Bacteria 11404
843 Ga0495678_004463 3300049459 Bacteria 8083
844 Ga0495678_004822 3300049459 Bacteria 7664
845 Ga0495678_007223 3300049459 Bacteria 5786
846 Ga0495678_008310 3300049459 Bacteria 5251
847 Ga0495678_010219 3300049459 Bacteria 4574
848 Ga0495678_022736 3300049459 Bacteria 2737
849 Ga0495678_051856 3300049459 Bacteria 1583
850 Ga0495682_0000235 3300049460 Bacteria 43660
851 Ga0495682_0000375 3300049460 Bacteria 32322
852 Ga0495682_0021362 3300049460 Bacteria 2425
853 Ga0495682_0137032 3300049460 Bacteria 874
854 Ga0501031_0192610 3300049568 Bacteria 1331
855 Ga0501032_0093399 3300049569 Bacteria 1995
856 Ga0501034_0000165 3300049571 Bacteria 123084
857 Ga0501037_0032342 3300049573 Bacteria 3863
858 Ga0501039_0149389 3300049575 Bacteria 1836
859 Ga0501241_000551 3300049758 Bacteria 8051
860 Ga0501226_000002 3300049853 Bacteria 426935
861 Ga0501226_001319 3300049853 Bacteria 3205
862 Ga0500618_001805 3300053125 Bacteria 9020
863 Ga0500573_0179976 3300053140 Bacteria 1137

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042146 Ga0450907_039522 Ga0450907_039522_74_796 240
2 3300046674 Ga0495588_0026370 Ga0495588_0026370_2160_2882 240
3 3300042138 Ga0450903_016216 Ga0450903_016216_74_904 243
4 3300006051 Ga0075364_10056823 Ga0075364_100568232 253
5 3300042185 Ga0450909_001760 Ga0450909_001760_1900_2676 255
6 3300042010 Ga0439452_000992 Ga0439452_000992_8855_9631 257
7 3300013102 Ga0157371_10435411 Ga0157371_104354111 258
8 iso_pu_bacteria 2935625433 2935628601 260
9 iso_pu_bacteria 2939617950 2939620915 260
10 iso_pu_bacteria 2974435778 2974436105 260
11 iso_pu_bacteria 8019504834 8019507128 260
12 iso_pu_bacteria 2808606373 2808905391 261
13 3300013102 Ga0157371_10002020 Ga0157371_1000202015 262
14 3300025728 Ga0207655_1051225 Ga0207655_10512253 263
15 iso_pu_bacteria 3007315729 3007316584 263
16 3300013105 Ga0157369_10000184 Ga0157369_1000018478 264
17 3300013307 Ga0157372_10000062 Ga0157372_1000006230 264
18 3300025245 Ga0207425_1001697 Ga0207425_10016973 264
19 3300025258 Ga0209129_1000021 Ga0209129_1000021151 264
20 3300027312 Ga0209371_1000029 Ga0209371_1000029129 264
21 3300027312 Ga0209371_1018226 Ga0209371_10182262 264
22 3300030500 Ga0268256_1000032 Ga0268256_1000032266 264
23 3300030500 Ga0268256_1005448 Ga0268256_10054482 264
24 3300042010 Ga0439452_000012 Ga0439452_000012_121616_122413 264
25 3300048919 Ga0496116_0069230 Ga0496116_0069230_1288_2085 264
26 3300048919 Ga0496116_0070321 Ga0496116_0070321_131_928 264
27 3300048920 Ga0496117_0004559 Ga0496117_0004559_4304_5101 264
28 3300048920 Ga0496117_0047121 Ga0496117_0047121_1841_2638 264
29 3300048921 Ga0496118_0005061 Ga0496118_0005061_4304_5101 264
30 3300048925 Ga0496122_0018001 Ga0496122_0018001_3410_4207 264
31 3300048925 Ga0496122_0086068 Ga0496122_0086068_227_1024 264
32 3300048926 Ga0496123_0014856 Ga0496123_0014856_98_895 264
33 3300048927 Ga0496124_0004151 Ga0496124_0004151_13721_14518 264
34 3300048928 Ga0496125_0015837 Ga0496125_0015837_5027_5824 264
35 iso_pu_bacteria 2510065053 2510284871 264
36 iso_pu_bacteria 2510065055 2510295181 264
37 iso_pu_bacteria 2510065058 2510312249 264
38 iso_pu_bacteria 2511231004 2511256100 264
39 iso_pu_bacteria 2511231006 2511266077 264
40 iso_pu_bacteria 2511231007 2511272789 264
41 iso_pu_bacteria 2511231008 2511278871 264
42 iso_pu_bacteria 2511231010 2511288750 264
43 iso_pu_bacteria 2511231011 2511297385 264
44 iso_pu_bacteria 2511231012 2511300144 264
45 iso_pu_bacteria 2511231014 2511316352 264
46 iso_pu_bacteria 2511231015 2511319412 264
47 iso_pu_bacteria 2511231016 2511323517 264
48 iso_pu_bacteria 2511231017 2511330956 264
49 iso_pu_bacteria 2511231018 2511337803 264
50 iso_pu_bacteria 2511231019 2511344565 264
51 iso_pu_bacteria 2511231020 2511349147 264
52 iso_pu_bacteria 2511231021 2511354087 264
53 iso_pu_bacteria 2511231022 2511365050 264
54 iso_pu_bacteria 2511231023 2511368957 264
55 iso_pu_bacteria 2511231024 2511376024 264
56 iso_pu_bacteria 2511231031 2511414332 264
57 iso_pu_bacteria 2511231156 2511822493 264
58 iso_pu_bacteria 2512047018 2512325988 264
59 iso_pu_bacteria 2554235132 2554818051 264
60 iso_pu_bacteria 2554235231 2555247825 264
61 iso_pu_bacteria 2554235341 2555667462 264
62 iso_pu_bacteria 2582580891 2583789773 264
63 iso_pu_bacteria 2597489887 2597855693 264
64 iso_pu_bacteria 2597489888 2597861701 264
65 iso_pu_bacteria 2599185155 2599327331 264
66 iso_pu_bacteria 2599185160 2599356683 264
67 iso_pu_bacteria 2599185161 2599363285 264
68 iso_pu_bacteria 2599185162 2599369763 264
69 iso_pu_bacteria 2599185163 2599376394 264
70 iso_pu_bacteria 2599185164 2599381788 264
71 iso_pu_bacteria 2599185165 2599388068 264
72 iso_pu_bacteria 2599185166 2599395408 264
73 iso_pu_bacteria 2599185167 2599398817 264
74 iso_pu_bacteria 2599185168 2599407173 264
75 iso_pu_bacteria 2599185179 2599450872 264
76 iso_pu_bacteria 2599185181 2599463516 264
77 iso_pu_bacteria 2599185182 2599469134 264
78 iso_pu_bacteria 2599185185 2599485595 264
79 iso_pu_bacteria 2599185186 2599492535 264
80 iso_pu_bacteria 2599185188 2599500071 264
81 iso_pu_bacteria 2599185189 2599506464 264
82 iso_pu_bacteria 2599185190 2599514182 264
83 iso_pu_bacteria 2599185191 2599518783 264
84 iso_pu_bacteria 2599185212 2599616654 264
85 iso_pu_bacteria 2599185248 2599769451 264
86 iso_pu_bacteria 2599185257 2599806724 264
87 iso_pu_bacteria 2599185288 2599883539 264
88 iso_pu_bacteria 2599185289 2599886871 264
89 iso_pu_bacteria 2599185290 2599893483 264
90 iso_pu_bacteria 2599185291 2599898200 264
91 iso_pu_bacteria 2599185300 2599930933 264
92 iso_pu_bacteria 2599185302 2599944688 264
93 iso_pu_bacteria 2599185303 2599950726 264
94 iso_pu_bacteria 2599185304 2599957308 264
95 iso_pu_bacteria 2599185305 2599962002 264
96 iso_pu_bacteria 2599185306 2599964586 264
97 iso_pu_bacteria 2599185307 2599972998 264
98 iso_pu_bacteria 2599185308 2599978873 264
99 iso_pu_bacteria 2599185309 2599983259 264
100 iso_pu_bacteria 2599185310 2599991646 264
101 iso_pu_bacteria 2599185311 2599994806 264
102 iso_pu_bacteria 2599185312 2600000931 264
103 iso_pu_bacteria 2599185313 2600004901 264
104 iso_pu_bacteria 2599185314 2600012833 264
105 iso_pu_bacteria 2599185315 2600018936 264
106 iso_pu_bacteria 2599185316 2600027032 264
107 iso_pu_bacteria 2599185317 2600030948 264
108 iso_pu_bacteria 2599185318 2600034623 264
109 iso_pu_bacteria 2599185319 2600043429 264
110 iso_pu_bacteria 2599185320 2600048266 264
111 iso_pu_bacteria 2599185321 2600053363 264
112 iso_pu_bacteria 2599185322 2600062741 264
113 iso_pu_bacteria 2599185323 2600068444 264
114 iso_pu_bacteria 2599185324 2600071830 264
115 iso_pu_bacteria 2599185325 2600077706 264
116 iso_pu_bacteria 2599185356 2600216145 264
117 iso_pu_bacteria 2600254930 2600360839 264
118 iso_pu_bacteria 2600254931 2600364846 264
119 iso_pu_bacteria 2600254954 2600443873 264
120 iso_pu_bacteria 2600255283 2601627154 264
121 iso_pu_bacteria 2600255296 2601692383 264
122 iso_pu_bacteria 2600255313 2601776312 264
123 iso_pu_bacteria 2600255318 2601797872 264
124 iso_pu_bacteria 2600255389 2602008676 264
125 iso_pu_bacteria 2603880185 2606076645 264
126 iso_pu_bacteria 2603880199 2606128941 264
127 iso_pu_bacteria 2606217733 2608380645 264
128 iso_pu_bacteria 2619619299 2621302145 264
129 iso_pu_bacteria 2623620443 2624478258 264
130 iso_pu_bacteria 2623620446 2624489801 264
131 iso_pu_bacteria 2643221565 2643841026 264
132 iso_pu_bacteria 2643221589 2643954865 264
133 iso_pu_bacteria 2643221602 2644024505 264
134 iso_pu_bacteria 2643221633 2644190199 264
135 iso_pu_bacteria 2643221650 2644282034 264
136 iso_pu_bacteria 2643221713 2644619683 264
137 iso_pu_bacteria 2651869719 2652547007 264
138 iso_pu_bacteria 2667528170 2671090761 264
139 iso_pu_bacteria 2667528171 2671099927 264
140 iso_pu_bacteria 2667528176 2671127383 264
141 iso_pu_bacteria 2671180172 2671772375 264
142 iso_pu_bacteria 2675903515 2678261030 264
143 iso_pu_bacteria 2713897148 2715749245 264
144 iso_pu_bacteria 2713897149 2715755513 264
145 iso_pu_bacteria 2718217725 2718632196 264
146 iso_pu_bacteria 2721755607 2723246595 264
147 iso_pu_bacteria 2728369097 2729148675 264
148 iso_pu_bacteria 2738541265 2738674120 264
149 iso_pu_bacteria 2738541271 2738687553 264
150 iso_pu_bacteria 2738541282 2738752513 264
151 iso_pu_bacteria 2738541294 2738807872 264
152 iso_pu_bacteria 2738541303 2738861554 264
153 iso_pu_bacteria 2738541309 2738895232 264
154 iso_pu_bacteria 2738543004 2739200499 264
155 iso_pu_bacteria 2738543015 2739260022 264
