F490005

General Info

Members Datasets Scaffolds Average Seq Length
1097 825 523 239

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0152345|Ga0496110_0152345_499_1311
Length 270
Sequence MAARTLAPRGERHRRRFETAMTKPPVGINRTGRKLGQKVKKGKLKASSRRWLERHINDPYVQRAKLEGYRARAAFKLLEIDEKHQILKGAKRIIDLGAAPGSWSQIAAKVTNSTDQDPRVAAIDFLEVDPLPGVKILQLDFLDDEAPALLMEAIGGVPNLVLSDMAAPTTGHHRTDHLRTMHLCEVAAHFAIEVLAEGGHFLAKTFQGGTEKDLLDLLKKNFKQVIHVKPASSRQESVEMFLLAKHFKGRRAVEADGETTEAEPVTEAED

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
15 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
16 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
17 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
18 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
19 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
20 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
21 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
22 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
23 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
24 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
25 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
26 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
27 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
28 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
29 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
30 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
31 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
32 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
33 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
34 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
35 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
36 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
37 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
38 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
39 2516143018 Ensifer sp. BR816 Isolate Nodule
40 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
41 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
42 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
43 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
44 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
45 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
46 2519899620 Rhizobium sp. Pop5 Isolate Nodule
47 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
48 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
49 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
50 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
51 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
52 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
53 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
54 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
55 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
56 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
57 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
58 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
59 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
60 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
61 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
62 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
63 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
64 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
65 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
66 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
67 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
68 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
69 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
70 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
71 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
72 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
73 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
74 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
75 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
76 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
77 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
78 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
79 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
80 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
81 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
82 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
83 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
84 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
85 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
86 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
87 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
88 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
89 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
90 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
91 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
92 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
93 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
94 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
95 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
96 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
97 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
98 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
99 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
100 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
101 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
102 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
103 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
104 2643221557 Ensifer sp. Root558 Isolate Unclassified
105 2643221558 Rhizobium sp. Root149 Isolate Unclassified
106 2643221568 Rhizobium sp. Root564 Isolate Unclassified
107 2643221582 Rhizobium sp. Root651 Isolate Unclassified
108 2643221599 Rhizobium sp. Root708 Isolate Unclassified
109 2643221607 Rhizobium sp. Root73 Isolate Unclassified
110 2643221610 Ensifer sp. Root74 Isolate Unclassified
111 2643221618 Ensifer sp. Root231 Isolate Unclassified
112 2643221626 Ensifer sp. Root31 Isolate Unclassified
113 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
114 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
115 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
116 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
117 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
118 2643221655 Ensifer sp. Root1252 Isolate Unclassified
119 2643221659 Ensifer sp. Root127 Isolate Unclassified
120 2643221668 Ensifer sp. Root423 Isolate Unclassified
121 2643221675 Ensifer sp. Root1298 Isolate Unclassified
122 2643221680 Ensifer sp. Root1312 Isolate Unclassified
123 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
124 2643221688 Rhizobium sp. Root482 Isolate Unclassified
125 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
126 2643221693 Rhizobium sp. Root491 Isolate Unclassified
127 2643221698 Ensifer sp. Root142 Isolate Unclassified
128 2643221712 Ensifer sp. Root258 Isolate Unclassified
129 2643221718 Rhizobium sp. Root268 Isolate Unclassified
130 2643221719 Rhizobium sp. Root274 Isolate Unclassified
131 2643221723 Ensifer sp. Root278 Isolate Unclassified
132 2643221726 Ensifer sp. Root954 Isolate Unclassified
133 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
134 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
135 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
136 2718217882 Rhizobium sp. N741 Isolate Nodule
137 2718217927 Rhizobium sp. N324 Isolate Nodule
138 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
139 2718218009 Rhizobium sp. N561 Isolate Nodule
140 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
141 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
142 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
143 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
144 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
145 2718218363 Rhizobium sp. N113 Isolate Nodule
146 2718218365 Rhizobium sp. N731 Isolate Nodule
147 2718218366 Rhizobium sp. N621 Isolate Nodule
148 2718218423 Rhizobium sp. N941 Isolate Nodule
149 2721755514 Rhizobium sp. N6212 Isolate Nodule
150 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
151 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
152 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
153 2721755809 Rhizobium sp. N541 Isolate Nodule
154 2721755810 Rhizobium sp. N871 Isolate Nodule
155 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
156 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
157 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
158 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
159 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
160 2728369365 Rhizobium sp. N1341 Isolate Nodule
161 2728369397 Rhizobium sp. N1314 Isolate Nodule
162 2738541293 Rhizobium sp. GV031 Isolate Unclassified
163 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
164 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
165 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
166 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
167 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
168 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
169 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
170 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
171 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
172 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
173 2791355256 Rhizobium sp. M10 Isolate Nodule
174 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
175 2791355260 Rhizobium sp. L9 Isolate Nodule
176 2791355261 Rhizobium sp. J15 Isolate Nodule
177 2791355262 Rhizobium sp. M1 Isolate Nodule
178 2791355263 Rhizobium chutanense C5 Isolate Nodule
179 2791355264 Rhizobium sp. S9 Isolate Nodule
180 2791355265 Rhizobium sp. H4 Isolate Nodule
181 2791355266 Rhizobium sp. L43 Isolate Nodule
182 2791355267 Rhizobium sp. L18 Isolate Nodule
183 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
184 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
185 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
186 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
187 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
188 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
189 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
190 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
191 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
192 2802429633 Rhizobium anhuiense J3 Isolate Nodule
193 2802429634 Rhizobium anhuiense S10 Isolate Nodule
194 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
195 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
196 2802429637 Rhizobium anhuiense C15 Isolate Nodule
197 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
198 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
199 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
200 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
201 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
202 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
203 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
204 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
205 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
206 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
207 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
208 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
209 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
210 2838048938 Rhizobium pisi 27/80 Isolate Nodule
211 2838061910 Rhizobium phaseoli L15 Isolate Nodule
212 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
213 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
214 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
215 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
216 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
217 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
218 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
219 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
220 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
221 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
222 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
223 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
224 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
225 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
226 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
227 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
228 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
229 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
230 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
231 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
232 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
233 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
234 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
235 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
236 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
237 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
238 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
239 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
240 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
241 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
242 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
243 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
244 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
245 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
246 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
247 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
248 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
249 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
250 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
251 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
252 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
253 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
254 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
255 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
256 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
257 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
258 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
259 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
260 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
261 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
262 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
263 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
264 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
265 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
266 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
267 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
268 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
269 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
270 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
271 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
272 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
273 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
274 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
275 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
276 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
277 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
278 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
279 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
280 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
281 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
282 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
283 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
284 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
285 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
286 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
287 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
288 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
289 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
290 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
291 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
292 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
293 2844163670 Ensifer sp. 1H6 Isolate Unclassified
294 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
295 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
296 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
297 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
