F489976
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1096 | 347 | 2192 | 169 |
Family's Representative Sequence
| Representative Sequence | 3300005530|Ga0070679_100024119|Ga0070679_1000241197 |
| Length | 155 |
| Sequence | VSEHKAFRVSVTKDYLVFAAAHFITFAGHRCESLHGHNYRVGVALEGDIDEESWYVVDFSYLKQLMKRLCDEIDHKVLLPLENPKVQVSIERYVFPRXXCALLAIPNTTVEMLAKYLVHQARIALTGKQFSKLAVIEIEVEENFGQSAFYREQLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 2 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 193 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 198 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 202 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 203 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 204 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 205 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 206 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 207 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 209 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 218 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 227 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 228 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 231 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 232 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 233 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 234 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 235 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 236 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 237 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 238 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 239 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 240 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 241 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 291 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 292 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 293 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 294 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 295 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 296 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 299 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 300 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 301 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 320 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 321 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 322 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 323 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 328 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.73 |
| Metatranscriptomes | 0.27 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.37 |
| Rhizosphere | 98.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 25.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070679_100024119 | 3300005530 | Bacteria | 5960 |
| 2 | JGI24749J21850_1038148 | 3300002076 | Unclassified | 700 |
| 3 | Ga0058862_12487656 | 3300004803 | Bacteria | 1768 |
| 4 | Ga0065714_10176379 | 3300005288 | Unclassified | 981 |
| 5 | Ga0065712_10008736 | 3300005290 | Bacteria | 2188 |
| 6 | Ga0065712_10028594 | 3300005290 | Bacteria | 1501 |