156 iso_pu_bacteria 2738543016 2739263174 264
157 iso_pu_bacteria 2738543020 2739287105 264
158 iso_pu_bacteria 2738543021 2739292418 264
159 iso_pu_bacteria 2738543025 2739311319 264
160 iso_pu_bacteria 2740892503 2743735110 264
161 iso_pu_bacteria 2744054620 2745006341 264
162 iso_pu_bacteria 2765235841 2765586409 264
163 iso_pu_bacteria 2773857670 2774119518 264
164 iso_pu_bacteria 2773857672 2774132360 264
165 iso_pu_bacteria 2773857673 2774134772 264
166 iso_pu_bacteria 2784132063 2784261009 264
167 iso_pu_bacteria 2784132072 2784315929 264
168 iso_pu_bacteria 2791355520 2794594019 264
169 iso_pu_bacteria 2806310737 2807410651 264
170 iso_pu_bacteria 2806310745 2807458992 264
171 iso_pu_bacteria 2808606361 2808855981 264
172 iso_pu_bacteria 2808606376 2808922704 264
173 iso_pu_bacteria 2808606377 2808933121 264
174 iso_pu_bacteria 2808606378 2808936061 264
175 iso_pu_bacteria 2808606379 2808939655 264
176 iso_pu_bacteria 2808606380 2808944391 264
177 iso_pu_bacteria 2808606381 2808955243 264
178 iso_pu_bacteria 2808606382 2808955909 264
179 iso_pu_bacteria 2808606383 2808964442 264
180 iso_pu_bacteria 2808606385 2808976623 264
181 iso_pu_bacteria 2808606388 2808991939 264
182 iso_pu_bacteria 2808606389 2808999330 264
183 iso_pu_bacteria 2808606445 2809218016 264
184 iso_pu_bacteria 2811994881 2812370229 264
185 iso_pu_bacteria 2816332298 2817488445 264
186 iso_pu_bacteria 2818991456 2819657270 264
187 iso_pu_bacteria 2818991464 2819705257 264
188 iso_pu_bacteria 2823421272 2823425468 264
189 iso_pu_bacteria 2825651385 2825654228 264
190 iso_pu_bacteria 2826581358 2826586161 264
191 iso_pu_bacteria 2834028612 2834032178 264
192 iso_pu_bacteria 2842805378 2842809903 264
193 iso_pu_bacteria 2842815866 2842817797 264
194 iso_pu_bacteria 2842826826 2842830545 264
195 iso_pu_bacteria 2842832357 2842834199 264
196 iso_pu_bacteria 2842837860 2842838672 264
197 iso_pu_bacteria 2842843487 2842846325 264
198 iso_pu_bacteria 2842849001 2842851745 264
199 iso_pu_bacteria 2842854478 2842858685 264
200 iso_pu_bacteria 2844665904 2844667940 264
201 iso_pu_bacteria 2852612431 2852617110 264
202 iso_pu_bacteria 2852657418 2852660415 264
203 iso_pu_bacteria 2852667396 2852671901 264
204 iso_pu_bacteria 2860339153 2860343602 264
205 iso_pu_bacteria 2878029506 2878030201 264
206 iso_pu_bacteria 2880230671 2880231150 264
207 iso_pu_bacteria 2904518522 2904519606 264
208 iso_pu_bacteria 2904550169 2904555518 264
209 iso_pu_bacteria 2908446538 2908447064 264
210 iso_pu_bacteria 2912963787 2912968684 264
211 iso_pu_bacteria 2913036834 2913037321 264
212 iso_pu_bacteria 2917070673 2917071212 264
213 iso_pu_bacteria 2917832318 2917834096 264
214 iso_pu_bacteria 2919063839 2919066116 264
215 iso_pu_bacteria 2919125081 2919127675 264
216 iso_pu_bacteria 2919155634 2919155722 264
217 iso_pu_bacteria 2919385768 2919389734 264
218 iso_pu_bacteria 2919456309 2919460026 264
219 iso_pu_bacteria 2919481497 2919486938 264
220 iso_pu_bacteria 2919487758 2919488663 264
221 iso_pu_bacteria 2919501602 2919502203 264
222 iso_pu_bacteria 2919697872 2919698919 264
223 iso_pu_bacteria 2923153595 2923154105 264
224 iso_pu_bacteria 2923519811 2923524317 264
225 iso_pu_bacteria 2923586266 2923589825 264
226 iso_pu_bacteria 2926063275 2926063876 264
227 iso_pu_bacteria 2929144301 2929144855 264
228 iso_pu_bacteria 2929189879 2929190332 264
229 iso_pu_bacteria 2931369376 2931371808 264
230 iso_pu_bacteria 2931390751 2931391414 264
231 iso_pu_bacteria 2931396565 2931398880 264
232 iso_pu_bacteria 2935353572 2935359040 264
233 iso_pu_bacteria 2939636861 2939641147 264
234 iso_pu_bacteria 2939651529 2939654024 264
235 iso_pu_bacteria 2945928738 2945930131 264
236 iso_pu_bacteria 2945961074 2945967627 264
237 iso_pu_bacteria 2946006987 2946012475 264
238 iso_pu_bacteria 2969304461 2969304997 264
239 iso_pu_bacteria 2974289157 2974293313 264
240 iso_pu_bacteria 2974298342 2974298712 264
241 iso_pu_bacteria 2984286254 2984291954 264
242 iso_pu_bacteria 2984499530 2984501005 264
243 iso_pu_bacteria 2984504281 2984505549 264
244 iso_pu_bacteria 2988728565 2988732243 264
245 iso_pu_bacteria 2990196909 2990198740 264
246 iso_pu_bacteria 2998139840 2998140502 264
247 iso_pu_bacteria 3007252601 3007254633 264
248 iso_pu_bacteria 3007395558 3007399657 264
249 iso_pu_bacteria 3007511990 3007517953 264
250 iso_pu_bacteria 3007614139 3007617837 264
251 iso_pu_bacteria 3007619802 3007622006 264
252 iso_pu_bacteria 3007718800 3007720298 264
253 iso_pu_bacteria 3007803356 3007805383 264
254 iso_pu_bacteria 3007855910 3007859737 264
255 iso_pu_bacteria 3007861166 3007864291 264
256 iso_pu_bacteria 3007866637 3007872125 264
257 iso_pu_bacteria 3007872151 3007872652 264
258 iso_pu_bacteria 637000220 637317857 264
259 iso_pu_bacteria 8011350971 8011352678 264
260 iso_pu_bacteria 8015687852 8015688354 264
261 iso_pu_bacteria 8016728285 8016732530 264
262 iso_pu_bacteria 8019769354 8019770341 264
263 iso_pu_bacteria 8019775933 8019777377 264
264 iso_pu_bacteria 8029995093 8030000237 264
265 iso_pu_bacteria 8034962539 8034963446 264
266 iso_pu_bacteria 8052494512 8052499620 264
267 iso_pu_bacteria 8054285046 8054290975 264
268 iso_pu_bacteria 8054347763 8054350096 264
269 iso_pu_bacteria 8054503363 8054503999 264
270 iso_pu_bacteria 8054929484 8054934202 264
271 iso_pu_bacteria 8055770955 8055771451 264
272 iso_pu_bacteria 8055817908 8055818399 264
273 iso_pu_bacteria 8055878733 8055879387 264
274 iso_pu_bacteria 8056115690 8056115943 264
275 iso_pu_bacteria 8056120720 8056121103 264
276 iso_pu_bacteria 8056125926 8056126511 264
277 iso_pu_bacteria 8056131705 8056132373 264
278 iso_pu_bacteria 8056143049 8056143783 264
279 iso_pu_bacteria 8056155041 8056158553 264
280 iso_pu_bacteria 8056161164 8056164379 264
281 iso_pu_bacteria 8056166840 8056170549 264
282 iso_pu_bacteria 8056172158 8056176669 264
283 iso_pu_bacteria 8056177738 8056183006 264
284 iso_pu_bacteria 8056569372 8056572357 264
285 iso_pu_bacteria 8057798959 8057802743 264
286 3300046507 Ga0495606_0117649 Ga0495606_0117649_271_1068 265
287 3300046810 Ga0495660_0026092 Ga0495660_0026092_528_1340 265
288 3300015261 Ga0182006_1046602 Ga0182006_10466021 267
289 3300027312 Ga0209371_1000380 Ga0209371_100038011 267
290 3300030500 Ga0268256_1000428 Ga0268256_10004286 267
291 3300042439 Ga0439464_0004794 Ga0439464_0004794_931_1758 267
292 2124908027 MRS2a_Contig_87 MRS2a_00716270 268
293 2162886007 SwRhRL2b_contig_288416 SwRhRL2b_0400.00001110 268
294 2162886007 SwRhRL2b_contig_487482 SwRhRL2b_0810.00003840 268
295 3300001915 JGI24741J21665_1006446 JGI24741J21665_10064462 268
296 3300002771 JGI25163J39215_1000534 JGI25163J39215_10005345 268
297 3300002771 JGI25163J39215_1001084 JGI25163J39215_10010844 268
298 3300002772 JGI25164J39214_1000145 JGI25164J39214_100014554 268
299 3300002772 JGI25164J39214_1000148 JGI25164J39214_10001485 268
300 3300003214 JGI25165J46597_1000266 JGI25165J46597_10002665 268
301 3300003214 JGI25165J46597_1000268 JGI25165J46597_10002685 268
302 3300003752 Ga0055539_1000048 Ga0055539_100004859 268
303 3300003756 Ga0055533_1000059 Ga0055533_100005959 268
304 3300003758 Ga0055532_1000096 Ga0055532_100009620 268
305 3300003759 Ga0055525_1000189 Ga0055525_100018959 268
306 3300003781 Ga0055536_1000615 Ga0055536_10006155 268
307 3300003781 Ga0055536_1002223 Ga0055536_10022235 268
308 3300003791 Ga0055530_10000374 Ga0055530_100003746 268
309 3300003791 Ga0055530_10000913 Ga0055530_100009135 268
310 3300003792 Ga0055540_1000337 Ga0055540_10003375 268
311 3300003792 Ga0055540_1000646 Ga0055540_10006465 268
312 3300003792 Ga0055540_1000657 Ga0055540_10006575 268
313 3300003794 Ga0055531_10000375 Ga0055531_100003759 268
314 3300003841 Ga0055541_1000035 Ga0055541_1000035101 268
315 3300005288 Ga0065714_10000248 Ga0065714_100002485 268
316 3300005288 Ga0065714_10004567 Ga0065714_100045676 268
317 3300005288 Ga0065714_10016358 Ga0065714_100163582 268
318 3300005288 Ga0065714_10066037 Ga0065714_100660375 268
319 3300005288 Ga0065714_10067559 Ga0065714_100675595 268
320 3300005288 Ga0065714_10069151 Ga0065714_100691512 268
321 3300005288 Ga0065714_10075356 Ga0065714_100753563 268
322 3300005288 Ga0065714_10172978 Ga0065714_101729781 268
323 3300005289 Ga0065704_10000791 Ga0065704_100007915 268
324 3300005289 Ga0065704_10001014 Ga0065704_1000101410 268
325 3300005289 Ga0065704_10020956 Ga0065704_100209562 268
326 3300005289 Ga0065704_10090218 Ga0065704_100902183 268
327 3300005290 Ga0065712_10067752 Ga0065712_1006775241 268