298 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
299 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
300 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
301 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
302 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
303 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
304 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
305 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
306 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
307 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
308 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
309 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
310 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
311 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
312 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
313 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
314 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
315 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
316 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
317 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
318 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
319 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
320 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
321 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
322 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
323 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
324 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
325 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
326 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
327 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
328 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
329 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
330 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
331 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
332 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
333 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
334 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
335 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
336 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
337 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
338 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
339 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
340 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
341 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
342 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
343 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
344 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
345 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
346 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
347 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
348 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
349 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
350 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
351 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
352 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
353 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
354 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
355 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
356 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
357 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
358 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
359 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
360 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
361 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
362 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
363 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
364 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
365 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
366 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
367 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
368 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
369 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
370 2933599457 Rhizobium phaseoli M3 Isolate Nodule
371 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
372 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
373 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
374 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
375 2936381700 Rhizobium chutanense C16 Isolate Unclassified
376 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
377 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
378 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
379 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
380 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
381 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
382 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
383 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
384 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
385 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
386 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
387 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
388 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
389 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
390 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
391 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
392 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
393 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
394 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
395 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
396 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
397 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
398 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
399 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
400 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
401 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
402 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
403 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
404 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
405 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
406 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
407 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
408 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
409 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
410 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
411 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
412 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
413 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
414 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
415 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
416 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
417 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
418 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
419 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
420 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
421 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
422 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
423 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
424 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
425 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
426 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
427 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
428 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
429 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
430 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
431 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
432 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
433 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
434 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
435 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
436 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
437 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
438 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
439 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
440 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
441 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
442 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
443 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
444 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
445 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
446 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
447 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
448 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
449 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
450 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
451 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
452 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
453 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
454 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
455 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
456 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
457 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
458 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
459 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
460 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
461 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
462 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
463 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
464 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
465 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
466 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
467 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
468 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
469 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
470 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
471 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
472 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
473 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
474 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
475 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
476 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
477 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
478 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
479 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
480 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
481 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
482 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
483 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
484 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
485 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
486 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
487 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
488 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
489 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
490 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
491 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
492 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
493 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
494 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
495 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
496 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
497 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
498 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
499 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
500 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
501 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
502 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
503 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
504 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
505 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
506 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
507 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
508 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
509 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
510 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
511 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
512 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
513 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
514 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
515 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
516 2996887358 Rhizobium sp. R711 Isolate Nodule
517 2996893221 Rhizobium sp. R635 Isolate Nodule
518 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
519 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
520 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
521 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
522 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
523 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
524 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
525 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
526 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
527 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
528 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
529 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
530 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
531 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
532 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
533 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
534 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
535 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
536 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
537 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
538 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
539 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
540 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
542 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
543 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
544 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
545 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
546 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
547 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
548 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
549 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
550 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
551 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
552 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
553 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
554 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
555 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
556 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
557 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
558 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
559 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
560 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
561 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
562 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
563 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
564 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
565 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
566 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
567 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
568 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
569 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
570 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
571 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
572 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
573 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
574 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
575 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
576 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
577 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
578 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
579 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
580 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
581 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
582 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
583 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
584 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
585 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