| 7 | Ga0065712_10067883 | 3300005290 | Bacteria | 23337 |
| 8 | Ga0065715_10104455 | 3300005293 | Bacteria | 2938 |
| 9 | Ga0065715_10235989 | 3300005293 | Bacteria | 1216 |
| 10 | Ga0065715_10340988 | 3300005293 | Unclassified | 967 |
| 11 | Ga0065715_10487116 | 3300005293 | Bacteria | 792 |
| 12 | Ga0065715_10649786 | 3300005293 | Unclassified | 679 |
| 13 | Ga0065707_10085013 | 3300005295 | Bacteria | 6540 |
| 14 | Ga0065707_10312359 | 3300005295 | Archaea | 982 |
| 15 | Ga0065707_10359125 | 3300005295 | Bacteria | 907 |
| 16 | Ga0065707_10405574 | 3300005295 | Bacteria | 847 |
| 17 | Ga0065707_10812297 | 3300005295 | Bacteria | 595 |
| 18 | Ga0070658_10107917 | 3300005327 | Bacteria | 2304 |
| 19 | Ga0070658_10124341 | 3300005327 | Bacteria | 2146 |
| 20 | Ga0070658_10180694 | 3300005327 | Unclassified | 1775 |
| 21 | Ga0070676_10200534 | 3300005328 | Bacteria | 1308 |
| 22 | Ga0070683_100000764 | 3300005329 | Bacteria | 23609 |
| 23 | Ga0070683_100001074 | 3300005329 | Bacteria | 20520 |
| 24 | Ga0070683_100263331 | 3300005329 | Bacteria | 1640 |
| 25 | Ga0070690_100032609 | 3300005330 | Bacteria | 3255 |
| 26 | Ga0070690_100032909 | 3300005330 | Bacteria | 3241 |
| 27 | Ga0070670_100000634 | 3300005331 | Bacteria | 27387 |
| 28 | Ga0070670_100254378 | 3300005331 | Bacteria | 1530 |
| 29 | Ga0070670_100593515 | 3300005331 | Unclassified | 991 |
| 30 | Ga0070677_10031074 | 3300005333 | Bacteria | 2038 |
| 31 | Ga0070677_10281103 | 3300005333 | Unclassified | 838 |
| 32 | Ga0070677_10606364 | 3300005333 | Unclassified | 607 |
| 33 | Ga0068869_100007269 | 3300005334 | Bacteria | 7057 |
| 34 | Ga0068869_100831342 | 3300005334 | Bacteria | 796 |
| 35 | Ga0070666_10004319 | 3300005335 | Bacteria | 8649 |
| 36 | Ga0070666_10105189 | 3300005335 | Bacteria | 1949 |
| 37 | Ga0070666_10181925 | 3300005335 | Unclassified | 1475 |
| 38 | Ga0070680_100025294 | 3300005336 | Bacteria | 4744 |
| 39 | Ga0070680_100039309 | 3300005336 | Unclassified | 3829 |
| 40 | Ga0070680_100060089 | 3300005336 | Bacteria | 3111 |
| 41 | Ga0070680_100071431 | 3300005336 | Bacteria | 2852 |
| 42 | Ga0070680_100112443 | 3300005336 | Bacteria | 2268 |
| 43 | Ga0070680_100115438 | 3300005336 | Bacteria | 2237 |
| 44 | Ga0070680_100500722 | 3300005336 | Bacteria | 1039 |
| 45 | Ga0070680_100563572 | 3300005336 | Bacteria | 977 |
| 46 | Ga0070680_100599160 | 3300005336 | Bacteria | 946 |
| 47 | Ga0070682_100176842 | 3300005337 | Bacteria | 1487 |
| 48 | Ga0070682_100221968 | 3300005337 | Unclassified | 1346 |
| 49 | Ga0068868_100060711 | 3300005338 | Bacteria | 2994 |
| 50 | Ga0070660_100017230 | 3300005339 | Bacteria | 5263 |
| 51 | Ga0070660_100720061 | 3300005339 | Bacteria | 837 |
| 52 | Ga0070689_100085603 | 3300005340 | Bacteria | 2479 |
| 53 | Ga0070689_100674574 | 3300005340 | Bacteria | 901 |
| 54 | Ga0070691_10024745 | 3300005341 | Bacteria | 2792 |
| 55 | Ga0070691_10058787 | 3300005341 | Bacteria | 1846 |
| 56 | Ga0070691_10442094 | 3300005341 | Unclassified | 741 |
| 57 | Ga0070687_100236678 | 3300005343 | Unclassified | 1127 |
| 58 | Ga0070687_100346622 | 3300005343 | Bacteria | 957 |
| 59 | Ga0070687_100347583 | 3300005343 | Unclassified | 956 |
| 60 | Ga0070661_100008643 | 3300005344 | Bacteria | 7045 |