328 3300005290 Ga0065712_10069162 Ga0065712_100691623 268
329 3300005331 Ga0070670_100001434 Ga0070670_10000143412 268
330 3300005331 Ga0070670_100014428 Ga0070670_1000144283 268
331 3300005344 Ga0070661_100000078 Ga0070661_10000007812 268
332 3300005353 Ga0070669_100001899 Ga0070669_1000018996 268
333 3300005435 Ga0070714_100424047 Ga0070714_1004240471 268
334 3300005457 Ga0070662_100003973 Ga0070662_1000039734 268
335 3300005539 Ga0068853_100000210 Ga0068853_10000021016 268
336 3300005548 Ga0070665_100370287 Ga0070665_1003702872 268
337 3300005548 Ga0070665_100619819 Ga0070665_1006198191 268
338 3300005564 Ga0070664_100007381 Ga0070664_1000073815 268
339 3300005564 Ga0070664_100017832 Ga0070664_1000178326 268
340 3300005578 Ga0068854_100002209 Ga0068854_1000022095 268
341 3300005834 Ga0068851_10000004 Ga0068851_10000004210 268
342 3300006051 Ga0075364_10120441 Ga0075364_101204413 268
343 3300006058 Ga0075432_10001130 Ga0075432_100011305 268
344 3300006058 Ga0075432_10003524 Ga0075432_100035244 268
345 3300006058 Ga0075432_10037538 Ga0075432_100375382 268
346 3300006058 Ga0075432_10085681 Ga0075432_100856812 268
347 3300006177 Ga0075362_10009085 Ga0075362_100090852 268
348 3300006177 Ga0075362_10231875 Ga0075362_102318751 268
349 3300006914 Ga0075436_100099306 Ga0075436_1000993063 268
350 3300006944 Ga0099823_1013050 Ga0099823_10130507 268
351 3300006946 Ga0079104_1000638 Ga0079104_10006386 268
352 3300006946 Ga0079104_1000654 Ga0079104_10006545 268
353 3300006946 Ga0079104_1002562 Ga0079104_10025626 268
354 3300006946 Ga0079104_1033089 Ga0079104_10330892 268
355 3300006948 Ga0099826_10018533 Ga0099826_100185334 268
356 3300009011 Ga0105251_10001807 Ga0105251_1000180714 268
357 3300009011 Ga0105251_10002054 Ga0105251_100020548 268
358 3300009011 Ga0105251_10003211 Ga0105251_100032115 268
359 3300009011 Ga0105251_10003431 Ga0105251_100034315 268
360 3300009011 Ga0105251_10004126 Ga0105251_100041265 268
361 3300009011 Ga0105251_10004337 Ga0105251_100043378 268
362 3300009011 Ga0105251_10020559 Ga0105251_100205593 268
363 3300009011 Ga0105251_10027160 Ga0105251_100271603 268
364 3300009011 Ga0105251_10125409 Ga0105251_101254092 268
365 3300009036 Ga0105244_10000133 Ga0105244_1000013357 268
366 3300009036 Ga0105244_10002007 Ga0105244_100020072 268
367 3300009036 Ga0105244_10002116 Ga0105244_1000211613 268
368 3300009036 Ga0105244_10004326 Ga0105244_100043264 268
369 3300009036 Ga0105244_10008580 Ga0105244_100085802 268
370 3300009036 Ga0105244_10016377 Ga0105244_100163775 268
371 3300009036 Ga0105244_10016789 Ga0105244_100167891 268
372 3300009036 Ga0105244_10022008 Ga0105244_100220081 268
373 3300009036 Ga0105244_10025650 Ga0105244_100256504 268
374 3300009036 Ga0105244_10056930 Ga0105244_100569302 268
375 3300009036 Ga0105244_10065634 Ga0105244_100656343 268
376 3300009036 Ga0105244_10091443 Ga0105244_100914432 268
377 3300009036 Ga0105244_10093117 Ga0105244_100931171 268
378 3300009092 Ga0105250_10000423 Ga0105250_100004235 268
379 3300009092 Ga0105250_10002533 Ga0105250_100025338 268
380 3300009092 Ga0105250_10002789 Ga0105250_100027895 268
381 3300009092 Ga0105250_10006222 Ga0105250_100062224 268
382 3300009092 Ga0105250_10011389 Ga0105250_100113892 268
383 3300009092 Ga0105250_10033549 Ga0105250_100335492 268
384 3300009148 Ga0105243_10001058 Ga0105243_1000105817 268
385 3300009148 Ga0105243_10001664 Ga0105243_1000166417 268
386 3300009148 Ga0105243_10002290 Ga0105243_1000229012 268
387 3300009148 Ga0105243_10007323 Ga0105243_100073232 268
388 3300009148 Ga0105243_10029807 Ga0105243_100298074 268
389 3300009148 Ga0105243_10032432 Ga0105243_100324322 268
390 3300009148 Ga0105243_10036011 Ga0105243_100360113 268
391 3300009176 Ga0105242_10004878 Ga0105242_100048786 268
392 3300009545 Ga0105237_10007904 Ga0105237_100079046 268
393 3300009545 Ga0105237_10149704 Ga0105237_101497041 268
394 3300009553 Ga0105249_10055939 Ga0105249_100559394 268
395 3300011119 Ga0105246_10000489 Ga0105246_1000048912 268
396 3300011119 Ga0105246_10005406 Ga0105246_100054063 268
397 3300011119 Ga0105246_10077933 Ga0105246_100779333 268
398 3300011119 Ga0105246_10083769 Ga0105246_100837692 268
399 3300012498 Ga0157345_1000037 Ga0157345_10000375 268
400 3300013100 Ga0157373_10008180 Ga0157373_100081807 268
401 3300013100 Ga0157373_10012146 Ga0157373_100121468 268
402 3300013100 Ga0157373_10022539 Ga0157373_100225395 268
403 3300013100 Ga0157373_10029077 Ga0157373_100290771 268
404 3300013100 Ga0157373_10032871 Ga0157373_100328712 268
405 3300013100 Ga0157373_10037056 Ga0157373_100370563 268
406 3300013100 Ga0157373_10044899 Ga0157373_100448992 268
407 3300013100 Ga0157373_10096805 Ga0157373_100968052 268
408 3300013100 Ga0157373_10219535 Ga0157373_102195352 268
409 3300013100 Ga0157373_10331575 Ga0157373_103315752 268
410 3300013102 Ga0157371_10000839 Ga0157371_100008395 268
411 3300013102 Ga0157371_10002513 Ga0157371_100025136 268
412 3300013102 Ga0157371_10004811 Ga0157371_100048115 268
413 3300013102 Ga0157371_10051956 Ga0157371_100519564 268
414 3300013104 Ga0157370_10000388 Ga0157370_1000038846 268
415 3300013104 Ga0157370_10014921 Ga0157370_100149216 268
416 3300013104 Ga0157370_10104635 Ga0157370_101046353 268
417 3300013104 Ga0157370_10162376 Ga0157370_101623762 268
418 3300013104 Ga0157370_10192583 Ga0157370_101925832 268
419 3300013104 Ga0157370_10246484 Ga0157370_102464842 268
420 3300013104 Ga0157370_10246485 Ga0157370_102464852 268
421 3300013105 Ga0157369_10001610 Ga0157369_1000161022 268
422 3300013105 Ga0157369_10002373 Ga0157369_1000237312 268
423 3300013105 Ga0157369_10008368 Ga0157369_100083687 268
424 3300013105 Ga0157369_10018752 Ga0157369_100187525 268
425 3300013105 Ga0157369_10040248 Ga0157369_100402484 268
426 3300013105 Ga0157369_10478173 Ga0157369_104781731 268
427 3300013105 Ga0157369_10662021 Ga0157369_106620212 268
428 3300013306 Ga0163162_10159342 Ga0163162_101593421 268
429 3300013307 Ga0157372_10000947 Ga0157372_1000094721 268
430 3300013307 Ga0157372_10006103 Ga0157372_100061037 268
431 3300013307 Ga0157372_10046612 Ga0157372_100466125 268
432 3300013307 Ga0157372_10374368 Ga0157372_103743682 268
433 3300013308 Ga0157375_10001804 Ga0157375_100018045 268
434 3300013308 Ga0157375_10008927 Ga0157375_100089276 268
435 3300013308 Ga0157375_10015868 Ga0157375_100158687 268
436 3300014497 Ga0182008_10000659 Ga0182008_1000065917 268
437 3300014497 Ga0182008_10005131 Ga0182008_100051312 268
438 3300014497 Ga0182008_10012107 Ga0182008_100121071 268
439 3300014497 Ga0182008_10022943 Ga0182008_100229432 268
440 3300014497 Ga0182008_10036559 Ga0182008_100365593 268
441 3300014497 Ga0182008_10053683 Ga0182008_100536832 268
442 3300015261 Ga0182006_1003235 Ga0182006_10032352 268
443 3300015261 Ga0182006_1003547 Ga0182006_10035475 268
444 3300015261 Ga0182006_1003616 Ga0182006_10036164 268
445 3300015261 Ga0182006_1008819 Ga0182006_10088196 268
446 3300015261 Ga0182006_1012301 Ga0182006_10123014 268
447 3300015261 Ga0182006_1012616 Ga0182006_10126163 268
448 3300015261 Ga0182006_1020170 Ga0182006_10201702 268
449 3300015262 Ga0182007_10003898 Ga0182007_100038982 268
450 3300015262 Ga0182007_10007513 Ga0182007_100075136 268
451 3300015265 Ga0182005_1004207 Ga0182005_10042072 268
452 3300015265 Ga0182005_1004402 Ga0182005_10044026 268
453 3300015265 Ga0182005_1009233 Ga0182005_10092332 268
454 3300015265 Ga0182005_1016613 Ga0182005_10166132 268
455 3300015265 Ga0182005_1024350 Ga0182005_10243501 268
456 3300017792 Ga0163161_10000624 Ga0163161_1000062423 268
457 3300017792 Ga0163161_10005035 Ga0163161_100050354 268
458 3300017792 Ga0163161_10013791 Ga0163161_100137913 268
459 3300017792 Ga0163161_10026264 Ga0163161_100262643 268
460 3300017792 Ga0163161_10171325 Ga0163161_101713252 268
461 3300017792 Ga0163161_10405035 Ga0163161_104050351 268
462 3300017792 Ga0163161_10482035 Ga0163161_104820351 268
463 3300025206 Ga0209435_100864 Ga0209435_1008643 268
464 3300025207 Ga0209760_100181 Ga0209760_1001814 268
465 3300025207 Ga0209760_100215 Ga0209760_10021517 268
466 3300025224 Ga0209784_100028 Ga0209784_100028100 268
467 3300025225 Ga0209566_100028 Ga0209566_100028100 268
468 3300025226 Ga0209674_100047 Ga0209674_100047100 268
469 3300025229 Ga0209147_100031 Ga0209147_100031100 268
470 3300025230 Ga0209563_100050 Ga0209563_100050100 268
471 3300025230 Ga0209563_100488 Ga0209563_1004889 268
472 3300025231 Ga0207427_100014 Ga0207427_100014413 268
473 3300025231 Ga0207427_100016 Ga0207427_100016205 268
474 3300025233 Ga0209437_100011 Ga0209437_100011394 268