586 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
587 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
588 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
589 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
590 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
591 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
592 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
593 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
594 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
595 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
596 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
597 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
598 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
599 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
600 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
601 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
602 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
603 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
604 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
605 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
606 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
607 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
608 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
609 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
610 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
611 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
612 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
613 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
614 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
615 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
616 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
617 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
618 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
619 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
620 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
621 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
622 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
623 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
624 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
625 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
626 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
627 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
628 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
629 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
630 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
631 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
632 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
633 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
634 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
635 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
636 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
637 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
638 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
639 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
640 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
641 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
642 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
643 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
644 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
645 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
646 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
647 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
648 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
649 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
650 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
651 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
652 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
653 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
654 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
655 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
656 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
657 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
658 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
659 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
660 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
661 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
662 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
663 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
664 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
665 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
666 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
667 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
668 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
669 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
670 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
671 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
672 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
673 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
674 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
675 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
676 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
677 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
678 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
679 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
680 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
681 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
682 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
683 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
684 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
685 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
686 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
687 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
688 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
689 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
690 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
691 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
692 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
693 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
694 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
695 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
696 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
697 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
698 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
699 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
700 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
701 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
702 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
703 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
704 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
705 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
706 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
707 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
708 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
709 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
710 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
711 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
712 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
713 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
714 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
715 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
716 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
717 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
718 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
719 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
720 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
721 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
722 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
723 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
724 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
725 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
726 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
727 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
728 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
729 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
730 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
731 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
732 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
733 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
734 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
735 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
736 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
737 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
738 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
739 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
740 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
741 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
742 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
743 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
744 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
745 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
746 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
747 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
748 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
749 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
750 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
751 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
752 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
753 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
754 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
755 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
756 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
757 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
758 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
759 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
760 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
761 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
762 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
763 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
764 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
765 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
766 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
767 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
768 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
769 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
770 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
771 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
772 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
773 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
774 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
775 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
776 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
777 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
778 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
779 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
780 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
781 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
782 8005258706 Rhizobium sp. R693 Isolate Nodule
783 8005275841 Rhizobium sp. N4311 Isolate Nodule
784 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
785 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
786 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
787 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
788 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
789 8005321885 Rhizobium sp. R72 Isolate Nodule
790 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
791 8005382845 Rhizobium sp. R634 Isolate Nodule
792 8005395548 Rhizobium sp. R339 Isolate Nodule
793 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
794 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
795 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
796 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
797 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
798 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
799 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
800 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
801 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
802 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
803 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
804 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
805 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
806 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
807 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
808 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
809 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
810 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
811 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
812 8018176218 Rhizobium sp. N122 Isolate Nodule
813 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
814 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
815 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
816 8024501048 Rhizobium sp. H4 Isolate Nodule
817 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
818 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
819 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
820 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
821 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
822 8056382006 Rhizobium croatiense 13T Isolate Nodule
823 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
824 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
825 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 47.49
Metatranscriptomes 0.18
Isolates 52.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.46
Bulb 0
Endosphere 19.33
Nodule 39.93
Rhizoplane 1.64
Rhizosphere 21.6
Stem 0
Stem Tuber 0
Unclassified 17.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000204 3300001979 Bacteria 24594
2 JGI25155J39150_1000023 3300002704 Bacteria 136961
3 JGI25156J39149_1000029 3300002705 Bacteria 126505
4 JGI25156J39149_1000094 3300002705 Bacteria 65145
5 JGI25162J39368_1000587 3300002737 Bacteria 26590
6 JGI25162J39368_1002465 3300002737 Bacteria 7153
7 JGI25154J39366_1000067 3300002738 Bacteria 100452
8 JGI25158J39367_1000091 3300002739 Bacteria 21033
9 JGI25157J39369_1000043 3300002741 Bacteria 122537
10 JGI25152J39213_1001312 3300002773 Bacteria 11110
11 JGI25152J39213_1006131 3300002773 Bacteria 3343
12 JGI25152J39213_1006498 3300002773 Bacteria 3170
13 JGI25152J39213_1006580 3300002773 Bacteria 3132
14 JGI25152J39213_1006969 3300002773 Bacteria 2983
15 JGI25150J39212_1000012 3300002774 Bacteria 182468
16 JGI25150J39212_1010852 3300002774 Bacteria 1675
17 JGI25159J45721_1000016 3300002987 Bacteria 139656
18 JGI25159J45721_1000279 3300002987 Bacteria 24002
19 JGI25159J45721_1000452 3300002987 Bacteria 18938
20 JGI25151J46595_10000025 3300003187 Bacteria 213302
21 JGI25151J46595_10000250 3300003187 Bacteria 62876
22 JGI25151J46595_10002596 3300003187 Bacteria 10660
23 JGI25151J46595_10003625 3300003187 Bacteria 8443
24 JGI25151J46595_10009171 3300003187 Bacteria 4707
25 JGI25151J46595_10036661 3300003187 Bacteria 1847
26 JGI25165J46597_1000341 3300003214 Bacteria 53973
27 JGI25165J46597_1000736 3300003214 Bacteria 25593
28 JGI25153J46596_10000232 3300003215 Bacteria 47116
29 JGI25153J46596_10004357 3300003215 Bacteria 7640
30 JGI25153J46596_10015083 3300003215 Bacteria 3170
31 JGI25153J46596_10015309 3300003215 Bacteria 3132
32 JGI25153J46596_10041298 3300003215 Bacteria 1420
33 rootL2_10164180 3300003322 Bacteria 1668
34 rootL2_10172147 3300003322 Bacteria 1488
35 rootH1_10003075 3300003323 Bacteria 1686
36 rootH1_10134538 3300003323 Bacteria 2153
37 rootH1_10134546 3300003323 Bacteria 2019
38 JGI25160J50197_1000002 3300003354 Bacteria 561707
39 JGI25160J50197_1000046 3300003354 Bacteria 141352
40 JGI25160J50197_1010015 3300003354 Bacteria 3463
41 JGI25160J50197_1017151 3300003354 Bacteria 2304
42 JGI25160J50197_1031512 3300003354 Bacteria 1364
43 JGI25161J50226_1000031 3300003374 Bacteria 141352
44 JGI25161J50226_1000074 3300003374 Bacteria 85547
45 JGI25161J50226_1001241 3300003374 Bacteria 8242
46 Ga0032354_1119851 3300003693 Bacteria 1461
47 Ga0055526_1000207 3300003771 Bacteria 50680
48 Ga0055526_1002214 3300003771 Bacteria 13327
49 Ga0055526_1007940 3300003771 Bacteria 5393
50 Ga0055526_1022727 3300003771 Bacteria 2122