| 61 | Ga0070661_100013274 | 3300005344 | Bacteria | 5782 |
| 62 | Ga0070661_100061807 | 3300005344 | Unclassified | 2749 |
| 63 | Ga0070661_100086991 | 3300005344 | Bacteria | 2311 |
| 64 | Ga0070661_100343835 | 3300005344 | Bacteria | 1169 |
| 65 | Ga0070661_100850582 | 3300005344 | Bacteria | 751 |
| 66 | Ga0070661_101112262 | 3300005344 | Bacteria | 659 |
| 67 | Ga0070692_10169154 | 3300005345 | Unclassified | 1258 |
| 68 | Ga0070668_100030893 | 3300005347 | Bacteria | 4076 |
| 69 | Ga0070668_100076947 | 3300005347 | Bacteria | 2607 |
| 70 | Ga0070668_100433767 | 3300005347 | Bacteria | 1127 |
| 71 | Ga0070668_101210325 | 3300005347 | Unclassified | 685 |
| 72 | Ga0070668_101326221 | 3300005347 | Bacteria | 655 |
| 73 | Ga0070669_100038469 | 3300005353 | Bacteria | 3474 |
| 74 | Ga0070669_100181590 | 3300005353 | Bacteria | 1646 |
| 75 | Ga0070669_100219522 | 3300005353 | Unclassified | 1503 |
| 76 | Ga0070669_101050532 | 3300005353 | Bacteria | 700 |
| 77 | Ga0070675_100008647 | 3300005354 | Bacteria | 7908 |
| 78 | Ga0070675_100009676 | 3300005354 | Bacteria | 7504 |
| 79 | Ga0070675_100009716 | 3300005354 | Bacteria | 7493 |
| 80 | Ga0070675_100065891 | 3300005354 | Bacteria | 2995 |
| 81 | Ga0070675_100082773 | 3300005354 | Bacteria | 2678 |
| 82 | Ga0070675_100088027 | 3300005354 | Bacteria | 2598 |
| 83 | Ga0070675_100773314 | 3300005354 | Unclassified | 877 |
| 84 | Ga0070671_100552582 | 3300005355 | Unclassified | 993 |
| 85 | Ga0070671_100921924 | 3300005355 | Bacteria | 764 |
| 86 | Ga0070674_100000664 | 3300005356 | Bacteria | 17387 |
| 87 | Ga0070674_100065114 | 3300005356 | Unclassified | 2557 |
| 88 | Ga0070674_100149122 | 3300005356 | Bacteria | 1763 |
| 89 | Ga0070674_100386909 | 3300005356 | Bacteria | 1139 |
| 90 | Ga0070674_100451414 | 3300005356 | Unclassified | 1061 |
| 91 | Ga0070673_100052234 | 3300005364 | Bacteria | 3206 |
| 92 | Ga0070673_100204206 | 3300005364 | Unclassified | 1703 |
| 93 | Ga0070673_100218639 | 3300005364 | Bacteria | 1648 |
| 94 | Ga0070673_100222531 | 3300005364 | Bacteria | 1634 |
| 95 | Ga0070688_100040267 | 3300005365 | Bacteria | 2862 |
| 96 | Ga0070688_100388544 | 3300005365 | Bacteria | 1030 |
| 97 | Ga0070688_100546849 | 3300005365 | Bacteria | 880 |
| 98 | Ga0070659_100070695 | 3300005366 | Bacteria | 2773 |
| 99 | Ga0070659_100458522 | 3300005366 | Bacteria | 1082 |
| 100 | Ga0070659_101245674 | 3300005366 | Bacteria | 659 |
| 101 | Ga0070667_100229132 | 3300005367 | Bacteria | 1656 |
| 102 | Ga0070709_10021097 | 3300005434 | Bacteria | 3791 |
| 103 | Ga0070709_10035734 | 3300005434 | Unclassified | 3022 |
| 104 | Ga0070709_10180433 | 3300005434 | Bacteria | 1482 |
| 105 | Ga0070709_10200696 | 3300005434 | Unclassified | 1412 |
| 106 | Ga0070714_100007464 | 3300005435 | Bacteria | 8514 |
| 107 | Ga0070714_100491330 | 3300005435 | Bacteria | 1169 |
| 108 | Ga0070714_100571204 | 3300005435 | Bacteria | 1084 |
| 109 | Ga0070714_100859851 | 3300005435 | Unclassified | 880 |
| 110 | Ga0070713_100049913 | 3300005436 | Bacteria | 3454 |
| 111 | Ga0070713_100205246 | 3300005436 | Bacteria | 1782 |
| 112 | Ga0070710_10221506 | 3300005437 | Bacteria | 1204 |