475 3300025233 Ga0209437_100016 Ga0209437_100016224 268
476 3300025242 Ga0209258_100150 Ga0209258_10015055 268
477 3300025246 Ga0209646_1000165 Ga0209646_100016555 268
478 3300025253 Ga0209677_100029 Ga0209677_100029100 268
479 3300025256 Ga0209759_1011972 Ga0209759_10119722 268
480 3300025261 Ga0209233_1000019 Ga0209233_1000019394 268
481 3300025261 Ga0209233_1000036 Ga0209233_1000036413 268
482 3300025291 Ga0209675_1002284 Ga0209675_10022842 268
483 3300025292 Ga0209676_1000025 Ga0209676_1000025230 268
484 3300025292 Ga0209676_1000032 Ga0209676_1000032383 268
485 3300025292 Ga0209676_1000326 Ga0209676_10003266 268
486 3300025292 Ga0209676_1001232 Ga0209676_100123215 268
487 3300025292 Ga0209676_1001980 Ga0209676_10019808 268
488 3300025292 Ga0209676_1015080 Ga0209676_10150802 268
489 3300025298 Ga0209050_1000025 Ga0209050_1000025384 268
490 3300025298 Ga0209050_1000028 Ga0209050_1000028303 268
491 3300025298 Ga0209050_1001079 Ga0209050_100107922 268
492 3300025298 Ga0209050_1001508 Ga0209050_100150818 268
493 3300025303 Ga0209051_1000026 Ga0209051_100002625 268
494 3300025303 Ga0209051_1000080 Ga0209051_1000080136 268
495 3300025303 Ga0209051_1000334 Ga0209051_100033417 268
496 3300025303 Ga0209051_1003650 Ga0209051_10036504 268
497 3300025304 Ga0209257_1000034 Ga0209257_1000034230 268
498 3300025321 Ga0207656_10000007 Ga0207656_1000000746 268
499 3300025711 Ga0207696_1000020 Ga0207696_10000206 268
500 3300025711 Ga0207696_1000057 Ga0207696_100005762 268
501 3300025711 Ga0207696_1000064 Ga0207696_1000064105 268
502 3300025711 Ga0207696_1000229 Ga0207696_100022964 268
503 3300025711 Ga0207696_1003169 Ga0207696_10031696 268
504 3300025711 Ga0207696_1003440 Ga0207696_10034403 268
505 3300025711 Ga0207696_1014985 Ga0207696_10149853 268
506 3300025711 Ga0207696_1020002 Ga0207696_10200023 268
507 3300025728 Ga0207655_1000014 Ga0207655_1000014192 268
508 3300025728 Ga0207655_1000406 Ga0207655_100040646 268
509 3300025728 Ga0207655_1000565 Ga0207655_100056533 268
510 3300025728 Ga0207655_1000815 Ga0207655_100081528 268
511 3300025728 Ga0207655_1000922 Ga0207655_10009225 268
512 3300025728 Ga0207655_1001160 Ga0207655_10011603 268
513 3300025728 Ga0207655_1001818 Ga0207655_10018185 268
514 3300025728 Ga0207655_1002188 Ga0207655_10021886 268
515 3300025728 Ga0207655_1002787 Ga0207655_10027879 268
516 3300025728 Ga0207655_1003594 Ga0207655_10035945 268
517 3300025728 Ga0207655_1003980 Ga0207655_10039805 268
518 3300025728 Ga0207655_1004144 Ga0207655_10041445 268
519 3300025728 Ga0207655_1005546 Ga0207655_10055463 268
520 3300025728 Ga0207655_1006369 Ga0207655_10063695 268
521 3300025728 Ga0207655_1010151 Ga0207655_10101513 268
522 3300025728 Ga0207655_1010822 Ga0207655_10108222 268
523 3300025728 Ga0207655_1017130 Ga0207655_10171301 268
524 3300025728 Ga0207655_1056487 Ga0207655_10564872 268
525 3300025728 Ga0207655_1057153 Ga0207655_10571531 268
526 3300025728 Ga0207655_1061236 Ga0207655_10612362 268
527 3300025728 Ga0207655_1123231 Ga0207655_11232311 268
528 3300025735 Ga0207713_1000031 Ga0207713_1000031170 268
529 3300025735 Ga0207713_1000759 Ga0207713_10007593 268
530 3300025735 Ga0207713_1001119 Ga0207713_10011195 268
531 3300025735 Ga0207713_1001550 Ga0207713_100155014 268
532 3300025735 Ga0207713_1001809 Ga0207713_10018096 268
533 3300025735 Ga0207713_1001942 Ga0207713_10019425 268
534 3300025735 Ga0207713_1002040 Ga0207713_10020406 268
535 3300025735 Ga0207713_1003833 Ga0207713_10038335 268
536 3300025735 Ga0207713_1004233 Ga0207713_10042337 268
537 3300025735 Ga0207713_1005577 Ga0207713_10055775 268
538 3300025735 Ga0207713_1006802 Ga0207713_10068024 268
539 3300025735 Ga0207713_1008147 Ga0207713_10081473 268
540 3300025735 Ga0207713_1024439 Ga0207713_10244392 268
541 3300025735 Ga0207713_1024754 Ga0207713_10247542 268
542 3300025735 Ga0207713_1034429 Ga0207713_10344292 268
543 3300025735 Ga0207713_1034499 Ga0207713_10344993 268
544 3300025735 Ga0207713_1104116 Ga0207713_11041162 268
545 3300025914 Ga0207671_10000015 Ga0207671_10000015296 268
546 3300025920 Ga0207649_10000001 Ga0207649_10000001191 268
547 3300025923 Ga0207681_10000480 Ga0207681_1000048014 268
548 3300025925 Ga0207650_10000868 Ga0207650_1000086814 268
549 3300025925 Ga0207650_10001058 Ga0207650_100010585 268
550 3300025929 Ga0207664_10210444 Ga0207664_102104441 268
551 3300025933 Ga0207706_10000624 Ga0207706_100006246 268
552 3300025933 Ga0207706_10006689 Ga0207706_100066895 268
553 3300025933 Ga0207706_10355067 Ga0207706_103550671 268
554 3300025934 Ga0207686_10001543 Ga0207686_100015436 268
555 3300025935 Ga0207709_10000022 Ga0207709_10000022228 268
556 3300025935 Ga0207709_10000578 Ga0207709_100005785 268
557 3300025935 Ga0207709_10000971 Ga0207709_1000097112 268
558 3300025935 Ga0207709_10006325 Ga0207709_100063255 268
559 3300025935 Ga0207709_10009944 Ga0207709_100099443 268
560 3300025935 Ga0207709_10017283 Ga0207709_100172833 268
561 3300025935 Ga0207709_10177570 Ga0207709_101775702 268
562 3300025945 Ga0207679_10000011 Ga0207679_10000011191 268
563 3300025945 Ga0207679_10056642 Ga0207679_100566422 268
564 3300026041 Ga0207639_10000706 Ga0207639_100007064 268
565 3300027111 Ga0209281_1000026 Ga0209281_1000026337 268
566 3300027111 Ga0209281_1000033 Ga0209281_1000033189 268
567 3300027111 Ga0209281_1004548 Ga0209281_10045483 268
568 3300027296 Ga0209389_1000095 Ga0209389_100009519 268
569 3300027296 Ga0209389_1093364 Ga0209389_10933642 268
570 3300027312 Ga0209371_1000217 Ga0209371_10002176 268
571 3300027312 Ga0209371_1014099 Ga0209371_10140992 268
572 3300027471 Ga0209995_1012455 Ga0209995_10124551 268
573 3300027665 Ga0209983_1012794 Ga0209983_10127942 268
574 3300027876 Ga0209974_10027040 Ga0209974_100270402 268
575 3300027907 Ga0207428_10018345 Ga0207428_100183451 268
576 3300027907 Ga0207428_10084951 Ga0207428_100849512 268
577 3300027907 Ga0207428_10107357 Ga0207428_101073572 268
578 3300027907 Ga0207428_10110397 Ga0207428_101103972 268
579 3300028379 Ga0268266_10007054 Ga0268266_100070544 268
580 3300028379 Ga0268266_10223110 Ga0268266_102231102 268
581 3300028379 Ga0268266_10359174 Ga0268266_103591742 268
582 3300028786 Ga0307517_10046926 Ga0307517_100469264 268
583 3300030500 Ga0268256_1000173 Ga0268256_100017362 268
584 3300030500 Ga0268256_1015628 Ga0268256_10156282 268
585 3300030731 Ga0316177_1136448 Ga0316177_11364482 268
586 3300030733 Ga0314311_1115640 Ga0314311_11156402 268
587 3300030734 Ga0316179_1116990 Ga0316179_11169904 268
588 3300030735 Ga0316178_1078135 Ga0316178_10781358 268
589 3300030742 Ga0316183_1053680 Ga0316183_10536805 268
590 3300030744 Ga0316181_1247226 Ga0316181_12472263 268
591 3300031344 Ga0265316_10053330 Ga0265316_100533303 268
592 3300031548 Ga0307408_100000002 Ga0307408_100000002185 268
593 3300031548 Ga0307408_100013668 Ga0307408_1000136682 268
594 3300031548 Ga0307408_100032095 Ga0307408_1000320954 268
595 3300031548 Ga0307408_100129270 Ga0307408_1001292702 268
596 3300031548 Ga0307408_100241922 Ga0307408_1002419222 268
597 3300031712 Ga0265342_10095268 Ga0265342_100952682 268
598 3300031731 Ga0307405_10000474 Ga0307405_100004744 268
599 3300031731 Ga0307405_10009426 Ga0307405_100094265 268
600 3300031731 Ga0307405_10013191 Ga0307405_100131912 268
601 3300031731 Ga0307405_10065543 Ga0307405_100655432 268
602 3300031824 Ga0307413_10052144 Ga0307413_100521443 268
603 3300031824 Ga0307413_10564500 Ga0307413_105645002 268
604 3300031901 Ga0307406_10357606 Ga0307406_103576062 268
605 3300031901 Ga0307406_10417033 Ga0307406_104170332 268
606 3300031903 Ga0307407_10038970 Ga0307407_100389702 268
607 3300031911 Ga0307412_10006654 Ga0307412_100066546 268
608 3300031911 Ga0307412_10012666 Ga0307412_100126665 268
609 3300031911 Ga0307412_10014146 Ga0307412_100141463 268
610 3300031911 Ga0307412_10016071 Ga0307412_100160714 268
611 3300031911 Ga0307412_10108365 Ga0307412_101083652 268
612 3300031911 Ga0307412_10202814 Ga0307412_102028142 268
613 3300031911 Ga0307412_10474972 Ga0307412_104749722 268
614 3300031995 Ga0307409_100015570 Ga0307409_1000155702 268
615 3300031995 Ga0307409_100017296 Ga0307409_1000172964 268
616 3300032002 Ga0307416_100070455 Ga0307416_1000704551 268
617 3300032002 Ga0307416_100456033 Ga0307416_1004560331 268
618 3300032002 Ga0307416_100941339 Ga0307416_1009413392 268
619 3300032004 Ga0307414_10002568 Ga0307414_100025687 268
620 3300032004 Ga0307414_10015030 Ga0307414_100150302 268
621 3300032004 Ga0307414_10054038 Ga0307414_100540384 268
622 3300032004 Ga0307414_10064819 Ga0307414_100648192 268