51 Ga0055524_1004019 3300003775 Bacteria 6935
52 Ga0055524_1007477 3300003775 Bacteria 4628
53 Ga0055524_1007645 3300003775 Bacteria 4569
54 Ga0055524_1011853 3300003775 Bacteria 3380
55 Ga0055524_1015300 3300003775 Bacteria 2802
56 Ga0055524_1029137 3300003775 Bacteria 1639
57 Ga0055536_1010507 3300003781 Bacteria 3663
58 Ga0055528_1000146 3300003790 Bacteria 57915
59 Ga0055528_1000897 3300003790 Bacteria 20068
60 Ga0055528_1002867 3300003790 Bacteria 8972
61 Ga0055528_1003099 3300003790 Bacteria 8532
62 Ga0055528_1007193 3300003790 Bacteria 4951
63 Ga0055530_10016453 3300003791 Bacteria 2362
64 Ga0055540_1000111 3300003792 Bacteria 88263
65 Ga0055540_1003680 3300003792 Bacteria 7289
66 Ga0055531_10007389 3300003794 Bacteria 6012
67 Ga0058692_1002656 3300003856 Bacteria 5887
68 Ga0058692_1002911 3300003856 Bacteria 5528
69 Ga0055543_1000008 3300004625 Bacteria 202062
70 Ga0055543_1000022 3300004625 Bacteria 140745
71 Ga0055543_1000188 3300004625 Bacteria 50290
72 Ga0055543_1002371 3300004625 Bacteria 6290
73 Ga0065165_1000058 3300005262 Bacteria 184784
74 Ga0065165_1000336 3300005262 Bacteria 76934
75 Ga0065165_1024971 3300005262 Bacteria 1997
76 Ga0070670_100000173 3300005331 Bacteria 58127
77 Ga0070666_10125356 3300005335 Bacteria 1783
78 Ga0070682_100234782 3300005337 Bacteria 1313
79 Ga0070668_100068615 3300005347 Bacteria 2756
80 Ga0070668_100501995 3300005347 Bacteria 1050
81 Ga0070669_100071894 3300005353 Bacteria 2560
82 Ga0070669_100244162 3300005353 Bacteria 1428
83 Ga0070671_100016028 3300005355 Bacteria 6056
84 Ga0070659_100160610 3300005366 Bacteria 1837
85 Ga0070663_100571756 3300005455 Bacteria 947
86 Ga0070663_100665479 3300005455 Bacteria 882
87 Ga0070665_100004421 3300005548 Bacteria 14769
88 Ga0070665_100254820 3300005548 Bacteria 1756
89 Ga0068855_100092975 3300005563 Bacteria 3478
90 Ga0075365_10010451 3300006038 Bacteria 5409
91 Ga0075365_10017717 3300006038 Bacteria 4365
92 Ga0075368_10000355 3300006042 Bacteria 13436
93 Ga0075368_10063483 3300006042 Bacteria 1482
94 Ga0075363_100270358 3300006048 Bacteria 982
95 Ga0075364_10003332 3300006051 Bacteria 9116
96 Ga0075364_10014583 3300006051 Bacteria 4858
97 Ga0075362_10009717 3300006177 Bacteria 3730
98 Ga0075362_10026468 3300006177 Bacteria 2477
99 Ga0075367_10000511 3300006178 Bacteria 14626
100 Ga0075369_10028887 3300006186 Bacteria 2327
101 Ga0075369_10105297 3300006186 Bacteria 1268
102 Ga0075366_10012030 3300006195 Bacteria 4901
103 Ga0075366_10099458 3300006195 Bacteria 1745
104 Ga0075366_10204972 3300006195 Bacteria 1200
105 Ga0075370_10001381 3300006353 Bacteria 10466
106 Ga0075370_10045976 3300006353 Bacteria 2469
107 Ga0079104_1000069 3300006946 Bacteria 153993
108 Ga0079104_1001287 3300006946 Bacteria 17341
109 Ga0099826_10018831 3300006948 Bacteria 5198
110 Ga0099826_10023495 3300006948 Bacteria 4593
111 Ga0105251_10075825 3300009011 Bacteria 1561
112 Ga0105244_10199038 3300009036 Bacteria 945
113 Ga0105240_10000278 3300009093 Bacteria 101540
114 Ga0105243_10016561 3300009148 Bacteria 5574
115 Ga0105237_10000434 3300009545 Bacteria 59528
116 Ga0105249_10295169 3300009553 Bacteria 1624
117 Ga0123341_1000175 3300009765 Bacteria 32159
118 Ga0123342_1003939 3300009766 Bacteria 23272
119 Ga0123342_1031762 3300009766 Bacteria 2529
120 Ga0105239_10018500 3300010375 Bacteria 7696
121 Ga0157373_10046011 3300013100 Bacteria 3114
122 Ga0157373_10102545 3300013100 Bacteria 2013
123 Ga0157373_10124972 3300013100 Bacteria 1809
124 Ga0157371_10000058 3300013102 Bacteria 171756
125 Ga0157371_10025080 3300013102 Bacteria 4349
126 Ga0157370_10000792 3300013104 Bacteria 39754
127 Ga0157370_10147765 3300013104 Bacteria 2188
128 Ga0157369_10124524 3300013105 Bacteria 2733
129 Ga0157369_10453170 3300013105 Bacteria 1328
130 Ga0171463_1001 3300013249 Bacteria 1406070
131 Ga0163162_10900840 3300013306 Bacteria 998
132 Ga0157372_10795271 3300013307 Bacteria 1099
133 Ga0183363_1147 3300015690 Bacteria 17691
134 Ga0214544_1000008 3300021320 Bacteria 326027
135 Ga0214542_1000011 3300021321 Bacteria 238260
136 Ga0214543_1000003 3300021327 Bacteria 692327
137 Ga0214543_1000004 3300021327 Bacteria 527190
138 Ga0228711_1027658 3300022739 Bacteria 3417
139 Ga0228710_1000534 3300022740 Bacteria 49030
140 Ga0209435_100011 3300025206 Bacteria 413027
141 Ga0209436_100650 3300025208 Bacteria 14804
142 Ga0209672_111667 3300025228 Bacteria 1124
143 Ga0209563_103604 3300025230 Bacteria 3158
144 Ga0207427_104809 3300025231 Bacteria 2107
145 Ga0209437_100036 3300025233 Bacteria 469153
146 Ga0209437_100086 3300025233 Bacteria 254578
147 Ga0207425_1000012 3300025245 Bacteria 528324
148 Ga0207425_1001893 3300025245 Bacteria 7980
149 Ga0207425_1003765 3300025245 Bacteria 4740
150 Ga0207425_1005185 3300025245 Bacteria 3752
151 Ga0207425_1009121 3300025245 Bacteria 2488
152 Ga0207425_1045443 3300025245 Bacteria 821
153 Ga0209646_1000024 3300025246 Bacteria 413027
154 Ga0209026_1000030 3300025250 Bacteria 329811
155 Ga0209677_101617 3300025253 Bacteria 9499
156 Ga0209759_1000011 3300025256 Bacteria 413027
157 Ga0209129_1000086 3300025258 Bacteria 181543
158 Ga0209129_1000123 3300025258 Bacteria 133661
159 Ga0209129_1000261 3300025258 Bacteria 53485
160 Ga0209129_1000316 3300025258 Bacteria 42919
161 Ga0209129_1000563 3300025258 Bacteria 25595
162 Ga0209129_1001248 3300025258 Bacteria 14586
163 Ga0209129_1004964 3300025258 Bacteria 4929
164 Ga0209233_1000110 3300025261 Bacteria 260825
165 Ga0209233_1000166 3300025261 Bacteria 152270
166 Ga0209233_1000465 3300025261 Bacteria 25645
167 Ga0209673_1000015 3300025273 Bacteria 530618
168 Ga0209673_1000091 3300025273 Bacteria 201875
169 Ga0209673_1000874 3300025273 Bacteria 39105
170 Ga0209673_1000919 3300025273 Bacteria 37355
171 Ga0209673_1000969 3300025273 Bacteria 35614
172 Ga0209673_1003237 3300025273 Bacteria 9842
173 Ga0209673_1004304 3300025273 Bacteria 7693
174 Ga0209673_1012686 3300025273 Bacteria 3379
175 Ga0209130_1000002 3300025284 Bacteria 722648
176 Ga0209130_1000008 3300025284 Bacteria 581232
177 Ga0209130_1000088 3300025284 Bacteria 152927
178 Ga0209130_1013890 3300025284 Bacteria 2043
179 Ga0209130_1025048 3300025284 Bacteria 1296
180 Ga0209676_1009188 3300025292 Bacteria 4300
181 Ga0209025_1000024 3300025294 Bacteria 528324
182 Ga0209025_1000407 3300025294 Bacteria 87041
183 Ga0209025_1000441 3300025294 Bacteria 81951
184 Ga0209025_1000469 3300025294 Bacteria 78737
185 Ga0209025_1001129 3300025294 Bacteria 38238
186 Ga0209025_1001595 3300025294 Bacteria 28547
187 Ga0209025_1003038 3300025294 Bacteria 16550
188 Ga0209025_1008383 3300025294 Bacteria 7449
189 Ga0209564_1000091 3300025295 Bacteria 249103
190 Ga0209564_1000845 3300025295 Bacteria 41202
191 Ga0209564_1006326 3300025295 Bacteria 6434
192 Ga0209564_1008515 3300025295 Bacteria 5046
193 Ga0209564_1016448 3300025295 Bacteria 2943
194 Ga0209564_1020120 3300025295 Bacteria 2461
195 Ga0209758_1000046 3300025297 Bacteria 364931
196 Ga0209758_1000336 3300025297 Bacteria 87439
197 Ga0209758_1000602 3300025297 Bacteria 55848
198 Ga0209758_1000877 3300025297 Bacteria 41329
199 Ga0209758_1001026 3300025297 Bacteria 36693
200 Ga0209758_1001612 3300025297 Bacteria 25773
201 Ga0209758_1002567 3300025297 Bacteria 18250
202 Ga0209758_1025459 3300025297 Bacteria 2596
203 Ga0209050_1012596 3300025298 Bacteria 3859
204 Ga0209050_1017011 3300025298 Bacteria 2932
205 Ga0209256_1000180 3300025299 Bacteria 123687
206 Ga0209256_1001130 3300025299 Bacteria 30415
207 Ga0209256_1002068 3300025299 Bacteria 17685
208 Ga0209256_1002341 3300025299 Bacteria 15796
209 Ga0209256_1009020 3300025299 Bacteria 4468
210 Ga0209256_1013913 3300025299 Bacteria 2945
211 Ga0209256_1014331 3300025299 Bacteria 2862
212 Ga0207426_1000012 3300025302 Bacteria 730942
213 Ga0207426_1000013 3300025302 Bacteria 721897
214 Ga0207426_1000016 3300025302 Bacteria 581232
215 Ga0207426_1000063 3300025302 Bacteria 358920
216 Ga0207426_1000172 3300025302 Bacteria 163690
217 Ga0207426_1001284 3300025302 Bacteria 21757
218 Ga0209051_1000084 3300025303 Bacteria 190324
219 Ga0209051_1001391 3300025303 Bacteria 20798
220 Ga0209051_1008848 3300025303 Bacteria 5269
221 Ga0209051_1015068 3300025303 Bacteria 3574
222 Ga0209051_1020889 3300025303 Bacteria 2804
223 Ga0209051_1022502 3300025303 Bacteria 2651
224 Ga0209051_1069412 3300025303 Bacteria 1068
225 Ga0209257_1002244 3300025304 Bacteria 19810
226 Ga0209257_1004073 3300025304 Bacteria 11723
227 Ga0209257_1005200 3300025304 Bacteria 9345
228 Ga0207680_10303088 3300025903 Bacteria 1114
229 Ga0207695_10000376 3300025913 Bacteria 101548
230 Ga0207671_10000732 3300025914 Bacteria 41620
231 Ga0207681_10247304 3300025923 Bacteria 1391
232 Ga0207694_10464385 3300025924 Bacteria 1058
233 Ga0207650_10000899 3300025925 Bacteria 22456
234 Ga0207644_10209249 3300025931 Bacteria 1541
235 Ga0207690_10299962 3300025932 Bacteria 1257
236 Ga0207667_10123293 3300025949 Bacteria 2670
237 Ga0207668_10053591 3300025972 Bacteria 2796
238 Ga0207668_10477719 3300025972 Bacteria 1068
239 Ga0207678_10599334 3300026067 Bacteria 966
240 Ga0207702_10217381 3300026078 Bacteria 1780
241 Ga0209281_1000192 3300027111 Bacteria 140252
242 Ga0209281_1000468 3300027111 Bacteria 56770
243 Ga0209281_1000629 3300027111 Bacteria 39061
244 Ga0209371_1000009 3300027312 Bacteria 963030
245 Ga0209371_1000547 3300027312 Bacteria 35249
246 Ga0209371_1000853 3300027312 Bacteria 24684
247 Ga0209282_1000103 3300027666 Bacteria 56769
248 Ga0209282_1000224 3300027666 Bacteria 29523
249 Ga0209282_1025566 3300027666 Bacteria 3691
250 Ga0209813_10000358 3300027866 Bacteria 11644
251 Ga0209813_10035055 3300027866 Bacteria 1500
252 Ga0268266_10043940 3300028379 Bacteria 3819
253 Ga0268266_10186252 3300028379 Bacteria 1893
254 Ga0307515_10000154 3300028794 Bacteria 166582
255 Ga0307515_10004744 3300028794 Bacteria 27847
256 Ga0307515_10009097 3300028794 Bacteria 19271
257 Ga0307515_10123040 3300028794 Bacteria 2921
258 Ga0268256_1000010 3300030500 Bacteria 963034
259 Ga0268256_1001802 3300030500 Bacteria 12062
260 Ga0268256_1006809 3300030500 Bacteria 4184
261 Ga0307513_10020729 3300031456 Bacteria 7784
262 Ga0307513_10056454 3300031456 Bacteria 4192
263 Ga0307513_10091461 3300031456 Bacteria 3101
264 Ga0307513_10357983 3300031456 Bacteria 1205
265 Ga0307408_100028092 3300031548 Bacteria 3884
266 Ga0307408_100073536 3300031548 Bacteria 2534
267 Ga0307516_10225197 3300031730 Bacteria 1582
268 Ga0307405_10000238 3300031731 Bacteria 20020
269 Ga0307406_10007930 3300031901 Bacteria 5912
270 Ga0307412_10001286 3300031911 Bacteria 14059
271 Ga0307412_10136150 3300031911 Bacteria 1792
272 Ga0315914_1000009 3300031967 Bacteria 182444
273 Ga0307414_10044780 3300032004 Bacteria 3026
274 Ga0315913_1000155 3300033430 Bacteria 46811
275 Ga0315915_1000013 3300033464 Bacteria 182438
276 Ga0373927_0010575 3300035695 Bacteria 6150
277 Ga0373947_0081196 3300035725 Bacteria 2007
278 Ga0373925_0005974 3300037068 Bacteria 9016
279 Ga0395900_0116748 3300037418 Bacteria 2739
280 Ga0395905_0001437 3300037471 Bacteria 28670
281 Ga0395905_0085445 3300037471 Bacteria 2956
282 Ga0395905_0268340 3300037471 Bacteria 1592
283 Ga0439436_0018073 3300041404 Bacteria 2109
284 Ga0439439_0041941 3300041406 Bacteria 1188
285 Ga0439465_0000272 3300041413 Bacteria 14513
286 Ga0439465_0011616 3300041413 Bacteria 2764
287 Ga0439465_0097784 3300041413 Bacteria 1011
288 Ga0451791_0134167 3300041451 Bacteria 952
289 Ga0451793_1870052 3300041452 Bacteria 1045
290 Ga0451833_0936012 3300041491 Bacteria 2128
291 Ga0439449_0011495 3300042007 Bacteria 3330
292 Ga0439449_0019033 3300042007 Bacteria 2575
293 Ga0439449_0064885 3300042007 Bacteria 1347
294 Ga0439454_035137 3300042011 Bacteria 802
295 Ga0439462_0007064 3300042015 Bacteria 2807
296 Ga0450920_002278 3300042122 Bacteria 3252
297 Ga0450900_023596 3300042136 Bacteria 869
298 Ga0439434_0124282 3300042435 Bacteria 843
299 Ga0466970_0002337 3300044765 Bacteria 9169
300 Ga0466967_0290782 3300045976 Bacteria 1570
301 Ga0495617_011491 3300046452 Bacteria 3020
302 Ga0495629_0040231 3300046459 Bacteria 3288
303 Ga0495638_0000299 3300046460 Bacteria 63971
304 Ga0495638_0064665 3300046460 Bacteria 2253
305 Ga0495638_0068400 3300046460 Bacteria 2178
306 Ga0495605_0001136 3300046474 Bacteria 17664
307 Ga0495605_0020073 3300046474 Bacteria 3555
308 Ga0495662_0004594 3300046476 Bacteria 6918
309 Ga0495664_0142665 3300046477 Bacteria 1452
310 Ga0495585_0002346 3300046492 Bacteria 13606
311 Ga0495585_0018083 3300046492 Bacteria 4067
312 Ga0495585_0033324 3300046492 Bacteria 2916
313 Ga0495607_0019722 3300046501 Bacteria 4278
314 Ga0495607_0062253 3300046501 Bacteria 2116
315 Ga0495607_0133023 3300046501 Bacteria 1292
316 Ga0495583_0032223 3300046506 Bacteria 2531
317 Ga0495606_0002337 3300046507 Bacteria 22341
318 Ga0495606_0219231 3300046507 Bacteria 1073
319 Ga0495610_0010591 3300046512 Bacteria 5715
320 Ga0495610_0012554 3300046512 Bacteria 5089
321 Ga0495616_0057635 3300046513 Bacteria 1915
322 Ga0495628_0163430 3300046516 Bacteria 1691
323 Ga0495631_0001476 3300046518 Bacteria 14271
324 Ga0495632_0003334 3300046519 Bacteria 11451
325 Ga0495632_0061334 3300046519 Bacteria 1825
326 Ga0495643_0014063 3300046522 Bacteria 4771
327 Ga0495643_0032112 3300046522 Bacteria 2917
328 Ga0495643_0033795 3300046522 Bacteria 2825
329 Ga0495643_0103461 3300046522 Bacteria 1456
330 Ga0495648_0013983 3300046524 Bacteria 5903
331 Ga0495648_0216810 3300046524 Bacteria 947
332 Ga0495652_0102353 3300046529 Bacteria 2320
333 Ga0495654_0000530 3300046530 Bacteria 30917
334 Ga0495654_0033571 3300046530 Bacteria 2596
335 Ga0495587_0353200 3300046536 Bacteria 819
336 Ga0495622_0006618 3300046557 Bacteria 5372
337 Ga0495633_0030076 3300046558 Bacteria 2639
338 Ga0495633_0037453 3300046558 Bacteria 2320
339 Ga0495656_0008267 3300046615 Bacteria 3711
340 Ga0495668_0003147 3300046616 Bacteria 12731
341 Ga0495668_0088436 3300046616 Bacteria 1698
342 Ga0495668_0238704 3300046616 Bacteria 995
343 Ga0495611_0029401 3300046648 Bacteria 2410
344 Ga0495625_0003388 3300046660 Bacteria 15968
345 Ga0495625_0040840 3300046660 Bacteria 3380
346 Ga0495625_0376783 3300046660 Bacteria 891
347 Ga0495661_0050965 3300046665 Bacteria 2502
348 Ga0495588_0013033 3300046674 Bacteria 3951
349 Ga0495670_0008868 3300046691 Bacteria 4949
350 Ga0495649_0012442 3300046694 Bacteria 4948
351 Ga0495600_0217550 3300046809 Bacteria 1222
352 Ga0495660_0013688 3300046810 Bacteria 4702
353 Ga0495660_0070213 3300046810 Bacteria 1860
354 Ga0495660_0104396 3300046810 Bacteria 1454
355 Ga0495604_0064028 3300047317 Bacteria 2803
356 Ga0495672_0050007 3300047320 Bacteria 2471
357 Ga0495683_0096851 3300047323 Bacteria 1423
358 Ga0495683_0097313 3300047323 Bacteria 1419
359 Ga0495687_010244 3300047443 Bacteria 5154
360 Ga0495673_0088739 3300047469 Bacteria 1267
361 Ga0495681_0002944 3300047470 Bacteria 12026
362 Ga0495681_0038553 3300047470 Bacteria 2341
363 Ga0495681_0089273 3300047470 Bacteria 1364
364 Ga0495686_0000688 3300047472 Bacteria 45757
365 Ga0495686_0011499 3300047472 Bacteria 6234
366 Ga0495686_0062690 3300047472 Bacteria 2305
367 Ga0495686_0183906 3300047472 Bacteria 1209
368 Ga0495626_0053767 3300048091 Bacteria 1852
369 Ga0496101_0079097 3300048904 Bacteria 2427
370 Ga0496104_0265369 3300048907 Bacteria 1629
371 Ga0496104_0275165 3300048907 Bacteria 1596
372 Ga0496106_0000259 3300048909 Bacteria 37115
373 Ga0496110_0152345 3300048913 Bacteria 2094
374 Ga0496111_0007359 3300048914 Bacteria 7208
375 Ga0496114_0081196 3300048917 Bacteria 2739
376 Ga0496116_0000080 3300048919 Bacteria 224530
377 Ga0496116_0001010 3300048919 Bacteria 34302
378 Ga0496116_0007988 3300048919 Bacteria 9265
379 Ga0496116_0018850 3300048919 Bacteria 5302
380 Ga0496116_0051203 3300048919 Bacteria 2745
381 Ga0496116_0169880 3300048919 Bacteria 1183
382 Ga0496117_0000002 3300048920 Bacteria 2483758
383 Ga0496117_0000732 3300048920 Bacteria 51545
384 Ga0496117_0010831 3300048920 Bacteria 8229
385 Ga0496117_0081076 3300048920 Bacteria 2131
386 Ga0496118_0000233 3300048921 Bacteria 97731
387 Ga0496118_0016899 3300048921 Bacteria 6665
388 Ga0496118_0024440 3300048921 Bacteria 5213
389 Ga0496118_0061651 3300048921 Bacteria 2775
390 Ga0496118_0120771 3300048921 Bacteria 1709
391 Ga0496118_0204590 3300048921 Bacteria 1165
392 Ga0496119_0006263 3300048922 Bacteria 11104
393 Ga0496119_0042794 3300048922 Bacteria 2868
394 Ga0496119_0066005 3300048922 Bacteria 2140
395 Ga0496119_0103457 3300048922 Bacteria 1595
396 Ga0496119_0141713 3300048922 Bacteria 1297
397 Ga0496120_0000021 3300048923 Bacteria 250966
398 Ga0496121_0000001 3300048924 Bacteria 1830318
399 Ga0496121_0000581 3300048924 Bacteria 68614