623 3300032005 Ga0307411_10010536 Ga0307411_100105362 268
624 3300032005 Ga0307411_10036524 Ga0307411_100365242 268
625 3300033180 Ga0307510_10003578 Ga0307510_1000357811 268
626 3300038705 Ga0237819_01318 Ga0237819_01318_5759_6565 268
627 3300039450 Ga0436363_0281375 Ga0436363_0281375_1607_2446 268
628 3300041404 Ga0439436_0012268 Ga0439436_0012268_151_966 268
629 3300041405 Ga0439438_000621 Ga0439438_000621_5560_6366 268
630 3300041405 Ga0439438_001072 Ga0439438_001072_4532_5338 268
631 3300041405 Ga0439438_001956 Ga0439438_001956_1605_2411 268
632 3300041405 Ga0439438_003204 Ga0439438_003204_1841_2656 268
633 3300041405 Ga0439438_005713 Ga0439438_005713_3655_4461 268
634 3300041405 Ga0439438_006379 Ga0439438_006379_3351_4157 268
635 3300041405 Ga0439438_006390 Ga0439438_006390_18_824 268
636 3300041405 Ga0439438_011071 Ga0439438_011071_594_1400 268
637 3300041405 Ga0439438_044002 Ga0439438_044002_17_823 268
638 3300041407 Ga0439447_000763 Ga0439447_000763_8096_8911 268
639 3300041407 Ga0439447_003053 Ga0439447_003053_3653_4459 268
640 3300041407 Ga0439447_004183 Ga0439447_004183_3892_4698 268
641 3300041407 Ga0439447_004452 Ga0439447_004452_3686_4492 268
642 3300041407 Ga0439447_054544 Ga0439447_054544_57_863 268
643 3300041411 Ga0439466_0001219 Ga0439466_0001219_2300_3106 268
644 3300041411 Ga0439466_0001604 Ga0439466_0001604_4734_5549 268
645 3300041411 Ga0439466_0002254 Ga0439466_0002254_3366_4172 268
646 3300041411 Ga0439466_0003680 Ga0439466_0003680_1187_1993 268
647 3300041411 Ga0439466_0012145 Ga0439466_0012145_1639_2472 268
648 3300041411 Ga0439466_0013185 Ga0439466_0013185_2022_2828 268
649 3300041411 Ga0439466_0013468 Ga0439466_0013468_1728_2534 268
650 3300041411 Ga0439466_0014147 Ga0439466_0014147_611_1417 268
651 3300041411 Ga0439466_0023139 Ga0439466_0023139_1194_2000 268
652 3300041411 Ga0439466_0029925 Ga0439466_0029925_984_1790 268
653 3300042006 Ga0439432_000649 Ga0439432_000649_5741_6547 268
654 3300042006 Ga0439432_001572 Ga0439432_001572_617_1423 268
655 3300042006 Ga0439432_001927 Ga0439432_001927_3750_4556 268
656 3300042006 Ga0439432_002096 Ga0439432_002096_1665_2480 268
657 3300042006 Ga0439432_004987 Ga0439432_004987_3716_4522 268
658 3300042006 Ga0439432_018571 Ga0439432_018571_56_862 268
659 3300042009 Ga0439451_002023 Ga0439451_002023_2781_3587 268
660 3300042009 Ga0439451_004014 Ga0439451_004014_1421_2227 268
661 3300042009 Ga0439451_004974 Ga0439451_004974_716_1522 268
662 3300042010 Ga0439452_002398 Ga0439452_002398_1952_2758 268
663 3300042010 Ga0439452_003343 Ga0439452_003343_4262_5068 268
664 3300042010 Ga0439452_006422 Ga0439452_006422_1807_2613 268
665 3300042010 Ga0439452_006430 Ga0439452_006430_93_899 268
666 3300042010 Ga0439452_014092 Ga0439452_014092_1088_1894 268
667 3300042012 Ga0439455_0019459 Ga0439455_0019459_591_1406 268
668 3300042013 Ga0439456_001110 Ga0439456_001110_3868_4674 268
669 3300042016 Ga0439463_000057 Ga0439463_000057_13050_13856 268
670 3300042016 Ga0439463_001908 Ga0439463_001908_3624_4430 268
671 3300042016 Ga0439463_006113 Ga0439463_006113_2125_2931 268
672 3300042115 Ga0450911_000012 Ga0450911_000012_96376_97191 268
673 3300042115 Ga0450911_000192 Ga0450911_000192_602_1408 268
674 3300042115 Ga0450911_001957 Ga0450911_001957_721_1527 268
675 3300042125 Ga0450923_006474 Ga0450923_006474_180_995 268
676 3300042127 Ga0450890_000220 Ga0450890_000220_3775_4581 268
677 3300042136 Ga0450900_000138 Ga0450900_000138_2991_3797 268
678 3300042137 Ga0450902_000850 Ga0450902_000850_2154_2960 268
679 3300042137 Ga0450902_014050 Ga0450902_014050_353_1159 268
680 3300042137 Ga0450902_015131 Ga0450902_015131_424_1230 268
681 3300042138 Ga0450903_004454 Ga0450903_004454_1122_1928 268
682 3300042139 Ga0450904_000331 Ga0450904_000331_6564_7379 268
683 3300042139 Ga0450904_003722 Ga0450904_003722_306_1112 268
684 3300042142 Ga0450905_000034 Ga0450905_000034_10203_11009 268
685 3300042144 Ga0450889_009463 Ga0450889_009463_159_974 268
686 3300042145 Ga0450906_002807 Ga0450906_002807_1487_2293 268
687 3300042146 Ga0450907_000627 Ga0450907_000627_3930_4736 268
688 3300042146 Ga0450907_000768 Ga0450907_000768_1860_2666 268
689 3300042147 Ga0450910_001269 Ga0450910_001269_1444_2250 268
690 3300042156 Ga0439446_0002361 Ga0439446_0002361_3404_4210 268
691 3300042156 Ga0439446_0009053 Ga0439446_0009053_1663_2478 268
692 3300042184 Ga0450908_007196 Ga0450908_007196_1127_1933 268
693 3300042184 Ga0450908_008314 Ga0450908_008314_991_1797 268
694 3300042185 Ga0450909_002673 Ga0450909_002673_221_1027 268
695 3300042435 Ga0439434_0002067 Ga0439434_0002067_1157_1972 268
696 3300042435 Ga0439434_0002931 Ga0439434_0002931_4114_4920 268
697 3300042439 Ga0439464_0000082 Ga0439464_0000082_9677_10483 268
698 3300042439 Ga0439464_0001991 Ga0439464_0001991_3728_4534 268
699 3300042439 Ga0439464_0035080 Ga0439464_0035080_141_947 268
700 3300042461 Ga0439460_0002166 Ga0439460_0002166_2361_3167 268
701 3300042461 Ga0439460_0002435 Ga0439460_0002435_2910_3716 268
702 3300042461 Ga0439460_0030234 Ga0439460_0030234_204_1010 268
703 3300042531 Ga0450918_001781 Ga0450918_001781_421_1227 268
704 3300042533 Ga0450901_000124 Ga0450901_000124_6876_7682 268
705 3300042993 Ga0439440_0000861 Ga0439440_0000861_1117_1923 268
706 3300042993 Ga0439440_0004862 Ga0439440_0004862_1375_2181 268
707 3300045051 Ga0451576_0490605 Ga0451576_0490605_358_1182 268
708 3300046452 Ga0495617_000900 Ga0495617_000900_12737_13543 268
709 3300046452 Ga0495617_001444 Ga0495617_001444_5717_6523 268
710 3300046452 Ga0495617_046413 Ga0495617_046413_250_1056 268
711 3300046453 Ga0495627_000529 Ga0495627_000529_24085_24891 268
712 3300046453 Ga0495627_000662 Ga0495627_000662_9940_10746 268
713 3300046453 Ga0495627_000811 Ga0495627_000811_6991_7797 268
714 3300046453 Ga0495627_003516 Ga0495627_003516_3537_4343 268
715 3300046453 Ga0495627_007132 Ga0495627_007132_1454_2260 268
716 3300046453 Ga0495627_038585 Ga0495627_038585_20_826 268
717 3300046455 Ga0495603_0037506 Ga0495603_0037506_509_1315 268
718 3300046457 Ga0495590_0002060 Ga0495590_0002060_4551_5357 268
719 3300046457 Ga0495590_0015849 Ga0495590_0015849_110_916 268
720 3300046458 Ga0495591_000417 Ga0495591_000417_31313_32119 268
721 3300046458 Ga0495591_000692 Ga0495591_000692_16943_17749 268
722 3300046458 Ga0495591_002059 Ga0495591_002059_6771_7577 268
723 3300046458 Ga0495591_004076 Ga0495591_004076_296_1102 268
724 3300046458 Ga0495591_004675 Ga0495591_004675_5676_6482 268
725 3300046458 Ga0495591_005356 Ga0495591_005356_1779_2585 268
726 3300046458 Ga0495591_006073 Ga0495591_006073_875_1681 268
727 3300046458 Ga0495591_006221 Ga0495591_006221_410_1216 268
728 3300046458 Ga0495591_007818 Ga0495591_007818_870_1676 268
729 3300046458 Ga0495591_008359 Ga0495591_008359_34_840 268
730 3300046458 Ga0495591_028006 Ga0495591_028006_126_932 268
731 3300046459 Ga0495629_0021447 Ga0495629_0021447_3454_4260 268
732 3300046460 Ga0495638_0006393 Ga0495638_0006393_4038_4844 268
733 3300046460 Ga0495638_0019097 Ga0495638_0019097_3660_4466 268
734 3300046460 Ga0495638_0029363 Ga0495638_0029363_2317_3123 268
735 3300046460 Ga0495638_0062755 Ga0495638_0062755_514_1320 268
736 3300046460 Ga0495638_0066091 Ga0495638_0066091_1383_2189 268
737 3300046460 Ga0495638_0124315 Ga0495638_0124315_261_1067 268
738 3300046460 Ga0495638_0165525 Ga0495638_0165525_361_1167 268
739 3300046463 Ga0495653_0008338 Ga0495653_0008338_5065_5871 268
740 3300046463 Ga0495653_0023867 Ga0495653_0023867_624_1430 268
741 3300046463 Ga0495653_0095792 Ga0495653_0095792_1109_1915 268
742 3300046471 Ga0495650_0008803 Ga0495650_0008803_1856_2662 268
743 3300046471 Ga0495650_0012860 Ga0495650_0012860_731_1537 268
744 3300046471 Ga0495650_0037161 Ga0495650_0037161_668_1474 268
745 3300046471 Ga0495650_0059434 Ga0495650_0059434_689_1495 268
746 3300046471 Ga0495650_0079877 Ga0495650_0079877_291_1097 268
747 3300046473 Ga0495582_0029428 Ga0495582_0029428_1647_2453 268
748 3300046474 Ga0495605_0000062 Ga0495605_0000062_65424_66230 268
749 3300046474 Ga0495605_0001077 Ga0495605_0001077_10600_11406 268
750 3300046474 Ga0495605_0001339 Ga0495605_0001339_9703_10509 268
751 3300046474 Ga0495605_0001776 Ga0495605_0001776_10074_10880 268
752 3300046474 Ga0495605_0006187 Ga0495605_0006187_3615_4421 268
753 3300046474 Ga0495605_0009458 Ga0495605_0009458_2358_3164 268
754 3300046474 Ga0495605_0018090 Ga0495605_0018090_572_1378 268
755 3300046474 Ga0495605_0120680 Ga0495605_0120680_256_1062 268
756 3300046474 Ga0495605_0129347 Ga0495605_0129347_178_984 268
757 3300046474 Ga0495605_0173483 Ga0495605_0173483_98_904 268
758 3300046475 Ga0495639_0001422 Ga0495639_0001422_5659_6465 268
759 3300046491 Ga0495584_0002039 Ga0495584_0002039_5637_6443 268
760 3300046491 Ga0495584_0002652 Ga0495584_0002652_3848_4654 268
761 3300046491 Ga0495584_0002719 Ga0495584_0002719_3568_4374 268
762 3300046491 Ga0495584_0005232 Ga0495584_0005232_5577_6383 268
763 3300046491 Ga0495584_0012017 Ga0495584_0012017_1655_2461 268
764 3300046492 Ga0495585_0002838 Ga0495585_0002838_6875_7681 268
765 3300046492 Ga0495585_0017841 Ga0495585_0017841_1567_2373 268
766 3300046492 Ga0495585_0102598 Ga0495585_0102598_384_1190 268
767 3300046499 Ga0495594_0001089 Ga0495594_0001089_12694_13500 268
768 3300046499 Ga0495594_0042261 Ga0495594_0042261_57_863 268
769 3300046501 Ga0495607_0000535 Ga0495607_0000535_29669_30475 268
770 3300046501 Ga0495607_0001879 Ga0495607_0001879_6814_7620 268
771 3300046501 Ga0495607_0002217 Ga0495607_0002217_3837_4643 268
772 3300046501 Ga0495607_0003116 Ga0495607_0003116_10138_10944 268
773 3300046501 Ga0495607_0003678 Ga0495607_0003678_3908_4714 268
774 3300046501 Ga0495607_0004041 Ga0495607_0004041_9493_10299 268
775 3300046501 Ga0495607_0005538 Ga0495607_0005538_3550_4356 268
776 3300046501 Ga0495607_0008397 Ga0495607_0008397_4189_4995 268
777 3300046501 Ga0495607_0016897 Ga0495607_0016897_683_1489 268
778 3300046501 Ga0495607_0089273 Ga0495607_0089273_570_1376 268
779 3300046501 Ga0495607_0101039 Ga0495607_0101039_312_1118 268
780 3300046501 Ga0495607_0118852 Ga0495607_0118852_437_1243 268
781 3300046501 Ga0495607_0149014 Ga0495607_0149014_115_921 268
782 3300046506 Ga0495583_0000015 Ga0495583_0000015_238735_239541 268
783 3300046506 Ga0495583_0000821 Ga0495583_0000821_30407_31213 268
784 3300046506 Ga0495583_0001917 Ga0495583_0001917_7412_8218 268
785 3300046506 Ga0495583_0002771 Ga0495583_0002771_9738_10544 268
786 3300046506 Ga0495583_0002903 Ga0495583_0002903_159_965 268
787 3300046506 Ga0495583_0003231 Ga0495583_0003231_10891_11697 268
788 3300046506 Ga0495583_0003968 Ga0495583_0003968_9633_10439 268
789 3300046506 Ga0495583_0006370 Ga0495583_0006370_6771_7577 268
790 3300046506 Ga0495583_0094592 Ga0495583_0094592_317_1123 268
791 3300046507 Ga0495606_0000214 Ga0495606_0000214_13648_14454 268
792 3300046507 Ga0495606_0000352 Ga0495606_0000352_3235_4041 268
793 3300046507 Ga0495606_0000892 Ga0495606_0000892_35408_36229 268
794 3300046507 Ga0495606_0008494 Ga0495606_0008494_2647_3453 268
795 3300046507 Ga0495606_0010283 Ga0495606_0010283_3754_4560 268
796 3300046507 Ga0495606_0017442 Ga0495606_0017442_3617_4423 268
797 3300046507 Ga0495606_0018966 Ga0495606_0018966_411_1217 268
798 3300046507 Ga0495606_0045423 Ga0495606_0045423_1655_2461 268
799 3300046507 Ga0495606_0105917 Ga0495606_0105917_168_974 268
800 3300046512 Ga0495610_0001409 Ga0495610_0001409_500_1306 268
801 3300046512 Ga0495610_0014812 Ga0495610_0014812_2795_3601 268
802 3300046512 Ga0495610_0057894 Ga0495610_0057894_770_1576 268
803 3300046512 Ga0495610_0066729 Ga0495610_0066729_735_1541 268
804 3300046513 Ga0495616_0002776 Ga0495616_0002776_926_1732 268
805 3300046513 Ga0495616_0004870 Ga0495616_0004870_5257_6063 268
806 3300046513 Ga0495616_0006934 Ga0495616_0006934_3079_3885 268
807 3300046513 Ga0495616_0007447 Ga0495616_0007447_5032_5838 268
808 3300046513 Ga0495616_0012671 Ga0495616_0012671_484_1290 268
809 3300046513 Ga0495616_0014475 Ga0495616_0014475_2952_3758 268
810 3300046513 Ga0495616_0088491 Ga0495616_0088491_371_1177 268
811 3300046515 Ga0495620_0000033 Ga0495620_0000033_108810_109616 268
812 3300046515 Ga0495620_0000050 Ga0495620_0000050_76854_77660 268
813 3300046515 Ga0495620_0001299 Ga0495620_0001299_8996_9802 268
814 3300046515 Ga0495620_0001883 Ga0495620_0001883_4763_5569 268
815 3300046515 Ga0495620_0001955 Ga0495620_0001955_1215_2021 268
816 3300046515 Ga0495620_0018478 Ga0495620_0018478_123_929 268
817 3300046515 Ga0495620_0034133 Ga0495620_0034133_751_1557 268
818 3300046517 Ga0495630_0015738 Ga0495630_0015738_1060_1866 268
819 3300046518 Ga0495631_0001124 Ga0495631_0001124_6874_7680 268
820 3300046518 Ga0495631_0002205 Ga0495631_0002205_5375_6181 268
821 3300046518 Ga0495631_0004919 Ga0495631_0004919_4148_4954 268
822 3300046518 Ga0495631_0037240 Ga0495631_0037240_847_1653 268
823 3300046519 Ga0495632_0000919 Ga0495632_0000919_24480_25286 268
824 3300046519 Ga0495632_0005948 Ga0495632_0005948_3769_4575 268
825 3300046519 Ga0495632_0008767 Ga0495632_0008767_5266_6072 268
826 3300046519 Ga0495632_0012508 Ga0495632_0012508_382_1188 268
827 3300046519 Ga0495632_0017772 Ga0495632_0017772_18_824 268
828 3300046519 Ga0495632_0031838 Ga0495632_0031838_801_1607 268
829 3300046519 Ga0495632_0066278 Ga0495632_0066278_760_1566 268
830 3300046519 Ga0495632_0079607 Ga0495632_0079607_22_828 268
831 3300046519 Ga0495632_0132364 Ga0495632_0132364_327_1133 268
832 3300046519 Ga0495632_0167143 Ga0495632_0167143_113_919 268
833 3300046520 Ga0495637_0000020 Ga0495637_0000020_45574_46380 268
834 3300046520 Ga0495637_0001280 Ga0495637_0001280_3364_4170 268
835 3300046520 Ga0495637_0001968 Ga0495637_0001968_3931_4737 268
836 3300046520 Ga0495637_0002004 Ga0495637_0002004_3918_4724 268
837 3300046520 Ga0495637_0006061 Ga0495637_0006061_3032_3838 268
838 3300046520 Ga0495637_0006923 Ga0495637_0006923_3875_4681 268
839 3300046520 Ga0495637_0014561 Ga0495637_0014561_400_1206 268
840 3300046520 Ga0495637_0014633 Ga0495637_0014633_2565_3371 268
841 3300046520 Ga0495637_0018213 Ga0495637_0018213_1852_2658 268
842 3300046520 Ga0495637_0019161 Ga0495637_0019161_452_1258 268
843 3300046520 Ga0495637_0041022 Ga0495637_0041022_1066_1872 268
844 3300046520 Ga0495637_0058463 Ga0495637_0058463_766_1572 268
845 3300046520 Ga0495637_0059719 Ga0495637_0059719_132_938 268
846 3300046520 Ga0495637_0084697 Ga0495637_0084697_70_876 268
847 3300046522 Ga0495643_0000320 Ga0495643_0000320_56779_57585 268
848 3300046522 Ga0495643_0001218 Ga0495643_0001218_6855_7661 268
849 3300046522 Ga0495643_0001318 Ga0495643_0001318_15261_16082 268
850 3300046522 Ga0495643_0002020 Ga0495643_0002020_9682_10503 268
851 3300046522 Ga0495643_0090811 Ga0495643_0090811_272_1078 268
852 3300046523 Ga0495644_0004800 Ga0495644_0004800_2351_3157 268
853 3300046523 Ga0495644_0005221 Ga0495644_0005221_3731_4537 268
854 3300046523 Ga0495644_0073001 Ga0495644_0073001_215_1021 268
855 3300046524 Ga0495648_0001594 Ga0495648_0001594_5980_6786 268
856 3300046524 Ga0495648_0003563 Ga0495648_0003563_9633_10439 268
857 3300046524 Ga0495648_0005817 Ga0495648_0005817_6788_7594 268
858 3300046524 Ga0495648_0011636 Ga0495648_0011636_658_1464 268
859 3300046524 Ga0495648_0016613 Ga0495648_0016613_3692_4498 268
860 3300046524 Ga0495648_0017390 Ga0495648_0017390_320_1126 268
861 3300046524 Ga0495648_0021864 Ga0495648_0021864_3575_4381 268
862 3300046524 Ga0495648_0024558 Ga0495648_0024558_1393_2199 268
863 3300046524 Ga0495648_0071572 Ga0495648_0071572_58_864 268
864 3300046524 Ga0495648_0083163 Ga0495648_0083163_597_1403 268
865 3300046526 Ga0495666_0017492 Ga0495666_0017492_2705_3511 268
866 3300046526 Ga0495666_0032216 Ga0495666_0032216_1143_1949 268
867 3300046528 Ga0495642_0001037 Ga0495642_0001037_6821_7627 268
868 3300046528 Ga0495642_0004922 Ga0495642_0004922_3440_4246 268
869 3300046530 Ga0495654_0001141 Ga0495654_0001141_6990_7796 268
870 3300046530 Ga0495654_0001487 Ga0495654_0001487_3600_4406 268
871 3300046530 Ga0495654_0003927 Ga0495654_0003927_4543_5349 268
872 3300046530 Ga0495654_0004238 Ga0495654_0004238_6317_7123 268
873 3300046530 Ga0495654_0004593 Ga0495654_0004593_4168_4974 268
874 3300046530 Ga0495654_0005161 Ga0495654_0005161_2094_2900 268
875 3300046530 Ga0495654_0009894 Ga0495654_0009894_3942_4748 268
876 3300046530 Ga0495654_0010887 Ga0495654_0010887_580_1386 268
877 3300046530 Ga0495654_0017900 Ga0495654_0017900_973_1779 268
878 3300046530 Ga0495654_0040169 Ga0495654_0040169_145_951 268
879 3300046530 Ga0495654_0053300 Ga0495654_0053300_344_1150 268
880 3300046530 Ga0495654_0053304 Ga0495654_0053304_817_1623 268
881 3300046530 Ga0495654_0064706 Ga0495654_0064706_271_1077 268
882 3300046536 Ga0495587_0046123 Ga0495587_0046123_205_1011 268
883 3300046538 Ga0495609_0000143 Ga0495609_0000143_66182_66988 268
884 3300046538 Ga0495609_0000372 Ga0495609_0000372_6870_7676 268
885 3300046538 Ga0495609_0000461 Ga0495609_0000461_6830_7636 268
886 3300046538 Ga0495609_0007912 Ga0495609_0007912_1740_2546 268
887 3300046538 Ga0495609_0009727 Ga0495609_0009727_3614_4420 268