400 Ga0496121_0008494 3300048924 Bacteria 12052
401 Ga0496121_0009527 3300048924 Bacteria 11132
402 Ga0496121_0016422 3300048924 Bacteria 7648
403 Ga0496121_0020886 3300048924 Bacteria 6449
404 Ga0496121_0034593 3300048924 Bacteria 4546
405 Ga0496121_0048240 3300048924 Bacteria 3624
406 Ga0496122_0000001 3300048925 Bacteria 1827766
407 Ga0496122_0000009 3300048925 Bacteria 584024
408 Ga0496122_0000247 3300048925 Bacteria 121291
409 Ga0496122_0001682 3300048925 Bacteria 34269
410 Ga0496122_0014835 3300048925 Bacteria 7503
411 Ga0496122_0018592 3300048925 Bacteria 6406
412 Ga0496122_0030455 3300048925 Bacteria 4520
413 Ga0496122_0041982 3300048925 Bacteria 3605
414 Ga0496122_0043533 3300048925 Bacteria 3516
415 Ga0496122_0075457 3300048925 Bacteria 2378
416 Ga0496122_0156448 3300048925 Bacteria 1398
417 Ga0496123_0000001 3300048926 Bacteria 1831497
418 Ga0496123_0000020 3300048926 Bacteria 388748
419 Ga0496123_0000222 3300048926 Bacteria 115482
420 Ga0496123_0015313 3300048926 Bacteria 6298
421 Ga0496123_0026585 3300048926 Bacteria 4330
422 Ga0496123_0043718 3300048926 Bacteria 3072
423 Ga0496123_0099010 3300048926 Bacteria 1703
424 Ga0496123_0147963 3300048926 Bacteria 1272
425 Ga0496124_0000063 3300048927 Bacteria 229705
426 Ga0496124_0000704 3300048927 Bacteria 54690
427 Ga0496124_0001515 3300048927 Bacteria 33826
428 Ga0496124_0015814 3300048927 Bacteria 7211
429 Ga0496124_0021527 3300048927 Bacteria 5939
430 Ga0496124_0025767 3300048927 Bacteria 5318
431 Ga0496124_0026166 3300048927 Bacteria 5266
432 Ga0496124_0061748 3300048927 Bacteria 3139
433 Ga0496124_0144776 3300048927 Bacteria 1871
434 Ga0496124_0232569 3300048927 Bacteria 1377
435 Ga0496125_0000001 3300048928 Bacteria 1766138
436 Ga0496125_0004123 3300048928 Bacteria 16969
437 Ga0496125_0014312 3300048928 Bacteria 7730
438 Ga0496125_0210445 3300048928 Bacteria 1263
439 Ga0496125_0305354 3300048928 Bacteria 973
440 Ga0496125_0327185 3300048928 Bacteria 926
441 Ga0496126_0000094 3300048929 Bacteria 208184
442 Ga0496126_0006808 3300048929 Bacteria 12679
443 Ga0496126_0103547 3300048929 Bacteria 2487
444 Ga0496126_0116812 3300048929 Bacteria 2318
445 Ga0496126_0618242 3300048929 Bacteria 851
446 Ga0495678_003970 3300049459 Bacteria 8846
447 Ga0501031_0022842 3300049568 Bacteria 4078
448 Ga0501032_0104415 3300049569 Bacteria 1877
449 Ga0501032_0367642 3300049569 Bacteria 925
450 Ga0501033_0000476 3300049570 Bacteria 37977
451 Ga0501033_0048336 3300049570 Bacteria 3160
452 Ga0501033_0127247 3300049570 Bacteria 1847
453 Ga0501033_0342965 3300049570 Bacteria 1047
454 Ga0501034_0252998 3300049571 Bacteria 1706
455 Ga0501034_0521871 3300049571 Bacteria 1099
456 Ga0501034_0633161 3300049571 Bacteria 972
457 Ga0501036_0017956 3300049572 Bacteria 5923
458 Ga0501036_0156444 3300049572 Bacteria 1922
459 Ga0501037_0035100 3300049573 Bacteria 3699
460 Ga0501037_0189300 3300049573 Bacteria 1457
461 Ga0501038_0113992 3300049574 Bacteria 2236
462 Ga0501038_0160805 3300049574 Bacteria 1825
463 Ga0501039_0115704 3300049575 Bacteria 2099
464 Ga0501039_0416141 3300049575 Bacteria 1056
465 Ga0501043_0092747 3300049579 Bacteria 2374
466 Ga0501047_0162420 3300049581 Bacteria 2105
467 Ga0501067_0071405 3300049583 Bacteria 1923
468 Ga0501080_0145372 3300049742 Bacteria 2192
469 Ga0501083_0040604 3300049744 Bacteria 3158
470 Ga0501280_007268 3300049776 Bacteria 1552
471 Ga0501035_0003519 3300049822 Bacteria 14970
472 Ga0501044_0062193 3300049823 Bacteria 3816
473 Ga0501044_0103576 3300049823 Bacteria 2860
474 nmdc:mga03683_32962_c1 3300050489 Bacteria 2087
475 nmdc:mga00v17_133_c2 3300050491 Bacteria 35968
476 nmdc:mga00v17_36647_c1 3300050491 Bacteria 2925
477 nmdc:mga00v17_72_c1 3300050491 Bacteria 60922
478 nmdc:mga0yw44_7430_c1 3300050492 Bacteria 5390
479 nmdc:mga0k408_3195_c1 3300050493 Bacteria 8678
480 nmdc:mga0k408_94713_c1 3300050493 Bacteria 1756
481 nmdc:mga06z11_101090_c1 3300050494 Bacteria 1582
482 nmdc:mga06z11_4151_c1 3300050494 Bacteria 5665
483 nmdc:mga04h51_1009_c1 3300050495 Bacteria 6500
484 nmdc:mga07m45_70084_c2 3300050496 Bacteria 1660
485 nmdc:mga0sz30_22408_c1 3300050516 Bacteria 2564
486 Ga0500610_0027143 3300053079 Bacteria 2873
487 Ga0495619_0160345 3300053085 Bacteria 1553
488 Ga0500578_0131405 3300053086 Bacteria 1570
489 Ga0500643_055883 3300053087 Bacteria 1117
490 Ga0500650_0234212 3300053098 Bacteria 828
491 Ga0500557_001007 3300053105 Bacteria 4271
492 Ga0500560_004306 3300053107 Bacteria 3012
493 Ga0500569_002392 3300053109 Bacteria 3688
494 Ga0500569_021294 3300053109 Bacteria 1712
495 Ga0500594_0007609 3300053118 Bacteria 2453
496 Ga0500594_0036012 3300053118 Bacteria 1330
497 Ga0500607_113631 3300053121 Bacteria 1323
498 Ga0500608_015086 3300053122 Bacteria 3463
499 Ga0500618_000046 3300053125 Bacteria 109891
500 Ga0500618_000151 3300053125 Bacteria 57092
501 Ga0500618_015380 3300053125 Bacteria 1935
502 Ga0500618_016573 3300053125 Bacteria 1843
503 Ga0500559_0001313 3300053136 Bacteria 14348
504 Ga0500561_0000123 3300053137 Bacteria 14866
505 Ga0500568_0001043 3300053139 Bacteria 18919
506 Ga0500568_0001239 3300053139 Bacteria 16933
507 Ga0500573_0001611 3300053140 Bacteria 10896
508 Ga0500577_0037699 3300053142 Bacteria 1741
509 Ga0500590_000994 3300053148 Bacteria 10966
510 Ga0500604_0116412 3300053151 Bacteria 891
511 Ga0500616_0000596 3300053153 Bacteria 43912
512 Ga0500616_0002540 3300053153 Bacteria 15067
513 Ga0500616_0073232 3300053153 Bacteria 1739
514 Ga0500622_0000117 3300053156 Bacteria 82720
515 Ga0500622_0000348 3300053156 Bacteria 45124
516 Ga0500624_001256 3300053157 Bacteria 4457
517 Ga0500627_0100520 3300053158 Bacteria 1298
518 Ga0500627_0130764 3300053158 Bacteria 1134
519 Ga0500634_0001572 3300053161 Bacteria 8981
520 Ga0500636_0000010 3300053177 Bacteria 145932
521 Ga0500636_0007563 3300053177 Bacteria 6282
522 Ga0500636_0267269 3300053177 Bacteria 862
523 Ga0587090_001818 3300059510 Bacteria 2233

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048925 Ga0496122_0156448 Ga0496122_0156448_291_1007 216
2 3300053153 Ga0500616_0000596 Ga0500616_0000596_39172_39981 218
3 3300053158 Ga0500627_0130764 Ga0500627_0130764_49_858 218
4 3300048927 Ga0496124_0232569 Ga0496124_0232569_544_1326 220
5 3300035695 Ga0373927_0010575 Ga0373927_0010575_3054_3773 222
6 3300035725 Ga0373947_0081196 Ga0373947_0081196_390_1109 222
7 3300037068 Ga0373925_0005974 Ga0373925_0005974_927_1646 222
8 3300053136 Ga0500559_0001313 Ga0500559_0001313_5378_6178 223
9 iso_pu_bacteria 2891373044 2891376207 223
10 3300046557 Ga0495622_0006618 Ga0495622_0006618_880_1572 224
11 iso_pu_bacteria 2643221568 2643856330 224
12 iso_pu_bacteria 2891048133 2891048740 224
13 iso_pu_bacteria 2919166419 2919166903 224
14 iso_pu_bacteria 2936375103 2936377046 224
15 iso_pu_bacteria 2978969890 2978973320 224
16 iso_pu_bacteria 2984587000 2984591601 224
17 iso_pu_bacteria 2995392953 2995396502 224
18 3300013100 Ga0157373_10046011 Ga0157373_100460113 225
19 3300013105 Ga0157369_10124524 Ga0157369_101245242 225
20 iso_pu_bacteria 2516653085 2517079397 225
21 iso_pu_bacteria 2643221558 2643810502 225
22 iso_pu_bacteria 2690316117 2692317210 225
23 iso_pu_bacteria 2791355260 2793320237 225
24 iso_pu_bacteria 2802429634 2806052282 225
25 iso_pu_bacteria 2802429635 2806058583 225
26 iso_pu_bacteria 2838022645 2838024593 225
27 iso_pu_bacteria 2838686498 2838692700 225
28 iso_pu_bacteria 2838729681 2838732772 225
29 iso_pu_bacteria 2838742623 2838745667 225
30 iso_pu_bacteria 2841851746 2841855310 225
31 iso_pu_bacteria 2842156927 2842161659 225
32 iso_pu_bacteria 2842180545 2842185276 225
33 iso_pu_bacteria 2842198810 2842200302 225
34 iso_pu_bacteria 2842229732 2842233215 225
35 iso_pu_bacteria 2842243621 2842248782 225
36 iso_pu_bacteria 2842257432 2842261925 225
37 iso_pu_bacteria 2842271015 2842277011 225
38 iso_pu_bacteria 2842304105 2842306433 225
39 iso_pu_bacteria 2844454524 2844455926 225
40 iso_pu_bacteria 2847417321 2847417722 225
41 iso_pu_bacteria 2933570622 2933573502 225
42 iso_pu_bacteria 8023680758 8023684163 225
43 iso_pu_bacteria 8057874678 8057880977 225
44 3300053161 Ga0500634_0001572 Ga0500634_0001572_7824_8606 226
45 iso_pu_bacteria 2643221637 2644206646 226
46 iso_pu_bacteria 2643221718 2644650293 226
47 3300003187 JGI25151J46595_10003625 JGI25151J46595_100036252 227
48 3300006195 Ga0075366_10099458 Ga0075366_100994582 227
49 3300025230 Ga0209563_103604 Ga0209563_1036042 227
50 3300025294 Ga0209025_1000469 Ga0209025_100046936 227
51 3300047472 Ga0495686_0011499 Ga0495686_0011499_3768_4481 227
52 3300048920 Ga0496117_0000732 Ga0496117_0000732_11491_12207 227
53 3300048925 Ga0496122_0000247 Ga0496122_0000247_11036_11752 227
54 3300048926 Ga0496123_0000222 Ga0496123_0000222_10697_11413 227
55 3300048927 Ga0496124_0000704 Ga0496124_0000704_8628_9344 227
56 3300048928 Ga0496125_0014312 Ga0496125_0014312_3308_4024 227
57 3300048929 Ga0496126_0006808 Ga0496126_0006808_7657_8373 227
58 3300049570 Ga0501033_0000476 Ga0501033_0000476_3537_4256 227
59 3300049822 Ga0501035_0003519 Ga0501035_0003519_1843_2562 227
60 3300050493 nmdc:mga0k408_94713_c1 nmdc:mga0k408_94713_c1_798_1511 227
61 iso_pu_bacteria 2558860983 2561467413 227
62 iso_pu_bacteria 2775507049 2776912174 227
63 3300005366 Ga0070659_100160610 Ga0070659_1001606102 228
64 3300013102 Ga0157371_10025080 Ga0157371_100250802 228
65 3300013307 Ga0157372_10795271 Ga0157372_107952712 228
66 3300025932 Ga0207690_10299962 Ga0207690_102999622 228
67 3300037471 Ga0395905_0268340 Ga0395905_0268340_600_1349 228
68 3300046460 Ga0495638_0064665 Ga0495638_0064665_258_980 228
69 3300048919 Ga0496116_0000080 Ga0496116_0000080_32215_32937 228
70 3300048922 Ga0496119_0103457 Ga0496119_0103457_759_1481 228
71 3300048925 Ga0496122_0075457 Ga0496122_0075457_23_745 228
72 3300048926 Ga0496123_0099010 Ga0496123_0099010_290_1012 228
73 3300048929 Ga0496126_0000094 Ga0496126_0000094_20606_21328 228
74 3300049569 Ga0501032_0367642 Ga0501032_0367642_37_750 228
75 3300049570 Ga0501033_0127247 Ga0501033_0127247_435_1148 228
76 3300049571 Ga0501034_0252998 Ga0501034_0252998_831_1604 228
77 3300049571 Ga0501034_0633161 Ga0501034_0633161_219_932 228
78 3300049572 Ga0501036_0017956 Ga0501036_0017956_4420_5133 228
79 3300049573 Ga0501037_0035100 Ga0501037_0035100_2060_2773 228
80 3300049574 Ga0501038_0160805 Ga0501038_0160805_873_1586 228
81 3300049575 Ga0501039_0115704 Ga0501039_0115704_102_815 228
82 3300049579 Ga0501043_0092747 Ga0501043_0092747_725_1429 228
83 3300049581 Ga0501047_0162420 Ga0501047_0162420_1223_1927 228
84 3300049583 Ga0501067_0071405 Ga0501067_0071405_711_1415 228
85 3300049744 Ga0501083_0040604 Ga0501083_0040604_860_1573 228
86 3300049823 Ga0501044_0062193 Ga0501044_0062193_1947_2660 228
87 3300053122 Ga0500608_015086 Ga0500608_015086_2468_3190 228
88 3300053156 Ga0500622_0000117 Ga0500622_0000117_7289_8071 228
89 3300053177 Ga0500636_0000010 Ga0500636_0000010_77790_78515 228
90 iso_pu_bacteria 2510065057 2510305200 228
91 iso_pu_bacteria 2718218233 2720618619 228
92 iso_pu_bacteria 2791355265 2793353329 228
93 iso_pu_bacteria 2842192696 2842192954 228
94 iso_pu_bacteria 2916041962 2916042841 228
95 iso_pu_bacteria 2916048683 2916051829 228
96 iso_pu_bacteria 2916076590 2916080926 228
97 iso_pu_bacteria 2937091812 2937097506 228
98 iso_pu_bacteria 2960610863 2960616981 228
99 iso_pu_bacteria 2960624210 2960630267 228
100 iso_pu_bacteria 2960687367 2960691951 228
101 iso_pu_bacteria 2970177841 2970181816 228
102 iso_pu_bacteria 2977516862 2977518946 228
103 iso_pu_bacteria 2989349275 2989355470 228
104 iso_pu_bacteria 3003930520 3003932137 228
105 iso_pu_bacteria 8018150411 8018152005 228
106 iso_pu_bacteria 8054558443 8054563431 228
107 3300046522 Ga0495643_0033795 Ga0495643_0033795_1727_2434 229
108 3300053125 Ga0500618_000151 Ga0500618_000151_44729_45535 229
109 3300053153 Ga0500616_0073232 Ga0500616_0073232_827_1534 229
110 3300053177 Ga0500636_0007563 Ga0500636_0007563_1479_2204 229
111 iso_pu_bacteria 2508501122 2509107151 229
112 iso_pu_bacteria 2509276019 2509374884 229
113 iso_pu_bacteria 2509276021 2509388371 229
114 iso_pu_bacteria 2509276033 2509443935 229
115 iso_pu_bacteria 2510065019 2510131521 229
116 iso_pu_bacteria 2510461076 2510897823 229
117 iso_pu_bacteria 2510917022 2511136248 229
118 iso_pu_bacteria 2510917028 2511185649 229
119 iso_pu_bacteria 2510917030 2511196788 229
120 iso_pu_bacteria 2513237084 2513571107 229
121 iso_pu_bacteria 2513237085 2513579347 229
122 iso_pu_bacteria 2513237088 2513596765 229
123 iso_pu_bacteria 2513237093 2513632194 229
124 iso_pu_bacteria 2513237103 2513713312 229
125 iso_pu_bacteria 2513237138 2513871622 229
126 iso_pu_bacteria 2513237144 2513910405 229
127 iso_pu_bacteria 2513237146 2513928357 229
128 iso_pu_bacteria 2513237162 2514020970 229
129 iso_pu_bacteria 2515075009 2515110451 229
130 iso_pu_bacteria 2515154113 2515638310 229
131 iso_pu_bacteria 2515154114 2515642880 229
132 iso_pu_bacteria 2515154116 2515659564 229
133 iso_pu_bacteria 2515154134 2515743037 229
134 iso_pu_bacteria 2516653077 2517039144 229
135 iso_pu_bacteria 2517093000 2517093341 229
136 iso_pu_bacteria 2517287029 2517409570 229
137 iso_pu_bacteria 2519899620 2520380039 229
138 iso_pu_bacteria 2524023209 2524457547 229
139 iso_pu_bacteria 2529292951 2530647753 229
140 iso_pu_bacteria 2534681796 2535515131 229
141 iso_pu_bacteria 2558860100 2558863876 229
142 iso_pu_bacteria 2582581294 2585203713 229
143 iso_pu_bacteria 2582581298 2585227105 229
144 iso_pu_bacteria 2582581299 2585229023 229
145 iso_pu_bacteria 2582581304 2585259537 229
146 iso_pu_bacteria 2582581307 2585275411 229
147 iso_pu_bacteria 2582581308 2585282268 229
148 iso_pu_bacteria 2582581315 2585325949 229
149 iso_pu_bacteria 2582581316 2585330116 229
150 iso_pu_bacteria 2582581867 2585398513 229
151 iso_pu_bacteria 2585427526 2585528355 229
152 iso_pu_bacteria 2585427527 2585536534 229
153 iso_pu_bacteria 2585427528 2585539743 229
154 iso_pu_bacteria 2585427529 2585550470 229
155 iso_pu_bacteria 2585427530 2585557012 229
156 iso_pu_bacteria 2585427531 2585560146 229
157 iso_pu_bacteria 2585427590 2585819340 229
158 iso_pu_bacteria 2585427593 2585837728 229
159 iso_pu_bacteria 2585427594 2585844614 229
160 iso_pu_bacteria 2585427608 2585901582 229
161 iso_pu_bacteria 2585427609 2585905673 229
162 iso_pu_bacteria 2585428125 2587979211 229
163 iso_pu_bacteria 2599185170 2599419129 229
164 iso_pu_bacteria 2615840624 2616295722 229
165 iso_pu_bacteria 2615840626 2616306292 229
166 iso_pu_bacteria 2617270742 2617383706 229
167 iso_pu_bacteria 2643221599 2644007388 229
168 iso_pu_bacteria 2643221634 2644190638 229
169 iso_pu_bacteria 2643221643 2644241509 229
170 iso_pu_bacteria 2718217882 2719179622 229
171 iso_pu_bacteria 2718217927 2719384229 229
172 iso_pu_bacteria 2718217997 2719663966 229
173 iso_pu_bacteria 2718218009 2719730292 229
174 iso_pu_bacteria 2718218199 2720490385 229
175 iso_pu_bacteria 2718218232 2720611763 229
176 iso_pu_bacteria 2718218235 2720630019 229
177 iso_pu_bacteria 2718218269 2720773714 229
178 iso_pu_bacteria 2718218363 2721145715 229
179 iso_pu_bacteria 2718218365 2721157247 229
180 iso_pu_bacteria 2718218366 2721162594 229
181 iso_pu_bacteria 2718218423 2721397943 229
182 iso_pu_bacteria 2721755514 2722838764 229
183 iso_pu_bacteria 2721755556 2723025384 229
184 iso_pu_bacteria 2721755684 2723558967 229
185 iso_pu_bacteria 2721755685 2723565574 229
186 iso_pu_bacteria 2721755809 2724036753 229
187 iso_pu_bacteria 2721755810 2724043048 229
188 iso_pu_bacteria 2721755819 2724088321 229
189 iso_pu_bacteria 2721755822 2724102839 229
190 iso_pu_bacteria 2721755823 2724108706 229
191 iso_pu_bacteria 2724679232 2725950196 229
192 iso_pu_bacteria 2728369352 2730106320 229
193 iso_pu_bacteria 2728369365 2730162859 229
194 iso_pu_bacteria 2728369397 2730296879 229
195 iso_pu_bacteria 2738541293 2738803795 229
196 iso_pu_bacteria 2738541317 2738945614 229
197 iso_pu_bacteria 2738541333 2739034604 229
198 iso_pu_bacteria 2765235942 2766065651 229
199 iso_pu_bacteria 2775507266 2778174200 229
200 iso_pu_bacteria 2791355256 2793295164 229
201 iso_pu_bacteria 2791355259 2793315377 229
202 iso_pu_bacteria 2791355261 2793326102 229
203 iso_pu_bacteria 2791355262 2793332482 229
204 iso_pu_bacteria 2791355263 2793341753 229
205 iso_pu_bacteria 2791355264 2793350795 229
206 iso_pu_bacteria 2791355266 2793362721 229
207 iso_pu_bacteria 2791355267 2793364725 229
208 iso_pu_bacteria 2802429605 2805927533 229
209 iso_pu_bacteria 2802429606 2805932318 229
210 iso_pu_bacteria 2802429633 2806043901 229
211 iso_pu_bacteria 2802429636 2806067079 229