888 3300046538 Ga0495609_0041131 Ga0495609_0041131_1174_1980 268
889 3300046542 Ga0495597_0001205 Ga0495597_0001205_761_1567 268
890 3300046542 Ga0495597_0001312 Ga0495597_0001312_7673_8479 268
891 3300046542 Ga0495597_0012872 Ga0495597_0012872_3028_3834 268
892 3300046542 Ga0495597_0020876 Ga0495597_0020876_2207_3013 268
893 3300046542 Ga0495597_0032407 Ga0495597_0032407_853_1659 268
894 3300046542 Ga0495597_0094475 Ga0495597_0094475_217_1023 268
895 3300046543 Ga0495645_0235516 Ga0495645_0235516_237_1043 268
896 3300046557 Ga0495622_0003131 Ga0495622_0003131_6872_7678 268
897 3300046557 Ga0495622_0003397 Ga0495622_0003397_1459_2265 268
898 3300046557 Ga0495622_0093076 Ga0495622_0093076_81_887 268
899 3300046558 Ga0495633_0000084 Ga0495633_0000084_47301_48107 268
900 3300046558 Ga0495633_0002008 Ga0495633_0002008_13192_13998 268
901 3300046615 Ga0495656_0013901 Ga0495656_0013901_901_1707 268
902 3300046616 Ga0495668_0013703 Ga0495668_0013703_124_930 268
903 3300046616 Ga0495668_0062086 Ga0495668_0062086_208_1014 268
904 3300046616 Ga0495668_0117973 Ga0495668_0117973_164_970 268
905 3300046642 Ga0495634_0016154 Ga0495634_0016154_398_1204 268
906 3300046642 Ga0495634_0077836 Ga0495634_0077836_1315_2121 268
907 3300046648 Ga0495611_0000246 Ga0495611_0000246_36053_36859 268
908 3300046648 Ga0495611_0000318 Ga0495611_0000318_30918_31724 268
909 3300046648 Ga0495611_0000910 Ga0495611_0000910_10249_11055 268
910 3300046648 Ga0495611_0008333 Ga0495611_0008333_392_1198 268
911 3300046660 Ga0495625_0000133 Ga0495625_0000133_36181_36987 268
912 3300046660 Ga0495625_0002266 Ga0495625_0002266_20008_20814 268
913 3300046660 Ga0495625_0016901 Ga0495625_0016901_387_1193 268
914 3300046663 Ga0495635_0003150 Ga0495635_0003150_4175_4981 268
915 3300046664 Ga0495659_0000898 Ga0495659_0000898_4125_4931 268
916 3300046665 Ga0495661_0000027 Ga0495661_0000027_132301_133107 268
917 3300046665 Ga0495661_0000065 Ga0495661_0000065_76873_77679 268
918 3300046665 Ga0495661_0000370 Ga0495661_0000370_7621_8427 268
919 3300046665 Ga0495661_0000542 Ga0495661_0000542_6870_7676 268
920 3300046665 Ga0495661_0002713 Ga0495661_0002713_6486_7292 268
921 3300046665 Ga0495661_0027979 Ga0495661_0027979_1485_2291 268
922 3300046665 Ga0495661_0149018 Ga0495661_0149018_119_925 268
923 3300046674 Ga0495588_0107371 Ga0495588_0107371_525_1331 268
924 3300046679 Ga0495623_0011845 Ga0495623_0011845_3289_4095 268
925 3300046679 Ga0495623_0014638 Ga0495623_0014638_367_1173 268
926 3300046680 Ga0495646_0042505 Ga0495646_0042505_1692_2498 268
927 3300046684 Ga0495669_0009945 Ga0495669_0009945_1567_2373 268
928 3300046689 Ga0495613_0012854 Ga0495613_0012854_2123_2929 268
929 3300046691 Ga0495670_0000196 Ga0495670_0000196_382_1188 268
930 3300046691 Ga0495670_0007919 Ga0495670_0007919_3695_4501 268
931 3300046691 Ga0495670_0008804 Ga0495670_0008804_444_1250 268
932 3300046691 Ga0495670_0023771 Ga0495670_0023771_1350_2156 268
933 3300046692 Ga0495671_0001993 Ga0495671_0001993_8113_8919 268
934 3300046692 Ga0495671_0005998 Ga0495671_0005998_5236_6042 268
935 3300046692 Ga0495671_0010036 Ga0495671_0010036_80_886 268
936 3300046692 Ga0495671_0011636 Ga0495671_0011636_794_1600 268
937 3300046692 Ga0495671_0019714 Ga0495671_0019714_1855_2661 268
938 3300046692 Ga0495671_0076149 Ga0495671_0076149_200_1006 268
939 3300046692 Ga0495671_0094070 Ga0495671_0094070_640_1446 268
940 3300046692 Ga0495671_0110951 Ga0495671_0110951_339_1145 268
941 3300046692 Ga0495671_0110977 Ga0495671_0110977_240_1046 268
942 3300046694 Ga0495649_0001378 Ga0495649_0001378_837_1643 268
943 3300046694 Ga0495649_0001797 Ga0495649_0001797_9536_10357 268
944 3300046694 Ga0495649_0005095 Ga0495649_0005095_6878_7684 268
945 3300046694 Ga0495649_0005670 Ga0495649_0005670_3171_3977 268
946 3300046694 Ga0495649_0054487 Ga0495649_0054487_237_1058 268
947 3300046794 Ga0495589_0000779 Ga0495589_0000779_6713_7519 268
948 3300046794 Ga0495589_0001384 Ga0495589_0001384_6885_7691 268
949 3300046794 Ga0495589_0001986 Ga0495589_0001986_9778_10584 268
950 3300046794 Ga0495589_0005362 Ga0495589_0005362_2457_3263 268
951 3300046794 Ga0495589_0051631 Ga0495589_0051631_81_887 268
952 3300046794 Ga0495589_0082943 Ga0495589_0082943_26_832 268
953 3300046809 Ga0495600_0028678 Ga0495600_0028678_2281_3087 268
954 3300046809 Ga0495600_0092650 Ga0495600_0092650_216_1022 268
955 3300046810 Ga0495660_0000797 Ga0495660_0000797_19447_20253 268
956 3300046810 Ga0495660_0002243 Ga0495660_0002243_3987_4793 268
957 3300046810 Ga0495660_0002803 Ga0495660_0002803_3824_4630 268
958 3300046810 Ga0495660_0008873 Ga0495660_0008873_58_864 268
959 3300046810 Ga0495660_0010257 Ga0495660_0010257_99_905 268
960 3300046810 Ga0495660_0046539 Ga0495660_0046539_322_1128 268
961 3300046810 Ga0495660_0179948 Ga0495660_0179948_58_864 268
962 3300047317 Ga0495604_0046093 Ga0495604_0046093_653_1459 268
963 3300047318 Ga0495636_0005482 Ga0495636_0005482_355_1161 268
964 3300047318 Ga0495636_0026308 Ga0495636_0026308_663_1469 268
965 3300047319 Ga0495674_0026203 Ga0495674_0026203_4061_4867 268
966 3300047320 Ga0495672_0000763 Ga0495672_0000763_27376_28182 268
967 3300047320 Ga0495672_0006798 Ga0495672_0006798_4742_5548 268
968 3300047320 Ga0495672_0007247 Ga0495672_0007247_1883_2689 268
969 3300047320 Ga0495672_0016835 Ga0495672_0016835_3700_4506 268
970 3300047320 Ga0495672_0026376 Ga0495672_0026376_2147_2953 268
971 3300047320 Ga0495672_0033865 Ga0495672_0033865_694_1500 268
972 3300047320 Ga0495672_0036556 Ga0495672_0036556_1359_2165 268
973 3300047320 Ga0495672_0038784 Ga0495672_0038784_2075_2881 268
974 3300047320 Ga0495672_0051139 Ga0495672_0051139_866_1672 268
975 3300047320 Ga0495672_0088989 Ga0495672_0088989_378_1184 268
976 3300047320 Ga0495672_0162519 Ga0495672_0162519_134_940 268
977 3300047320 Ga0495672_0192815 Ga0495672_0192815_160_966 268
978 3300047321 Ga0495676_0000181 Ga0495676_0000181_37879_38685 268
979 3300047321 Ga0495676_0027747 Ga0495676_0027747_428_1234 268
980 3300047321 Ga0495676_0106745 Ga0495676_0106745_522_1328 268
981 3300047322 Ga0495680_0019387 Ga0495680_0019387_2228_3034 268
982 3300047322 Ga0495680_0023975 Ga0495680_0023975_367_1173 268
983 3300047322 Ga0495680_0029539 Ga0495680_0029539_840_1646 268
984 3300047322 Ga0495680_0133411 Ga0495680_0133411_616_1422 268
985 3300047323 Ga0495683_0000044 Ga0495683_0000044_95091_95897 268
986 3300047323 Ga0495683_0000109 Ga0495683_0000109_6815_7621 268
987 3300047323 Ga0495683_0011206 Ga0495683_0011206_197_1003 268
988 3300047323 Ga0495683_0014543 Ga0495683_0014543_1558_2364 268
989 3300047323 Ga0495683_0028365 Ga0495683_0028365_329_1135 268
990 3300047443 Ga0495687_002205 Ga0495687_002205_75_881 268
991 3300047443 Ga0495687_011346 Ga0495687_011346_3236_4042 268
992 3300047443 Ga0495687_011390 Ga0495687_011390_342_1148 268
993 3300047444 Ga0495675_0022378 Ga0495675_0022378_2708_3514 268
994 3300047444 Ga0495675_0023506 Ga0495675_0023506_3006_3812 268
995 3300047444 Ga0495675_0069292 Ga0495675_0069292_219_1025 268
996 3300047445 Ga0495677_0007558 Ga0495677_0007558_218_1024 268
997 3300047446 Ga0495679_000132 Ga0495679_000132_29236_30042 268
998 3300047446 Ga0495679_001170 Ga0495679_001170_7816_8622 268
999 3300047446 Ga0495679_001404 Ga0495679_001404_37_843 268
1000 3300047447 Ga0495685_006140 Ga0495685_006140_2649_3455 268
1001 3300047469 Ga0495673_0001604 Ga0495673_0001604_6841_7647 268
1002 3300047469 Ga0495673_0002244 Ga0495673_0002244_9666_10472 268
1003 3300047469 Ga0495673_0002585 Ga0495673_0002585_4947_5753 268
1004 3300047469 Ga0495673_0002792 Ga0495673_0002792_6855_7661 268
1005 3300047469 Ga0495673_0002908 Ga0495673_0002908_1111_1917 268
1006 3300047469 Ga0495673_0003031 Ga0495673_0003031_6864_7670 268
1007 3300047469 Ga0495673_0007528 Ga0495673_0007528_4872_5678 268
1008 3300047469 Ga0495673_0010899 Ga0495673_0010899_2745_3551 268
1009 3300047469 Ga0495673_0012700 Ga0495673_0012700_937_1743 268
1010 3300047469 Ga0495673_0017586 Ga0495673_0017586_462_1268 268
1011 3300047469 Ga0495673_0030699 Ga0495673_0030699_137_943 268
1012 3300047469 Ga0495673_0037657 Ga0495673_0037657_1163_1969 268
1013 3300047469 Ga0495673_0127127 Ga0495673_0127127_82_888 268
1014 3300047470 Ga0495681_0000608 Ga0495681_0000608_690_1496 268
1015 3300047470 Ga0495681_0001925 Ga0495681_0001925_4212_5018 268
1016 3300047470 Ga0495681_0004457 Ga0495681_0004457_4023_4829 268
1017 3300047470 Ga0495681_0005164 Ga0495681_0005164_5519_6325 268
1018 3300047470 Ga0495681_0006396 Ga0495681_0006396_3787_4593 268