212 iso_pu_bacteria 2802429637 2806074823 229
213 iso_pu_bacteria 2818991453 2819643546 229
214 iso_pu_bacteria 2838016132 2838022181 229
215 iso_pu_bacteria 2838035591 2838037184 229
216 iso_pu_bacteria 2838042994 2838044366 229
217 iso_pu_bacteria 2838048938 2838051424 229
218 iso_pu_bacteria 2838061910 2838066631 229
219 iso_pu_bacteria 2838068647 2838073684 229
220 iso_pu_bacteria 2838661181 2838663627 229
221 iso_pu_bacteria 2838668709 2838672342 229
222 iso_pu_bacteria 2838680041 2838680636 229
223 iso_pu_bacteria 2838694306 2838695331 229
224 iso_pu_bacteria 2838701080 2838703915 229
225 iso_pu_bacteria 2838707686 2838708707 229
226 iso_pu_bacteria 2841864319 2841866761 229
227 iso_pu_bacteria 2842077413 2842080058 229
228 iso_pu_bacteria 2842110456 2842112257 229
229 iso_pu_bacteria 2842118031 2842120678 229
230 iso_pu_bacteria 2842146304 2842148293 229
231 iso_pu_bacteria 2842163707 2842170064 229
232 iso_pu_bacteria 2842205361 2842206877 229
233 iso_pu_bacteria 2842217011 2842218741 229
234 iso_pu_bacteria 2842237096 2842238119 229
235 iso_pu_bacteria 2842250916 2842253358 229
236 iso_pu_bacteria 2842264693 2842267390 229
237 iso_pu_bacteria 2842278818 2842280430 229
238 iso_pu_bacteria 2842285085 2842289377 229
239 iso_pu_bacteria 2842291075 2842293718 229
240 iso_pu_bacteria 2842298080 2842300839 229
241 iso_pu_bacteria 2842311132 2842312572 229
242 iso_pu_bacteria 2842317721 2842322605 229
243 iso_pu_bacteria 2842341865 2842343025 229
244 iso_pu_bacteria 2842357229 2842358041 229
245 iso_pu_bacteria 2842363717 2842367252 229
246 iso_pu_bacteria 2842370503 2842371099 229
247 iso_pu_bacteria 2842377471 2842380115 229
248 iso_pu_bacteria 2842384541 2842387186 229
249 iso_pu_bacteria 2842395702 2842401215 229
250 iso_pu_bacteria 2842402390 2842406725 229
251 iso_pu_bacteria 2842409023 2842413779 229
252 iso_pu_bacteria 2842415677 2842420259 229
253 iso_pu_bacteria 2842422224 2842427132 229
254 iso_pu_bacteria 2842428310 2842431358 229
255 iso_pu_bacteria 2842434925 2842437693 229
256 iso_pu_bacteria 2842441272 2842444508 229
257 iso_pu_bacteria 2842447887 2842450253 229
258 iso_pu_bacteria 2842462802 2842465664 229
259 iso_pu_bacteria 2842469257 2842472474 229
260 iso_pu_bacteria 2842482326 2842482383 229
261 iso_pu_bacteria 2842489311 2842492408 229
262 iso_pu_bacteria 2842495871 2842501967 229
263 iso_pu_bacteria 2842509118 2842509237 229
264 iso_pu_bacteria 2850079185 2850080086 229
265 iso_pu_bacteria 2852387548 2852388513 229
266 iso_pu_bacteria 2857516855 2857522139 229
267 iso_pu_bacteria 2913308742 2913310707 229
268 iso_pu_bacteria 2919100787 2919101301 229
269 iso_pu_bacteria 2919171160 2919172020 229
270 iso_pu_bacteria 2923556063 2923557233 229
271 iso_pu_bacteria 2933016740 2933019055 229
272 iso_pu_bacteria 2933586486 2933587586 229
273 iso_pu_bacteria 2933599457 2933604112 229
274 iso_pu_bacteria 2935894831 2935895854 229
275 iso_pu_bacteria 2935901341 2935907703 229
276 iso_pu_bacteria 2936367885 2936368874 229
277 iso_pu_bacteria 2936381700 2936383793 229
278 iso_pu_bacteria 2996887358 2996892144 229
279 iso_pu_bacteria 2996893221 2996893509 229
280 iso_pu_bacteria 3005409236 3005411266 229
281 iso_pu_bacteria 3005445848 3005446219 229
282 iso_pu_bacteria 3005452660 3005452874 229
283 iso_pu_bacteria 639633055 639646724 229
284 iso_pu_bacteria 8005258706 8005263529 229
285 iso_pu_bacteria 8005275841 8005278943 229
286 iso_pu_bacteria 8005282627 8005283632 229
287 iso_pu_bacteria 8005289223 8005291028 229
288 iso_pu_bacteria 8005301065 8005303897 229
289 iso_pu_bacteria 8005307578 8005308716 229
290 iso_pu_bacteria 8005321885 8005326671 229
291 iso_pu_bacteria 8005376324 8005377381 229
292 iso_pu_bacteria 8005382845 8005387239 229
293 iso_pu_bacteria 8005395548 8005401998 229
294 iso_pu_bacteria 8005430974 8005432984 229
295 iso_pu_bacteria 8005460587 8005461090 229
296 iso_pu_bacteria 8005497431 8005498708 229
297 iso_pu_bacteria 8005542996 8005543806 229
298 iso_pu_bacteria 8005556819 8005560684 229
299 iso_pu_bacteria 8005563573 8005569666 229
300 iso_pu_bacteria 8005570704 8005576979 229
301 iso_pu_bacteria 8005619151 8005619903 229
302 iso_pu_bacteria 8005626139 8005628500 229
303 iso_pu_bacteria 8005668836 8005670119 229
304 iso_pu_bacteria 8005688590 8005690325 229
305 iso_pu_bacteria 8005695170 8005700327 229
306 iso_pu_bacteria 8018127388 8018133183 229
307 iso_pu_bacteria 8018163183 8018167846 229
308 iso_pu_bacteria 8018176218 8018182078 229
309 iso_pu_bacteria 8024479707 8024480340 229
310 iso_pu_bacteria 8024486573 8024491388 229
311 iso_pu_bacteria 8024501048 8024503625 229
312 iso_pu_bacteria 8046767195 8046769901 229
313 iso_pu_bacteria 8056375014 8056375682 229
314 iso_pu_bacteria 8056382006 8056386007 229
315 iso_pu_bacteria 8056875544 8056879181 229
316 iso_pu_bacteria 8057575449 8057579911 229
317 3300002987 JGI25159J45721_1000279 JGI25159J45721_10002792 230
318 3300003354 JGI25160J50197_1000046 JGI25160J50197_100004679 230
319 3300003374 JGI25161J50226_1000031 JGI25161J50226_100003179 230
320 3300004625 Ga0055543_1000008 Ga0055543_1000008170 230
321 3300005262 Ga0065165_1000336 Ga0065165_100033643 230
322 3300005455 Ga0070663_100571756 Ga0070663_1005717561 230
323 3300013100 Ga0157373_10102545 Ga0157373_101025452 230
324 3300025284 Ga0209130_1000088 Ga0209130_100008825 230
325 3300025284 Ga0209130_1013890 Ga0209130_10138902 230
326 3300025284 Ga0209130_1025048 Ga0209130_10250482 230
327 3300025302 Ga0207426_1000012 Ga0207426_100001280 230
328 3300026067 Ga0207678_10599334 Ga0207678_105993342 230
329 3300032004 Ga0307414_10044780 Ga0307414_100447803 230
330 3300046507 Ga0495606_0002337 Ga0495606_0002337_4643_5362 230
331 3300048924 Ga0496121_0016422 Ga0496121_0016422_4533_5252 230
332 3300048928 Ga0496125_0305354 Ga0496125_0305354_49_825 230
333 iso_pu_bacteria 2511231052 2511500629 230
334 iso_pu_bacteria 2512047086 2512532055 230
335 iso_pu_bacteria 2512875026 2512972617 230
336 iso_pu_bacteria 2513237086 2513584209 230
337 iso_pu_bacteria 2513237089 2513602993 230
338 iso_pu_bacteria 2513237091 2513619196 230
339 iso_pu_bacteria 2513237140 2513880674 230
340 iso_pu_bacteria 2513237143 2513903387 230
341 iso_pu_bacteria 2513237156 2513989252 230
342 iso_pu_bacteria 2513237160 2514005266 230
343 iso_pu_bacteria 2515154107 2515607768 230
344 iso_pu_bacteria 2516143018 2516208509 230
345 iso_pu_bacteria 2516653046 2516891905 230
346 iso_pu_bacteria 2517487022 2517568718 230
347 iso_pu_bacteria 2524023207 2524449958 230
348 iso_pu_bacteria 2537561587 2537872846 230
349 iso_pu_bacteria 2551306084 2551681607 230
350 iso_pu_bacteria 2551306085 2551689127 230
351 iso_pu_bacteria 2551306086 2551694103 230
352 iso_pu_bacteria 2551306087 2551701771 230
353 iso_pu_bacteria 2551306089 2551709109 230
354 iso_pu_bacteria 2551306090 2551722435 230
355 iso_pu_bacteria 2551306091 2551729979 230
356 iso_pu_bacteria 2551306092 2551737331 230
357 iso_pu_bacteria 2551306093 2551742904 230
358 iso_pu_bacteria 2554235003 2554246649 230
359 iso_pu_bacteria 2558860242 2559293877 230
360 iso_pu_bacteria 2582581283 2585165046 230
361 iso_pu_bacteria 2582581306 2585270429 230
362 iso_pu_bacteria 2582581865 2585387762 230
363 iso_pu_bacteria 2599185210 2599605425 230
364 iso_pu_bacteria 2599185352 2600191507 230
365 iso_pu_bacteria 2600255279 2601609151 230
366 iso_pu_bacteria 2600255308 2601745926 230
367 iso_pu_bacteria 2643221557 2643807642 230
368 iso_pu_bacteria 2643221582 2643921136 230
369 iso_pu_bacteria 2643221607 2644047529 230
370 iso_pu_bacteria 2643221610 2644070054 230
371 iso_pu_bacteria 2643221618 2644103135 230
372 iso_pu_bacteria 2643221626 2644151935 230
373 iso_pu_bacteria 2643221636 2644206001 230
374 iso_pu_bacteria 2643221655 2644306062 230
375 iso_pu_bacteria 2643221659 2644330370 230
376 iso_pu_bacteria 2643221668 2644381025 230
377 iso_pu_bacteria 2643221675 2644414931 230
378 iso_pu_bacteria 2643221680 2644448588 230
379 iso_pu_bacteria 2643221686 2644480996 230
380 iso_pu_bacteria 2643221688 2644493814 230
381 iso_pu_bacteria 2643221689 2644496696 230
382 iso_pu_bacteria 2643221693 2644519209 230
383 iso_pu_bacteria 2643221698 2644542883 230
384 iso_pu_bacteria 2643221712 2644618987 230
385 iso_pu_bacteria 2643221723 2644673979 230
386 iso_pu_bacteria 2643221726 2644689104 230
387 iso_pu_bacteria 2657244999 2657681946 230
388 iso_pu_bacteria 2791355082 2792583799 230
389 iso_pu_bacteria 2791355091 2792622408 230
390 iso_pu_bacteria 2791355092 2792628024 230
391 iso_pu_bacteria 2791355094 2792638719 230
392 iso_pu_bacteria 2791355253 2793282008 230
393 iso_pu_bacteria 2802428858 2802720242 230
394 iso_pu_bacteria 2802428859 2802726063 230
395 iso_pu_bacteria 2802428860 2802731766 230
396 iso_pu_bacteria 2802428861 2802739517 230
397 iso_pu_bacteria 2802428862 2802742666 230
398 iso_pu_bacteria 2802428863 2802749370 230
399 iso_pu_bacteria 2802429268 2804750965 230
400 iso_pu_bacteria 2808606387 2808986347 230
401 iso_pu_bacteria 2818991439 2819556479 230
402 iso_pu_bacteria 2838074704 2838075413 230
403 iso_pu_bacteria 2838675328 2838677208 230
404 iso_pu_bacteria 2838714209 2838716096 230
405 iso_pu_bacteria 2838719591 2838720104 230
406 iso_pu_bacteria 2838724970 2838726848 230
407 iso_pu_bacteria 2841846520 2841847038 230
408 iso_pu_bacteria 2841859092 2841860433 230
409 iso_pu_bacteria 2842124991 2842126933 230
410 iso_pu_bacteria 2842130223 2842132101 230
411 iso_pu_bacteria 2842152218 2842152730 230
412 iso_pu_bacteria 2842170452 2842172341 230
413 iso_pu_bacteria 2842175837 2842176349 230
414 iso_pu_bacteria 2842187318 2842189203 230
415 iso_pu_bacteria 2842211629 2842213517 230
416 iso_pu_bacteria 2842224351 2842224865 230
417 iso_pu_bacteria 2842515876 2842517218 230
418 iso_pu_bacteria 2844163670 2844170703 230
419 iso_pu_bacteria 2848992105 2848992567 230
420 iso_pu_bacteria 2854896431 2854898334 230
421 iso_pu_bacteria 2854916844 2854919047 230
422 iso_pu_bacteria 2855825444 2855831824 230
423 iso_pu_bacteria 2855839649 2855840110 230
424 iso_pu_bacteria 2855872281 2855873122 230
425 iso_pu_bacteria 2858800743 2858804017 230
426 iso_pu_bacteria 2896384573 2896387452 230
427 iso_pu_bacteria 2899792073 2899792499 230
428 iso_pu_bacteria 2899845264 2899847912 230
429 iso_pu_bacteria 2913295892 2913297928 230
430 iso_pu_bacteria 2915980308 2915980849 230
431 iso_pu_bacteria 2915986958 2915990825 230
432 iso_pu_bacteria 2915993759 2915999626 230
433 iso_pu_bacteria 2916000859 2916007211 230
434 iso_pu_bacteria 2916007675 2916008980 230
435 iso_pu_bacteria 2916014648 2916019767 230
436 iso_pu_bacteria 2916021584 2916022584 230
437 iso_pu_bacteria 2916028427 2916029087 230
438 iso_pu_bacteria 2916035215 2916039843 230
439 iso_pu_bacteria 2916055098 2916060135 230
440 iso_pu_bacteria 2916061851 2916065930 230
441 iso_pu_bacteria 2916068649 2916073606 230
442 iso_pu_bacteria 2919114240 2919116299 230
443 iso_pu_bacteria 2920760137 2920763276 230
444 iso_pu_bacteria 2920822456 2920823425 230
445 iso_pu_bacteria 2921201388 2921204390 230
446 iso_pu_bacteria 2921208531 2921214984 230
447 iso_pu_bacteria 2921237296 2921239946 230
448 iso_pu_bacteria 2921244191 2921245154 230
449 iso_pu_bacteria 2921250672 2921257087 230
450 iso_pu_bacteria 2921257292 2921260257 230
451 iso_pu_bacteria 2921263974 2921268996 230
452 iso_pu_bacteria 2921282425 2921286635 230
453 iso_pu_bacteria 2921289301 2921291894 230
454 iso_pu_bacteria 2921296804 2921298896 230
455 iso_pu_bacteria 2924144063 2924146098 230
456 iso_pu_bacteria 2924150972 2924153839 230
457 iso_pu_bacteria 2924158325 2924163556 230
458 iso_pu_bacteria 2924165586 2924165934 230
459 iso_pu_bacteria 2924172951 2924178236 230
460 iso_pu_bacteria 2924179722 2924185621 230
461 iso_pu_bacteria 2924186466 2924191865 230
462 iso_pu_bacteria 2924193448 2924194245 230
463 iso_pu_bacteria 2924200457 2924202484 230
464 iso_pu_bacteria 2924207177 2924209716 230
465 iso_pu_bacteria 2924214083 2924215107 230
466 iso_pu_bacteria 2924221636 2924226426 230
467 iso_pu_bacteria 2924228884 2924232515 230
468 iso_pu_bacteria 2926754445 2926757253 230
469 iso_pu_bacteria 2926760298 2926761467 230
470 iso_pu_bacteria 2933006813 2933007375 230
471 iso_pu_bacteria 2933011516 2933012139 230
472 iso_pu_bacteria 2933594066 2933594584 230
473 iso_pu_bacteria 2936996657 2936999749 230
474 iso_pu_bacteria 2937002841 2937004999 230
475 iso_pu_bacteria 2937009748 2937011280 230
476 iso_pu_bacteria 2937016420 2937021026 230
477 iso_pu_bacteria 2937023124 2937023909 230
478 iso_pu_bacteria 2937029754 2937035597 230
479 iso_pu_bacteria 2937036028 2937041381 230
480 iso_pu_bacteria 2937042894 2937048669 230
481 iso_pu_bacteria 2937049772 2937053936 230
482 iso_pu_bacteria 2937056579 2937060495 230
483 iso_pu_bacteria 2937063883 2937070091 230
484 iso_pu_bacteria 2937071275 2937071472 230
485 iso_pu_bacteria 2937078374 2937082761 230
486 iso_pu_bacteria 2937098957 2937103386 230
487 iso_pu_bacteria 2937106411 2937112658 230
488 iso_pu_bacteria 2937113482 2937114619 230
489 iso_pu_bacteria 2937119839 2937122539 230
490 iso_pu_bacteria 2937126314 2937128416 230
491 iso_pu_bacteria 2941499720 2941500666 230
492 iso_pu_bacteria 2957375807 2957381993 230
493 iso_pu_bacteria 2957382221 2957383735 230
494 iso_pu_bacteria 2957388812 2957394129 230
495 iso_pu_bacteria 2957395598 2957399469 230
496 iso_pu_bacteria 2957402308 2957403783 230
497 iso_pu_bacteria 2957408893 2957410990 230
498 iso_pu_bacteria 2957415311 2957421621 230
499 iso_pu_bacteria 2957422303 2957424941 230
500 iso_pu_bacteria 2957430029 2957435485 230
501 iso_pu_bacteria 2957437181 2957442402 230
502 iso_pu_bacteria 2957443900 2957447044 230
503 iso_pu_bacteria 2957450854 2957457376 230
504 iso_pu_bacteria 2957457609 2957464354 230
505 iso_pu_bacteria 2957464669 2957466136 230
506 iso_pu_bacteria 2957471148 2957473867 230
507 iso_pu_bacteria 2957478035 2957482930 230
508 iso_pu_bacteria 2957484790 2957490233 230
509 iso_pu_bacteria 2957491536 2957496384 230
510 iso_pu_bacteria 2957498199 2957501963 230
511 iso_pu_bacteria 2957505466 2957511505 230
512 iso_pu_bacteria 2960584000 2960589107 230
513 iso_pu_bacteria 2960591022 2960594836 230
514 iso_pu_bacteria 2960597568 2960599691 230
515 iso_pu_bacteria 2960603979 2960605497 230
516 iso_pu_bacteria 2960617483 2960621810 230
517 iso_pu_bacteria 2960631154 2960637392 230
518 iso_pu_bacteria 2960637947 2960644743 230
519 iso_pu_bacteria 2960645483 2960651797 230
520 iso_pu_bacteria 2960652885 2960653211 230
521 iso_pu_bacteria 2960660292 2960660327 230
522 iso_pu_bacteria 2960667422 2960668378 230
523 iso_pu_bacteria 2960674078 2960675639 230
524 iso_pu_bacteria 2960680706 2960686675 230
525 iso_pu_bacteria 2960693952 2960700750 230
526 iso_pu_bacteria 2964607997 2964609422 230
527 iso_pu_bacteria 2964615318 2964619898 230
528 iso_pu_bacteria 2964621998 2964627442 230
529 iso_pu_bacteria 2964628898 2964634381 230
530 iso_pu_bacteria 2964636051 2964636361 230
531 iso_pu_bacteria 2964643177 2964648195 230
532 iso_pu_bacteria 2964649959 2964650393 230
533 iso_pu_bacteria 2964656573 2964660387 230
534 iso_pu_bacteria 2964663802 2964665861 230
535 iso_pu_bacteria 2964670856 2964676354 230
536 iso_pu_bacteria 2964678106 2964680668 230
537 iso_pu_bacteria 2964685014 2964687973 230
538 iso_pu_bacteria 2964691889 2964692993 230
539 iso_pu_bacteria 2964698721 2964700591 230
540 iso_pu_bacteria 2964705432 2964711290 230
541 iso_pu_bacteria 2964712639 2964714720 230
542 iso_pu_bacteria 2964719344 2964719843 230
543 iso_pu_bacteria 2967664464 2967670343 230
544 iso_pu_bacteria 2967671571 2967674290 230
545 iso_pu_bacteria 2967678726 2967685019 230
546 iso_pu_bacteria 2967686174 2967691590 230
547 iso_pu_bacteria 2967693043 2967695132 230
548 iso_pu_bacteria 2967699805 2967705132 230
549 iso_pu_bacteria 2967706974 2967712823 230
550 iso_pu_bacteria 2967714385 2967714724 230
551 iso_pu_bacteria 2967721400 2967724222 230
552 iso_pu_bacteria 2967728569 2967730629 230
553 iso_pu_bacteria 2967735183 2967736269 230
554 iso_pu_bacteria 2967742019 2967744037 230
555 iso_pu_bacteria 2967748971 2967751799 230
556 iso_pu_bacteria 2967755722 2967761387 230
557 iso_pu_bacteria 2967762386 2967762625 230
558 iso_pu_bacteria 2967769361 2967771256 230
559 iso_pu_bacteria 2967775926 2967778335 230
560 iso_pu_bacteria 2970019648 2970025650 230
561 iso_pu_bacteria 2970026789 2970030645 230
562 iso_pu_bacteria 2970033650 2970033974 230
563 iso_pu_bacteria 2970040964 2970045551 230
564 iso_pu_bacteria 2970047711 2970052570 230
565 iso_pu_bacteria 2970054988 2970057372 230
566 iso_pu_bacteria 2970061556 2970063916 230
567 iso_pu_bacteria 2970068827 2970071416 230
568 iso_pu_bacteria 2970076120 2970080544 230
569 iso_pu_bacteria 2970082768 2970086064 230
570 iso_pu_bacteria 2970088815 2970091221 230
571 iso_pu_bacteria 2970095765 2970101561 230
572 iso_pu_bacteria 2970102677 2970103455 230
573 iso_pu_bacteria 2970109326 2970116001 230
574 iso_pu_bacteria 2970116247 2970118460 230
575 iso_pu_bacteria 2970122695 2970125999 230
576 iso_pu_bacteria 2970129317 2970131630 230
577 iso_pu_bacteria 2970136068 2970142372 230
578 iso_pu_bacteria 2970143518 2970148611 230
579 iso_pu_bacteria 2970149975 2970153956 230
580 iso_pu_bacteria 2970156795 2970162695 230
581 iso_pu_bacteria 2970164137 2970167661 230
582 iso_pu_bacteria 2970170962 2970174211 230
583 iso_pu_bacteria 2970184632 2970190519 230
584 iso_pu_bacteria 2970191845 2970194971 230
585 iso_pu_bacteria 2977523885 2977529076 230
586 iso_pu_bacteria 2977530762 2977535932 230
587 iso_pu_bacteria 2977537788 2977540035 230
588 iso_pu_bacteria 2977544691 2977549400 230
589 iso_pu_bacteria 2977551784 2977552868 230
590 iso_pu_bacteria 2977558990 2977559232 230
591 iso_pu_bacteria 2977565890 2977567568 230
592 iso_pu_bacteria 2977572785 2977573098 230
593 iso_pu_bacteria 2977579622 2977580499 230
594 iso_pu_bacteria 2979089926 2979093245 230
595 iso_pu_bacteria 2979095461 2979099370 230
596 iso_pu_bacteria 2979100975 2979105215 230
597 iso_pu_bacteria 2984509177 2984512929 230
598 iso_pu_bacteria 2984518228 2984520707 230
599 iso_pu_bacteria 2984537506 2984539999 230
600 iso_pu_bacteria 2984601300 2984602190 230
601 iso_pu_bacteria 643692032 643824581 230
602 iso_pu_bacteria 648276728 648739418 230
603 iso_pu_bacteria 650716007 650739067 230
604 iso_pu_bacteria 8003570095 8003572699 230
605 iso_pu_bacteria 8003992118 8003992522 230
606 iso_pu_bacteria 8003999396 8003999847 230
607 iso_pu_bacteria 8049293176 8049293542 230
608 3300028794 Ga0307515_10009097 Ga0307515_1000909717 231
609 3300031730 Ga0307516_10225197 Ga0307516_102251972 231
610 3300046492 Ga0495585_0033324 Ga0495585_0033324_530_1249 231
611 3300046506 Ga0495583_0032223 Ga0495583_0032223_1775_2494 231
612 3300046558 Ga0495633_0037453 Ga0495633_0037453_85_804 231
613 3300046615 Ga0495656_0008267 Ga0495656_0008267_1810_2529 231
614 3300046660 Ga0495625_0376783 Ga0495625_0376783_143_862 231
615 3300047470 Ga0495681_0038553 Ga0495681_0038553_1459_2178 231
616 3300049570 Ga0501033_0342965 Ga0501033_0342965_139_867 231
617 3300053158 Ga0500627_0100520 Ga0500627_0100520_246_965 231
618 iso_pu_bacteria 2513237159 2513999790 231
619 iso_pu_bacteria 2582581866 2585397930 231
620 iso_pu_bacteria 2842521101 2842526362 231
621 3300006051 Ga0075364_10003332 Ga0075364_100033325 232
622 3300037418 Ga0395900_0116748 Ga0395900_0116748_1229_1987 232
623 3300037471 Ga0395905_0085445 Ga0395905_0085445_1506_2264 232
624 3300046460 Ga0495638_0000299 Ga0495638_0000299_15374_16093 232
625 3300047320 Ga0495672_0050007 Ga0495672_0050007_1592_2311 232
626 3300048924 Ga0496121_0000581 Ga0496121_0000581_35367_36125 232
627 3300049568 Ga0501031_0022842 Ga0501031_0022842_2611_3342 232
628 3300049569 Ga0501032_0104415 Ga0501032_0104415_583_1314 232
629 3300049570 Ga0501033_0048336 Ga0501033_0048336_1885_2616 232
630 3300049571 Ga0501034_0521871 Ga0501034_0521871_278_1009 232
631 3300049572 Ga0501036_0156444 Ga0501036_0156444_922_1653 232
632 3300049573 Ga0501037_0189300 Ga0501037_0189300_418_1149 232
633 3300049574 Ga0501038_0113992 Ga0501038_0113992_754_1485 232
634 3300049575 Ga0501039_0416141 Ga0501039_0416141_55_786 232
635 3300049823 Ga0501044_0103576 Ga0501044_0103576_1404_2135 232
636 3300050491 nmdc:mga00v17_133_c2 nmdc:mga00v17_133_c2_33347_34105 232
637 3300053086 Ga0500578_0131405 Ga0500578_0131405_768_1487 232
638 3300053098 Ga0500650_0234212 Ga0500650_0234212_90_809 232
639 3300053139 Ga0500568_0001239 Ga0500568_0001239_4696_5415 232
640 3300053142 Ga0500577_0037699 Ga0500577_0037699_847_1566 232
641 3300053153 Ga0500616_0002540 Ga0500616_0002540_7626_8345 232
642 iso_pu_bacteria 2599185156 2599333087 232
643 iso_pu_bacteria 2599185236 2599719514 232
644 iso_pu_bacteria 2643221653 2644297532 232
645 iso_pu_bacteria 2643221719 2644655785 232
646 iso_pu_bacteria 2818991272 2819243193 232
647 iso_pu_bacteria 2821123053 2821123683 232
648 iso_pu_bacteria 2838736955 2838739286 232
649 iso_pu_bacteria 2841840854 2841843184 232
650 iso_pu_bacteria 2842140634 2842142966 232
651 iso_pu_bacteria 2842922631 2842923390 232
652 iso_pu_bacteria 2857531043 2857531245 232
653 iso_pu_bacteria 2929138655 2929139000 232
654 iso_pu_bacteria 2989776772 2989777551 232
655 iso_pu_bacteria 8005246636 8005247286 232
656 3300002737 JGI25162J39368_1002465 JGI25162J39368_10024653 233
657 3300002739 JGI25158J39367_1000091 JGI25158J39367_10000915 233
658 3300002773 JGI25152J39213_1001312 JGI25152J39213_100131212 233
659 3300002773 JGI25152J39213_1006131 JGI25152J39213_10061312 233
660 3300002773 JGI25152J39213_1006498 JGI25152J39213_10064983 233
661 3300002773 JGI25152J39213_1006580 JGI25152J39213_10065803 233
662 3300002773 JGI25152J39213_1006969 JGI25152J39213_10069692 233
663 3300002774 JGI25150J39212_1000012 JGI25150J39212_1000012173 233
664 3300002774 JGI25150J39212_1010852 JGI25150J39212_10108522 233
665 3300002987 JGI25159J45721_1000452 JGI25159J45721_100045213 233
666 3300003187 JGI25151J46595_10000025 JGI25151J46595_10000025213 233
667 3300003187 JGI25151J46595_10000250 JGI25151J46595_1000025032 233
668 3300003187 JGI25151J46595_10002596 JGI25151J46595_1000259612 233
669 3300003187 JGI25151J46595_10009171 JGI25151J46595_100091718 233
670 3300003214 JGI25165J46597_1000736 JGI25165J46597_100073624 233
671 3300003215 JGI25153J46596_10000232 JGI25153J46596_1000023212 233
672 3300003215 JGI25153J46596_10004357 JGI25153J46596_100043576 233
673 3300003215 JGI25153J46596_10015083 JGI25153J46596_100150833 233
674 3300003215 JGI25153J46596_10015309 JGI25153J46596_100153093 233
675 3300003215 JGI25153J46596_10041298 JGI25153J46596_100412982 233
676 3300003322 rootL2_10172147 rootL2_101721471 233
677 3300003323 rootH1_10134546 rootH1_101345463 233
678 3300003354 JGI25160J50197_1010015 JGI25160J50197_10100153 233
679 3300003354 JGI25160J50197_1017151 JGI25160J50197_10171512 233
680 3300003354 JGI25160J50197_1031512 JGI25160J50197_10315122 233
681 3300003374 JGI25161J50226_1000074 JGI25161J50226_100007453 233
682 3300003693 Ga0032354_1119851 Ga0032354_11198512 233
683 3300003771 Ga0055526_1002214 Ga0055526_100221411 233
684 3300003771 Ga0055526_1007940 Ga0055526_10079405 233
685 3300003771 Ga0055526_1022727 Ga0055526_10227272 233
686 3300003775 Ga0055524_1007477 Ga0055524_10074771 233
687 3300003775 Ga0055524_1007645 Ga0055524_10076452 233
688 3300003775 Ga0055524_1011853 Ga0055524_10118534 233
689 3300003775 Ga0055524_1015300 Ga0055524_10153003 233
690 3300003775 Ga0055524_1029137 Ga0055524_10291371 233
691 3300003781 Ga0055536_1010507 Ga0055536_10105072 233
692 3300003790 Ga0055528_1000146 Ga0055528_100014615 233
693 3300003790 Ga0055528_1000897 Ga0055528_100089721 233
694 3300003790 Ga0055528_1002867 Ga0055528_10028677 233
695 3300003790 Ga0055528_1003099 Ga0055528_10030993 233
696 3300003790 Ga0055528_1007193 Ga0055528_10071934 233
697 3300003791 Ga0055530_10016453 Ga0055530_100164532 233
698 3300003792 Ga0055540_1000111 Ga0055540_100011149 233
699 3300003792 Ga0055540_1003680 Ga0055540_10036803 233
700 3300003794 Ga0055531_10007389 Ga0055531_100073896 233
701 3300004625 Ga0055543_1000188 Ga0055543_100018826 233
702 3300004625 Ga0055543_1002371 Ga0055543_10023711 233
703 3300005262 Ga0065165_1024971 Ga0065165_10249712 233
704 3300005331 Ga0070670_100000173 Ga0070670_10000017334 233
705 3300005335 Ga0070666_10125356 Ga0070666_101253563 233
706 3300005337 Ga0070682_100234782 Ga0070682_1002347821 233
707 3300005347 Ga0070668_100068615 Ga0070668_1000686153 233
708 3300005353 Ga0070669_100244162 Ga0070669_1002441622 233
709 3300005355 Ga0070671_100016028 Ga0070671_1000160285 233
710 3300005455 Ga0070663_100665479 Ga0070663_1006654791 233
711 3300005548 Ga0070665_100254820 Ga0070665_1002548202 233
712 3300005563 Ga0068855_100092975 Ga0068855_1000929752 233
713 3300006038 Ga0075365_10017717 Ga0075365_100177174 233
714 3300006042 Ga0075368_10063483 Ga0075368_100634832 233
715 3300006048 Ga0075363_100270358 Ga0075363_1002703582 233
716 3300006177 Ga0075362_10026468 Ga0075362_100264683 233
717 3300006178 Ga0075367_10000511 Ga0075367_1000051116 233
718 3300006186 Ga0075369_10028887 Ga0075369_100288873 233
719 3300006186 Ga0075369_10105297 Ga0075369_101052972 233
720 3300006195 Ga0075366_10012030 Ga0075366_100120303 233
721 3300006195 Ga0075366_10204972 Ga0075366_102049722 233
722 3300006353 Ga0075370_10001381 Ga0075370_1000138111 233
723 3300006353 Ga0075370_10045976 Ga0075370_100459762 233
724 3300009011 Ga0105251_10075825 Ga0105251_100758252 233
725 3300009036 Ga0105244_10199038 Ga0105244_101990381 233
726 3300009093 Ga0105240_10000278 Ga0105240_1000027858 233
727 3300009545 Ga0105237_10000434 Ga0105237_1000043445 233
728 3300009553 Ga0105249_10295169 Ga0105249_102951693 233
729 3300009765 Ga0123341_1000175 Ga0123341_100017526 233
730 3300009766 Ga0123342_1003939 Ga0123342_10039398 233
731 3300009766 Ga0123342_1031762 Ga0123342_10317623 233
732 3300010375 Ga0105239_10018500 Ga0105239_100185008 233
733 3300013104 Ga0157370_10147765 Ga0157370_101477652 233
734 3300013306 Ga0163162_10900840 Ga0163162_109008402 233
735 3300021327 Ga0214543_1000003 Ga0214543_100000379 233
736 3300025208 Ga0209436_100650 Ga0209436_10065015 233
737 3300025231 Ga0207427_104809 Ga0207427_1048092 233
738 3300025233 Ga0209437_100086 Ga0209437_100086189 233
739 3300025245 Ga0207425_1000012 Ga0207425_1000012376 233
740 3300025245 Ga0207425_1001893 Ga0207425_10018933 233
741 3300025245 Ga0207425_1005185 Ga0207425_10051853 233
742 3300025245 Ga0207425_1009121 Ga0207425_10091212 233
743 3300025245 Ga0207425_1045443 Ga0207425_10454431 233
744 3300025253 Ga0209677_101617 Ga0209677_1016172 233
745 3300025258 Ga0209129_1000086 Ga0209129_1000086165 233
746 3300025258 Ga0209129_1000123 Ga0209129_100012385 233
747 3300025258 Ga0209129_1000261 Ga0209129_100026149 233
748 3300025258 Ga0209129_1000316 Ga0209129_100031644 233
749 3300025258 Ga0209129_1000563 Ga0209129_100056314 233
750 3300025258 Ga0209129_1001248 Ga0209129_10012488 233
751 3300025258 Ga0209129_1004964 Ga0209129_10049643 233
752 3300025261 Ga0209233_1000110 Ga0209233_100011058 233
753 3300025261 Ga0209233_1000465 Ga0209233_100046524 233
754 3300025273 Ga0209673_1000015 Ga0209673_1000015330 233
755 3300025273 Ga0209673_1000091 Ga0209673_1000091192 233
756 3300025273 Ga0209673_1000874 Ga0209673_100087440 233
757 3300025273 Ga0209673_1000919 Ga0209673_10009192 233
758 3300025273 Ga0209673_1000969 Ga0209673_100096936 233
759 3300025273 Ga0209673_1003237 Ga0209673_10032375 233
760 3300025273 Ga0209673_1004304 Ga0209673_10043046 233
761 3300025273 Ga0209673_1012686 Ga0209673_10126863 233
762 3300025284 Ga0209130_1000002 Ga0209130_100000228 233
763 3300025294 Ga0209025_1000024 Ga0209025_1000024376 233
764 3300025294 Ga0209025_1000407 Ga0209025_100040745 233
765 3300025294 Ga0209025_1001595 Ga0209025_100159517 233
766 3300025294 Ga0209025_1003038 Ga0209025_100303814 233
767 3300025294 Ga0209025_1008383 Ga0209025_10083835 233
768 3300025295 Ga0209564_1000845 Ga0209564_10008455 233
769 3300025295 Ga0209564_1006326 Ga0209564_10063265 233
770 3300025295 Ga0209564_1008515 Ga0209564_10085156 233
771 3300025295 Ga0209564_1016448 Ga0209564_10164483 233
772 3300025295 Ga0209564_1020120 Ga0209564_10201201 233
773 3300025297 Ga0209758_1000046 Ga0209758_1000046165 233
774 3300025297 Ga0209758_1000336 Ga0209758_100033643 233
775 3300025297 Ga0209758_1000602 Ga0209758_100060237 233
776 3300025297 Ga0209758_1000877 Ga0209758_100087744 233
777 3300025297 Ga0209758_1001026 Ga0209758_100102629 233
778 3300025297 Ga0209758_1001612 Ga0209758_100161222 233
779 3300025297 Ga0209758_1002567 Ga0209758_10025677 233
780 3300025297 Ga0209758_1025459 Ga0209758_10254593 233
781 3300025298 Ga0209050_1012596 Ga0209050_10125963 233
782 3300025299 Ga0209256_1002068 Ga0209256_10020685 233
783 3300025299 Ga0209256_1002341 Ga0209256_100234115 233
784 3300025299 Ga0209256_1009020 Ga0209256_10090203 233
785 3300025299 Ga0209256_1013913 Ga0209256_10139133 233
786 3300025299 Ga0209256_1014331 Ga0209256_10143314 233
787 3300025302 Ga0207426_1000013 Ga0207426_100001328 233
788 3300025302 Ga0207426_1000063 Ga0207426_1000063164 233
789 3300025302 Ga0207426_1000172 Ga0207426_1000172140 233
790 3300025302 Ga0207426_1001284 Ga0207426_10012848 233
791 3300025303 Ga0209051_1000084 Ga0209051_100008486 233
792 3300025303 Ga0209051_1001391 Ga0209051_10013912 233
793 3300025303 Ga0209051_1008848 Ga0209051_10088484 233
794 3300025303 Ga0209051_1015068 Ga0209051_10150683 233
795 3300025303 Ga0209051_1022502 Ga0209051_10225021 233
796 3300025303 Ga0209051_1069412 Ga0209051_10694122 233
797 3300025304 Ga0209257_1002244 Ga0209257_10022444 233
798 3300025304 Ga0209257_1004073 Ga0209257_100407312 233
799 3300025304 Ga0209257_1005200 Ga0209257_10052001 233
800 3300025903 Ga0207680_10303088 Ga0207680_103030881 233
801 3300025913 Ga0207695_10000376 Ga0207695_1000037658 233
802 3300025914 Ga0207671_10000732 Ga0207671_1000073229 233
803 3300025923 Ga0207681_10247304 Ga0207681_102473042 233
804 3300025924 Ga0207694_10464385 Ga0207694_104643852 233
805 3300025925 Ga0207650_10000899 Ga0207650_100008997 233
806 3300025931 Ga0207644_10209249 Ga0207644_102092492 233
807 3300025949 Ga0207667_10123293 Ga0207667_101232932 233
808 3300025972 Ga0207668_10053591 Ga0207668_100535912 233
809 3300026078 Ga0207702_10217381 Ga0207702_102173813 233
810 3300027866 Ga0209813_10035055 Ga0209813_100350552 233
811 3300028379 Ga0268266_10186252 Ga0268266_101862522 233
812 3300028794 Ga0307515_10123040 Ga0307515_101230404 233
813 3300031456 Ga0307513_10020729 Ga0307513_100207299 233
814 3300031456 Ga0307513_10091461 Ga0307513_100914612 233
815 3300031456 Ga0307513_10357983 Ga0307513_103579832 233
816 3300031731 Ga0307405_10000238 Ga0307405_1000023813 233
817 3300031901 Ga0307406_10007930 Ga0307406_100079304 233
818 3300031911 Ga0307412_10001286 Ga0307412_100012863 233
819 3300037471 Ga0395905_0001437 Ga0395905_0001437_2704_3441 233
820 3300041413 Ga0439465_0011616 Ga0439465_0011616_1286_2005 233
821 3300041413 Ga0439465_0097784 Ga0439465_0097784_241_960 233
822 3300041451 Ga0451791_0134167 Ga0451791_0134167_200_925 233
823 3300041452 Ga0451793_1870052 Ga0451793_1870052_102_821 233
824 3300041491 Ga0451833_0936012 Ga0451833_0936012_924_1643 233
825 3300042007 Ga0439449_0064885 Ga0439449_0064885_130_849 233
826 3300046452 Ga0495617_011491 Ga0495617_011491_342_1061 233
827 3300046459 Ga0495629_0040231 Ga0495629_0040231_1296_2015 233
828 3300046460 Ga0495638_0068400 Ga0495638_0068400_1270_1989 233
829 3300046474 Ga0495605_0001136 Ga0495605_0001136_13213_13932 233
830 3300046474 Ga0495605_0020073 Ga0495605_0020073_1612_2331 233
831 3300046476 Ga0495662_0004594 Ga0495662_0004594_1019_1738 233
832 3300046477 Ga0495664_0142665 Ga0495664_0142665_597_1316 233
833 3300046492 Ga0495585_0002346 Ga0495585_0002346_11417_12136 233
834 3300046492 Ga0495585_0018083 Ga0495585_0018083_2715_3434 233
835 3300046501 Ga0495607_0062253 Ga0495607_0062253_179_898 233
836 3300046501 Ga0495607_0133023 Ga0495607_0133023_99_818 233
837 3300046512 Ga0495610_0010591 Ga0495610_0010591_4453_5172 233
838 3300046512 Ga0495610_0012554 Ga0495610_0012554_1562_2281 233
839 3300046513 Ga0495616_0057635 Ga0495616_0057635_167_886 233
840 3300046516 Ga0495628_0163430 Ga0495628_0163430_887_1606 233
841 3300046518 Ga0495631_0001476 Ga0495631_0001476_1546_2265 233
842 3300046519 Ga0495632_0003334 Ga0495632_0003334_2030_2749 233
843 3300046519 Ga0495632_0061334 Ga0495632_0061334_134_853 233
844 3300046522 Ga0495643_0014063 Ga0495643_0014063_151_870 233
845 3300046522 Ga0495643_0103461 Ga0495643_0103461_485_1204 233
846 3300046524 Ga0495648_0013983 Ga0495648_0013983_1383_2102 233
847 3300046524 Ga0495648_0216810 Ga0495648_0216810_68_787 233
848 3300046529 Ga0495652_0102353 Ga0495652_0102353_1114_1833 233
849 3300046530 Ga0495654_0033571 Ga0495654_0033571_1405_2124 233
850 3300046536 Ga0495587_0353200 Ga0495587_0353200_56_775 233
851 3300046616 Ga0495668_0003147 Ga0495668_0003147_8378_9097 233
852 3300046616 Ga0495668_0088436 Ga0495668_0088436_354_1073 233
853 3300046616 Ga0495668_0238704 Ga0495668_0238704_170_889 233
854 3300046648 Ga0495611_0029401 Ga0495611_0029401_133_852 233
855 3300046660 Ga0495625_0003388 Ga0495625_0003388_5462_6181 233
856 3300046660 Ga0495625_0040840 Ga0495625_0040840_1602_2321 233