1019 3300047470 Ga0495681_0009549 Ga0495681_0009549_2742_3548 268
1020 3300047470 Ga0495681_0010826 Ga0495681_0010826_1521_2327 268
1021 3300047470 Ga0495681_0013946 Ga0495681_0013946_781_1587 268
1022 3300047470 Ga0495681_0024547 Ga0495681_0024547_2319_3125 268
1023 3300047470 Ga0495681_0035166 Ga0495681_0035166_951_1757 268
1024 3300047472 Ga0495686_0042794 Ga0495686_0042794_925_1731 268
1025 3300048091 Ga0495626_0000218 Ga0495626_0000218_31375_32181 268
1026 3300048091 Ga0495626_0002818 Ga0495626_0002818_6765_7571 268
1027 3300048091 Ga0495626_0002988 Ga0495626_0002988_6775_7581 268
1028 3300048091 Ga0495626_0003946 Ga0495626_0003946_1030_1836 268
1029 3300048091 Ga0495626_0004767 Ga0495626_0004767_3197_4003 268
1030 3300048091 Ga0495626_0006156 Ga0495626_0006156_5491_6297 268
1031 3300048091 Ga0495626_0007349 Ga0495626_0007349_5276_6082 268
1032 3300048091 Ga0495626_0008938 Ga0495626_0008938_4549_5355 268
1033 3300048905 Ga0496102_0022878 Ga0496102_0022878_4295_5101 268
1034 3300048905 Ga0496102_0134315 Ga0496102_0134315_1074_1880 268
1035 3300048906 Ga0496103_0014475 Ga0496103_0014475_3740_4546 268
1036 3300048914 Ga0496111_0072322 Ga0496111_0072322_805_1611 268
1037 3300048915 Ga0496112_0514685 Ga0496112_0514685_207_1013 268
1038 3300048917 Ga0496114_0037332 Ga0496114_0037332_637_1443 268
1039 3300048918 Ga0496115_0196029 Ga0496115_0196029_510_1316 268
1040 3300048919 Ga0496116_0000567 Ga0496116_0000567_41986_42792 268
1041 3300048919 Ga0496116_0000699 Ga0496116_0000699_36024_36830 268
1042 3300048919 Ga0496116_0005627 Ga0496116_0005627_4176_4982 268
1043 3300048919 Ga0496116_0018115 Ga0496116_0018115_3225_4031 268
1044 3300048919 Ga0496116_0021247 Ga0496116_0021247_3744_4550 268
1045 3300048920 Ga0496117_0000970 Ga0496117_0000970_9017_9823 268
1046 3300048920 Ga0496117_0003533 Ga0496117_0003533_644_1450 268
1047 3300048920 Ga0496117_0005390 Ga0496117_0005390_6486_7292 268
1048 3300048920 Ga0496117_0005662 Ga0496117_0005662_3289_4095 268
1049 3300048920 Ga0496117_0019503 Ga0496117_0019503_493_1299 268
1050 3300048920 Ga0496117_0140940 Ga0496117_0140940_327_1133 268
1051 3300048921 Ga0496118_0003741 Ga0496118_0003741_9762_10568 268
1052 3300048921 Ga0496118_0013161 Ga0496118_0013161_2915_3721 268
1053 3300048921 Ga0496118_0083435 Ga0496118_0083435_1100_1906 268
1054 3300048921 Ga0496118_0128436 Ga0496118_0128436_360_1166 268
1055 3300048921 Ga0496118_0145131 Ga0496118_0145131_358_1164 268
1056 3300048922 Ga0496119_0000071 Ga0496119_0000071_98885_99691 268
1057 3300048923 Ga0496120_0001138 Ga0496120_0001138_30199_31005 268
1058 3300048923 Ga0496120_0010521 Ga0496120_0010521_175_981 268
1059 3300048924 Ga0496121_0001560 Ga0496121_0001560_29862_30668 268
1060 3300048924 Ga0496121_0001800 Ga0496121_0001800_6709_7515 268
1061 3300048924 Ga0496121_0002238 Ga0496121_0002238_11942_12748 268
1062 3300048924 Ga0496121_0017913 Ga0496121_0017913_1648_2454 268
1063 3300048924 Ga0496121_0145800 Ga0496121_0145800_504_1310 268
1064 3300048924 Ga0496121_0179755 Ga0496121_0179755_22_828 268
1065 3300048924 Ga0496121_0195128 Ga0496121_0195128_568_1374 268
1066 3300048925 Ga0496122_0001196 Ga0496122_0001196_32302_33108 268
1067 3300048925 Ga0496122_0002157 Ga0496122_0002157_5452_6258 268
1068 3300048925 Ga0496122_0010986 Ga0496122_0010986_4037_4843 268
1069 3300048925 Ga0496122_0013092 Ga0496122_0013092_2998_3804 268
1070 3300048925 Ga0496122_0099867 Ga0496122_0099867_360_1166 268
1071 3300048925 Ga0496122_0179970 Ga0496122_0179970_99_905 268
1072 3300048926 Ga0496123_0000594 Ga0496123_0000594_49789_50595 268
1073 3300048926 Ga0496123_0001464 Ga0496123_0001464_9380_10186 268
1074 3300048926 Ga0496123_0010203 Ga0496123_0010203_3941_4747 268
1075 3300048926 Ga0496123_0014657 Ga0496123_0014657_5299_6105 268
1076 3300048926 Ga0496123_0052115 Ga0496123_0052115_691_1497 268
1077 3300048926 Ga0496123_0139600 Ga0496123_0139600_54_860 268
1078 3300048927 Ga0496124_0001266 Ga0496124_0001266_6864_7670 268
1079 3300048927 Ga0496124_0007109 Ga0496124_0007109_2587_3393 268
1080 3300048927 Ga0496124_0011281 Ga0496124_0011281_7073_7879 268
1081 3300048927 Ga0496124_0013081 Ga0496124_0013081_6865_7671 268
1082 3300048927 Ga0496124_0015327 Ga0496124_0015327_6176_6982 268
1083 3300048927 Ga0496124_0054961 Ga0496124_0054961_2465_3271 268
1084 3300048927 Ga0496124_0058314 Ga0496124_0058314_1775_2581 268
1085 3300048927 Ga0496124_0066815 Ga0496124_0066815_97_903 268
1086 3300048928 Ga0496125_0003386 Ga0496125_0003386_1096_1902 268
1087 3300048928 Ga0496125_0005700 Ga0496125_0005700_6473_7279 268
1088 3300048928 Ga0496125_0006235 Ga0496125_0006235_6384_7190 268
1089 3300048928 Ga0496125_0015371 Ga0496125_0015371_1127_1933 268
1090 3300048928 Ga0496125_0016542 Ga0496125_0016542_376_1182 268
1091 3300048928 Ga0496125_0041345 Ga0496125_0041345_337_1143 268
1092 3300048928 Ga0496125_0113390 Ga0496125_0113390_503_1309 268
1093 3300048929 Ga0496126_0017913 Ga0496126_0017913_6196_7002 268
1094 3300048929 Ga0496126_0033815 Ga0496126_0033815_3095_3901 268
1095 3300048929 Ga0496126_0045794 Ga0496126_0045794_1004_1810 268
1096 3300048929 Ga0496126_0072120 Ga0496126_0072120_2027_2833 268
1097 3300048929 Ga0496126_0234549 Ga0496126_0234549_34_840 268
1098 3300049459 Ga0495678_000017 Ga0495678_000017_204915_205721 268
1099 3300049459 Ga0495678_002786 Ga0495678_002786_6982_7788 268
1100 3300049459 Ga0495678_004463 Ga0495678_004463_3458_4264 268
1101 3300049459 Ga0495678_004822 Ga0495678_004822_6845_7651 268
1102 3300049459 Ga0495678_007223 Ga0495678_007223_433_1239 268
1103 3300049459 Ga0495678_008310 Ga0495678_008310_3791_4597 268
1104 3300049459 Ga0495678_010219 Ga0495678_010219_47_853 268
1105 3300049459 Ga0495678_022736 Ga0495678_022736_1579_2385 268
1106 3300049459 Ga0495678_051856 Ga0495678_051856_368_1174 268
1107 3300049460 Ga0495682_0000235 Ga0495682_0000235_35908_36714 268
1108 3300049460 Ga0495682_0000375 Ga0495682_0000375_10047_10853 268
1109 3300049460 Ga0495682_0021362 Ga0495682_0021362_172_978 268
1110 3300049460 Ga0495682_0137032 Ga0495682_0137032_11_817 268
1111 3300049568 Ga0501031_0192610 Ga0501031_0192610_469_1275 268
1112 3300049569 Ga0501032_0093399 Ga0501032_0093399_78_893 268
1113 3300049571 Ga0501034_0000165 Ga0501034_0000165_15827_16633 268
1114 3300049573 Ga0501037_0032342 Ga0501037_0032342_2181_2996 268
1115 3300049575 Ga0501039_0149389 Ga0501039_0149389_112_927 268
1116 3300049758 Ga0501241_000551 Ga0501241_000551_3403_4209 268
1117 3300049853 Ga0501226_000002 Ga0501226_000002_315863_316678 268
1118 3300049853 Ga0501226_001319 Ga0501226_001319_124_930 268
1119 3300053125 Ga0500618_001805 Ga0500618_001805_7773_8579 268
1120 3300053140 Ga0500573_0179976 Ga0500573_0179976_234_1040 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06293

Kdo

Lipopolysaccharide kinase (Kdo/WaaP) family

20

218

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dfl-assembly1.cif.gz_A waap in complex with acyl carrier protein 0.9661 1 256
6dfl-assembly1.cif.gz_A waap in complex with acyl carrier protein 0.9582 1 256
7szb-assembly2.cif.gz_C crystal structure analysis of human prpk complex with a compound 0.7364 20 231
7sza-assembly2.cif.gz_C crystal structure analysis of human prpk complex with a compound 0.7047 9 231
3umx-assembly1.cif.gz_A crystal structure of pim1 kinase in complex with inhibitor (z)-2-[(1h-indol-3-yl)methylene]-7-(azepan-1-ylmethyl)-6-hydroxybenzofuran-3(2h)-one 0.6993 27 192
ID Description Score Start End Superfamily
af_P25741_19_230_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.9454 21 229 1.10.510.10
af_P25741_19_230_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.9281 21 229 1.10.510.10
1lwjB03 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.7767 28 53 2.60.40.1180
af_A4I0J0_34_185_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.739 29 58 2.40.128.110
4aefB04 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.7224 25 55 2.60.40.1180
ID Description Score Start End GO Terms
AF-A0A2D6J7S4-F1-model_v4 deleted 0.9872 118 264
AF-A4VR68-F1-model_v4 Lipopolysaccharide core biosynthesis protein WaaP 0.9751 2 264 GO:0009103
GO:0016301
AF-A0A1G8PDH5-F1-model_v4 Heptose I phosphotransferase 0.9739 2 265 GO:0009103
GO:0016301
AF-A0A6Y3K5W5-F1-model_v4 Lipopolysaccharide core heptose(I) kinase RfaP (EC 2.7.1.-) 0.9636 2 241 GO:0009103
GO:0016301
AF-A0A1G8PDH5-F1-model_v4 Heptose I phosphotransferase 0.9631 2 265 GO:0009103
GO:0016301

Feature Viewer

pLDDT pTM Quality
91.74 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map