857 3300046665 Ga0495661_0050965 Ga0495661_0050965_784_1503 233
858 3300046674 Ga0495588_0013033 Ga0495588_0013033_640_1359 233
859 3300046691 Ga0495670_0008868 Ga0495670_0008868_1539_2258 233
860 3300046694 Ga0495649_0012442 Ga0495649_0012442_3746_4465 233
861 3300046809 Ga0495600_0217550 Ga0495600_0217550_202_921 233
862 3300046810 Ga0495660_0013688 Ga0495660_0013688_765_1484 233
863 3300046810 Ga0495660_0070213 Ga0495660_0070213_42_761 233
864 3300046810 Ga0495660_0104396 Ga0495660_0104396_626_1345 233
865 3300047317 Ga0495604_0064028 Ga0495604_0064028_344_1063 233
866 3300047323 Ga0495683_0096851 Ga0495683_0096851_525_1244 233
867 3300047323 Ga0495683_0097313 Ga0495683_0097313_572_1291 233
868 3300047443 Ga0495687_010244 Ga0495687_010244_4259_4978 233
869 3300047469 Ga0495673_0088739 Ga0495673_0088739_343_1062 233
870 3300047470 Ga0495681_0089273 Ga0495681_0089273_549_1268 233
871 3300047472 Ga0495686_0000688 Ga0495686_0000688_1770_2489 233
872 3300047472 Ga0495686_0062690 Ga0495686_0062690_405_1124 233
873 3300047472 Ga0495686_0183906 Ga0495686_0183906_254_973 233
874 3300048091 Ga0495626_0053767 Ga0495626_0053767_962_1681 233
875 3300048904 Ga0496101_0079097 Ga0496101_0079097_1539_2258 233
876 3300048907 Ga0496104_0265369 Ga0496104_0265369_66_845 233
877 3300048909 Ga0496106_0000259 Ga0496106_0000259_9864_10583 233
878 3300048917 Ga0496114_0081196 Ga0496114_0081196_435_1154 233
879 3300048919 Ga0496116_0001010 Ga0496116_0001010_7271_7990 233
880 3300048919 Ga0496116_0007988 Ga0496116_0007988_6774_7493 233
881 3300048919 Ga0496116_0051203 Ga0496116_0051203_823_1542 233
882 3300048919 Ga0496116_0169880 Ga0496116_0169880_296_1075 233
883 3300048921 Ga0496118_0016899 Ga0496118_0016899_3969_4688 233
884 3300048921 Ga0496118_0061651 Ga0496118_0061651_1474_2193 233
885 3300048921 Ga0496118_0120771 Ga0496118_0120771_682_1401 233
886 3300048924 Ga0496121_0008494 Ga0496121_0008494_6174_6893 233
887 3300048924 Ga0496121_0020886 Ga0496121_0020886_3773_4492 233
888 3300048924 Ga0496121_0034593 Ga0496121_0034593_1533_2252 233
889 3300048924 Ga0496121_0048240 Ga0496121_0048240_2343_3062 233
890 3300048925 Ga0496122_0000009 Ga0496122_0000009_471412_472167 233
891 3300048925 Ga0496122_0001682 Ga0496122_0001682_7715_8434 233
892 3300048925 Ga0496122_0043533 Ga0496122_0043533_434_1213 233
893 3300048926 Ga0496123_0000020 Ga0496123_0000020_275970_276725 233
894 3300048926 Ga0496123_0026585 Ga0496123_0026585_3590_4309 233
895 3300048927 Ga0496124_0001515 Ga0496124_0001515_1800_2519 233
896 3300048927 Ga0496124_0021527 Ga0496124_0021527_3590_4309 233
897 3300048927 Ga0496124_0025767 Ga0496124_0025767_2656_3411 233
898 3300048927 Ga0496124_0061748 Ga0496124_0061748_2344_3063 233
899 3300048928 Ga0496125_0004123 Ga0496125_0004123_4095_4814 233
900 3300048928 Ga0496125_0210445 Ga0496125_0210445_526_1245 233
901 3300048928 Ga0496125_0327185 Ga0496125_0327185_184_903 233
902 3300048929 Ga0496126_0103547 Ga0496126_0103547_1545_2264 233
903 3300049459 Ga0495678_003970 Ga0495678_003970_1108_1827 233
904 3300049742 Ga0501080_0145372 Ga0501080_0145372_74_811 233
905 3300050493 nmdc:mga0k408_3195_c1 nmdc:mga0k408_3195_c1_1195_1914 233
906 3300050496 nmdc:mga07m45_70084_c2 nmdc:mga07m45_70084_c2_21_740 233
907 3300053079 Ga0500610_0027143 Ga0500610_0027143_802_1521 233
908 3300053085 Ga0495619_0160345 Ga0495619_0160345_137_856 233
909 3300053087 Ga0500643_055883 Ga0500643_055883_41_760 233
910 3300053105 Ga0500557_001007 Ga0500557_001007_3452_4171 233
911 3300053109 Ga0500569_002392 Ga0500569_002392_1562_2281 233
912 3300053109 Ga0500569_021294 Ga0500569_021294_211_930 233
913 3300053118 Ga0500594_0007609 Ga0500594_0007609_1583_2302 233
914 3300053118 Ga0500594_0036012 Ga0500594_0036012_455_1174 233
915 3300053121 Ga0500607_113631 Ga0500607_113631_400_1119 233
916 3300053125 Ga0500618_015380 Ga0500618_015380_881_1600 233
917 3300053139 Ga0500568_0001043 Ga0500568_0001043_8549_9268 233
918 3300053148 Ga0500590_000994 Ga0500590_000994_8718_9437 233
919 3300053151 Ga0500604_0116412 Ga0500604_0116412_27_746 233
920 3300053156 Ga0500622_0000348 Ga0500622_0000348_39918_40637 233
921 3300053177 Ga0500636_0267269 Ga0500636_0267269_31_750 233
922 iso_pu_bacteria 2510461069 2510841766 233
923 iso_pu_bacteria 2989771324 2989774001 233
924 iso_pu_bacteria 8005658619 8005660415 233
925 3300002987 JGI25159J45721_1000016 JGI25159J45721_100001699 234
926 3300003187 JGI25151J46595_10036661 JGI25151J46595_100366612 234
927 3300003354 JGI25160J50197_1000002 JGI25160J50197_1000002436 234
928 3300003374 JGI25161J50226_1001241 JGI25161J50226_10012416 234
929 3300003771 Ga0055526_1000207 Ga0055526_100020725 234
930 3300003775 Ga0055524_1004019 Ga0055524_10040195 234
931 3300003856 Ga0058692_1002656 Ga0058692_10026563 234
932 3300003856 Ga0058692_1002911 Ga0058692_10029114 234
933 3300004625 Ga0055543_1000022 Ga0055543_1000022112 234
934 3300005262 Ga0065165_1000058 Ga0065165_100005862 234
935 3300005347 Ga0070668_100501995 Ga0070668_1005019952 234
936 3300005353 Ga0070669_100071894 Ga0070669_1000718942 234
937 3300005548 Ga0070665_100004421 Ga0070665_10000442110 234
938 3300006042 Ga0075368_10000355 Ga0075368_100003556 234
939 3300006177 Ga0075362_10009717 Ga0075362_100097172 234
940 3300006946 Ga0079104_1001287 Ga0079104_100128717 234
941 3300006948 Ga0099826_10018831 Ga0099826_100188312 234
942 3300006948 Ga0099826_10023495 Ga0099826_100234953 234
943 3300009148 Ga0105243_10016561 Ga0105243_100165614 234
944 3300013102 Ga0157371_10000058 Ga0157371_1000005822 234
945 3300013104 Ga0157370_10000792 Ga0157370_1000079217 234
946 3300013249 Ga0171463_1001 Ga0171463_1001648 234
947 3300015690 Ga0183363_1147 Ga0183363_11478 234
948 3300021320 Ga0214544_1000008 Ga0214544_1000008308 234
949 3300021321 Ga0214542_1000011 Ga0214542_1000011213 234
950 3300021327 Ga0214543_1000004 Ga0214543_1000004287 234
951 3300022739 Ga0228711_1027658 Ga0228711_10276583 234
952 3300022740 Ga0228710_1000534 Ga0228710_10005343 234
953 3300025245 Ga0207425_1003765 Ga0207425_10037652 234
954 3300025284 Ga0209130_1000008 Ga0209130_1000008108 234
955 3300025292 Ga0209676_1009188 Ga0209676_10091883 234
956 3300025294 Ga0209025_1000441 Ga0209025_100044173 234
957 3300025294 Ga0209025_1001129 Ga0209025_100112924 234
958 3300025295 Ga0209564_1000091 Ga0209564_1000091124 234
959 3300025298 Ga0209050_1017011 Ga0209050_10170112 234
960 3300025299 Ga0209256_1000180 Ga0209256_100018015 234
961 3300025299 Ga0209256_1001130 Ga0209256_100113033 234
962 3300025302 Ga0207426_1000016 Ga0207426_1000016453 234
963 3300025303 Ga0209051_1020889 Ga0209051_10208892 234
964 3300025972 Ga0207668_10477719 Ga0207668_104777192 234
965 3300027111 Ga0209281_1000468 Ga0209281_10004683 234
966 3300027111 Ga0209281_1000629 Ga0209281_100062936 234
967 3300027312 Ga0209371_1000009 Ga0209371_1000009421 234
968 3300027312 Ga0209371_1000547 Ga0209371_100054728 234
969 3300027666 Ga0209282_1000103 Ga0209282_10001033 234
970 3300027666 Ga0209282_1000224 Ga0209282_100022419 234
971 3300027666 Ga0209282_1025566 Ga0209282_10255662 234
972 3300027866 Ga0209813_10000358 Ga0209813_100003588 234
973 3300028379 Ga0268266_10043940 Ga0268266_100439404 234
974 3300028794 Ga0307515_10004744 Ga0307515_1000474418 234
975 3300030500 Ga0268256_1000010 Ga0268256_1000010420 234
976 3300030500 Ga0268256_1006809 Ga0268256_10068092 234
977 3300031967 Ga0315914_1000009 Ga0315914_1000009186 234
978 3300033430 Ga0315913_1000155 Ga0315913_10001553 234
979 3300033464 Ga0315915_1000013 Ga0315915_10000133 234
980 3300041404 Ga0439436_0018073 Ga0439436_0018073_356_1093 234
981 3300042007 Ga0439449_0011495 Ga0439449_0011495_701_1438 234
982 3300042007 Ga0439449_0019033 Ga0439449_0019033_1696_2433 234
983 3300042015 Ga0439462_0007064 Ga0439462_0007064_2048_2785 234
984 3300042136 Ga0450900_023596 Ga0450900_023596_119_859 234
985 3300046522 Ga0495643_0032112 Ga0495643_0032112_2064_2804 234
986 3300046558 Ga0495633_0030076 Ga0495633_0030076_451_1191 234
987 3300047470 Ga0495681_0002944 Ga0495681_0002944_6020_6760 234
988 3300048907 Ga0496104_0275165 Ga0496104_0275165_338_1078 234
989 3300048919 Ga0496116_0018850 Ga0496116_0018850_1454_2194 234
990 3300048920 Ga0496117_0000002 Ga0496117_0000002_1946926_1947666 234
991 3300048920 Ga0496117_0081076 Ga0496117_0081076_1233_2036 234
992 3300048921 Ga0496118_0000233 Ga0496118_0000233_62438_63178 234
993 3300048921 Ga0496118_0024440 Ga0496118_0024440_2950_3690 234
994 3300048922 Ga0496119_0006263 Ga0496119_0006263_1658_2398 234
995 3300048922 Ga0496119_0066005 Ga0496119_0066005_772_1512 234
996 3300048923 Ga0496120_0000021 Ga0496120_0000021_118909_119649 234
997 3300048925 Ga0496122_0000001 Ga0496122_0000001_1317716_1318456 234
998 3300048926 Ga0496123_0000001 Ga0496123_0000001_1321447_1322187 234
999 3300048927 Ga0496124_0026166 Ga0496124_0026166_664_1404 234
1000 3300048929 Ga0496126_0116812 Ga0496126_0116812_577_1317 234
1001 3300050489 nmdc:mga03683_32962_c1 nmdc:mga03683_32962_c1_1070_1810 234
1002 3300050491 nmdc:mga00v17_72_c1 nmdc:mga00v17_72_c1_12843_13583 234
1003 3300050492 nmdc:mga0yw44_7430_c1 nmdc:mga0yw44_7430_c1_1266_2006 234
1004 3300050494 nmdc:mga06z11_101090_c1 nmdc:mga06z11_101090_c1_264_1004 234
1005 3300050494 nmdc:mga06z11_4151_c1 nmdc:mga06z11_4151_c1_3924_4664 234
1006 3300050495 nmdc:mga04h51_1009_c1 nmdc:mga04h51_1009_c1_3785_4525 234
1007 3300050516 nmdc:mga0sz30_22408_c1 nmdc:mga0sz30_22408_c1_136_876 234
1008 3300053107 Ga0500560_004306 Ga0500560_004306_659_1399 234
1009 3300053137 Ga0500561_0000123 Ga0500561_0000123_3181_3921 234
1010 3300053157 Ga0500624_001256 Ga0500624_001256_1882_2622 234
1011 3300059510 Ga0587090_001818 Ga0587090_001818_284_1024 234
1012 iso_pu_bacteria 2510917026 2511175222 234
1013 iso_pu_bacteria 2585427633 2585994483 234
1014 iso_pu_bacteria 2585427634 2585998930 234
1015 iso_pu_bacteria 2818991461 2819684660 234
1016 iso_pu_bacteria 2837651117 2837652108 234
1017 iso_pu_bacteria 8055431914 8055433391 234
1018 3300006038 Ga0075365_10010451 Ga0075365_100104512 235
1019 3300031548 Ga0307408_100028092 Ga0307408_1000280922 235
1020 3300031548 Ga0307408_100073536 Ga0307408_1000735362 235
1021 3300031911 Ga0307412_10136150 Ga0307412_101361502 235
1022 3300041406 Ga0439439_0041941 Ga0439439_0041941_249_1004 235
1023 3300041413 Ga0439465_0000272 Ga0439465_0000272_928_1683 235
1024 3300042011 Ga0439454_035137 Ga0439454_035137_34_789 235
1025 3300042122 Ga0450920_002278 Ga0450920_002278_255_1010 235
1026 3300042435 Ga0439434_0124282 Ga0439434_0124282_61_816 235
1027 3300046501 Ga0495607_0019722 Ga0495607_0019722_2473_3225 235
1028 3300048913 Ga0496110_0152345 Ga0496110_0152345_499_1311 235
1029 3300048914 Ga0496111_0007359 Ga0496111_0007359_5387_6199 235
1030 3300048925 Ga0496122_0018592 Ga0496122_0018592_4133_4945 235
1031 3300048926 Ga0496123_0015313 Ga0496123_0015313_2657_3469 235
1032 3300048927 Ga0496124_0144776 Ga0496124_0144776_609_1421 235
1033 3300053125 Ga0500618_016573 Ga0500618_016573_1024_1776 235
1034 iso_pu_bacteria 2600254933 2600374762 235
1035 iso_pu_bacteria 2615840698 2616553441 235
1036 iso_pu_bacteria 2667528174 2671112399 235
1037 iso_pu_bacteria 2818991448 2819608378 235
1038 iso_pu_bacteria 2838029111 2838029262 235
1039 iso_pu_bacteria 2842475841 2842476308 235
1040 iso_pu_bacteria 2842502639 2842502790 235
1041 iso_pu_bacteria 2899803654 2899804465 235
1042 iso_pu_bacteria 2919408235 2919408833 235
1043 iso_pu_bacteria 3005416602 3005422778 235
1044 iso_pu_bacteria 8005314921 8005321686 235
1045 iso_pu_bacteria 8005484373 8005486108 235
1046 iso_pu_bacteria 8005645114 8005650175 235
1047 iso_pu_bacteria 8005682033 8005685087 235
1048 3300006051 Ga0075364_10014583 Ga0075364_100145832 236
1049 3300006946 Ga0079104_1000069 Ga0079104_100006973 236
1050 3300027111 Ga0209281_1000192 Ga0209281_100019243 236
1051 3300028794 Ga0307515_10000154 Ga0307515_100001547 236
1052 3300031456 Ga0307513_10056454 Ga0307513_100564544 236
1053 3300046507 Ga0495606_0219231 Ga0495606_0219231_217_948 236
1054 3300048920 Ga0496117_0010831 Ga0496117_0010831_4012_4776 236
1055 3300048921 Ga0496118_0204590 Ga0496118_0204590_324_1088 236
1056 3300048922 Ga0496119_0141713 Ga0496119_0141713_210_974 236
1057 3300048924 Ga0496121_0000001 Ga0496121_0000001_456403_457167 236
1058 3300048924 Ga0496121_0009527 Ga0496121_0009527_5954_6694 236
1059 3300048925 Ga0496122_0041982 Ga0496122_0041982_276_1040 236
1060 3300048926 Ga0496123_0043718 Ga0496123_0043718_723_1487 236
1061 3300048927 Ga0496124_0000063 Ga0496124_0000063_82109_82879 236
1062 3300048927 Ga0496124_0015814 Ga0496124_0015814_752_1492 236
1063 3300048928 Ga0496125_0000001 Ga0496125_0000001_568454_569218 236
1064 3300048929 Ga0496126_0618242 Ga0496126_0618242_45_809 236
1065 3300049776 Ga0501280_007268 Ga0501280_007268_126_908 236
1066 3300050491 nmdc:mga00v17_36647_c1 nmdc:mga00v17_36647_c1_1508_2272 236
1067 3300046530 Ga0495654_0000530 Ga0495654_0000530_14156_14911 237
1068 3300013105 Ga0157369_10453170 Ga0157369_104531702 238
1069 3300048925 Ga0496122_0014835 Ga0496122_0014835_2682_3476 238
1070 3300053125 Ga0500618_000046 Ga0500618_000046_65591_66361 238
1071 3300001979 JGI24740J21852_10000204 JGI24740J21852_1000020425 239
1072 3300002704 JGI25155J39150_1000023 JGI25155J39150_100002382 239
1073 3300002705 JGI25156J39149_1000029 JGI25156J39149_1000029117 239
1074 3300002705 JGI25156J39149_1000094 JGI25156J39149_100009425 239
1075 3300002737 JGI25162J39368_1000587 JGI25162J39368_100058724 239
1076 3300002738 JGI25154J39366_1000067 JGI25154J39366_100006783 239
1077 3300002741 JGI25157J39369_1000043 JGI25157J39369_100004345 239
1078 3300003214 JGI25165J46597_1000341 JGI25165J46597_10003416 239
1079 3300003322 rootL2_10164180 rootL2_101641802 239
1080 3300003323 rootH1_10003075 rootH1_100030752 239
1081 3300003323 rootH1_10134538 rootH1_101345382 239
1082 3300013100 Ga0157373_10124972 Ga0157373_101249722 239
1083 3300025206 Ga0209435_100011 Ga0209435_100011293 239
1084 3300025228 Ga0209672_111667 Ga0209672_1116672 239
1085 3300025233 Ga0209437_100036 Ga0209437_10003660 239
1086 3300025246 Ga0209646_1000024 Ga0209646_1000024118 239
1087 3300025250 Ga0209026_1000030 Ga0209026_1000030118 239
1088 3300025256 Ga0209759_1000011 Ga0209759_1000011293 239
1089 3300025261 Ga0209233_1000166 Ga0209233_100016660 239
1090 3300027312 Ga0209371_1000853 Ga0209371_10008537 239
1091 3300030500 Ga0268256_1001802 Ga0268256_10018026 239
1092 3300044765 Ga0466970_0002337 Ga0466970_0002337_8055_8792 239
1093 3300045976 Ga0466967_0290782 Ga0466967_0290782_396_1133 239
1094 3300048922 Ga0496119_0042794 Ga0496119_0042794_528_1265 239
1095 3300048925 Ga0496122_0030455 Ga0496122_0030455_457_1194 239
1096 3300048926 Ga0496123_0147963 Ga0496123_0147963_393_1190 239
1097 3300053140 Ga0500573_0001611 Ga0500573_0001611_2469_3302 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01728

FtsJ

FtsJ-like methyltransferase

69

247

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8i9v-assembly1.cif.gz_CS cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state dbp10-2 0.8508 38 226
7r7o-assembly2.cif.gz_B structure of methyltransferase domain of spb1 boudn to sam 0.8378 38 229
7o9k-assembly1.cif.gz_n human mitochondrial ribosome large subunit assembly intermediate with mterf4-nsun4, mrm2, mtg1, the malsu module, gtpbp5 and mtef-tu 0.8378 48 223
7nac-assembly1.cif.gz_w state e2 nucleolar 60s ribosomal biogenesis intermediate - composite model 0.8356 38 229
8ia0-assembly1.cif.gz_CS cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state puf6 0.8351 38 226
ID Description Score Start End Superfamily
af_Q9VEP1_20_211_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8406 48 225 3.40.50.150
af_Q9VDT6_58_249_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8382 48 226 3.40.50.150
af_Q4CQP4_20_264_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8364 48 221 3.40.50.150
af_Q58771_22_215_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8349 48 229 3.40.50.150
af_Q5RJT2_23_207_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8347 48 226 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A435B914-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.8986 35 223 GO:0008650
AF-A0A527H939-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.8959 34 226 GO:0008650
AF-A0A530Y353-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.8929 49 207 GO:0008650
AF-Q2C9N4-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.8795 61 228 GO:0008650
GO:0051301
AF-A0A4S0IH70-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.8744 29 139 GO:0008650

Feature Viewer

pLDDT pTM Quality
78.44 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map