| 113 | Ga0070711_100000009 | 3300005439 | Bacteria | 172420 |
| 114 | Ga0070711_100042571 | 3300005439 | Unclassified | 3071 |
| 115 | Ga0070705_100546158 | 3300005440 | Bacteria | 887 |
| 116 | Ga0070700_100034745 | 3300005441 | Bacteria | 3046 |
| 117 | Ga0070700_100052768 | 3300005441 | Bacteria | 2536 |
| 118 | Ga0070700_100258641 | 3300005441 | Bacteria | 1252 |
| 119 | Ga0070694_100003241 | 3300005444 | Bacteria | 9716 |
| 120 | Ga0070694_100067431 | 3300005444 | Unclassified | 2457 |
| 121 | Ga0070694_100129931 | 3300005444 | Bacteria | 1818 |
| 122 | Ga0070694_100218984 | 3300005444 | Bacteria | 1427 |
| 123 | Ga0070708_100038507 | 3300005445 | Bacteria | 4177 |
| 124 | Ga0070708_100074725 | 3300005445 | Bacteria | 3057 |
| 125 | Ga0070708_100209998 | 3300005445 | Bacteria | 1824 |
| 126 | Ga0070708_100449655 | 3300005445 | Archaea | 1215 |
| 127 | Ga0070708_100665187 | 3300005445 | Bacteria | 981 |
| 128 | Ga0070708_100928361 | 3300005445 | Unclassified | 817 |
| 129 | Ga0070663_100070771 | 3300005455 | Bacteria | 2537 |
| 130 | Ga0070663_100076568 | 3300005455 | Bacteria | 2447 |
| 131 | Ga0070678_100079118 | 3300005456 | Bacteria | 2485 |
| 132 | Ga0070678_100313600 | 3300005456 | Unclassified | 1337 |
| 133 | Ga0070678_101372611 | 3300005456 | Bacteria | 659 |
| 134 | Ga0070662_100079683 | 3300005457 | Bacteria | 2436 |
| 135 | Ga0070662_100233188 | 3300005457 | Unclassified | 1473 |
| 136 | Ga0070662_100599159 | 3300005457 | Unclassified | 927 |
| 137 | Ga0070681_10008231 | 3300005458 | Bacteria | 10205 |
| 138 | Ga0070681_10040036 | 3300005458 | Bacteria | 4699 |
| 139 | Ga0070681_10052833 | 3300005458 | Bacteria | 4052 |
| 140 | Ga0070681_10158613 | 3300005458 | Bacteria | 2186 |
| 141 | Ga0070681_10170587 | 3300005458 | Bacteria | 2098 |
| 142 | Ga0068867_100237661 | 3300005459 | Bacteria | 1476 |
| 143 | Ga0068867_100246127 | 3300005459 | Unclassified | 1452 |
| 144 | Ga0070685_10276492 | 3300005466 | Bacteria | 1123 |
| 145 | Ga0070706_100033685 | 3300005467 | Bacteria | 4729 |
| 146 | Ga0070706_100132617 | 3300005467 | Bacteria | 2325 |
| 147 | Ga0070706_100174635 | 3300005467 | Unclassified | 2006 |
| 148 | Ga0070706_100291623 | 3300005467 | Bacteria | 1522 |
| 149 | Ga0070706_100652794 | 3300005467 | Bacteria | 977 |
| 150 | Ga0070706_101002993 | 3300005467 | Unclassified | 770 |
| 151 | Ga0070706_101347236 | 3300005467 | Unclassified | 654 |
| 152 | Ga0070707_100010894 | 3300005468 | Bacteria | 8467 |
| 153 | Ga0070707_100051229 | 3300005468 | Bacteria | 3958 |
| 154 | Ga0070707_100070873 | 3300005468 | Bacteria | 3357 |
| 155 | Ga0070707_100111704 | 3300005468 | Bacteria | 2650 |
| 156 | Ga0070707_100165017 | 3300005468 | Bacteria | 2158 |
| 157 | Ga0070707_100182062 | 3300005468 | Bacteria | 2048 |
| 158 | Ga0070707_100359616 | 3300005468 | Bacteria | 1414 |
| 159 | Ga0070707_100448139 | 3300005468 | Bacteria | 1251 |
| 160 | Ga0070698_100000520 | 3300005471 | Bacteria | 41001 |
| 161 | Ga0070698_100187329 | 3300005471 | Bacteria | 2007 |
| 162 | Ga0070698_100210750 | 3300005471 | Bacteria | 1878 |
| 163 | Ga0070698_100380074 | 3300005471 | Bacteria | 1345 |
| 164 | Ga0070699_100017273 | 3300005518 | Bacteria | 6195 |
| 165 | Ga0070699_100042946 | 3300005518 | Bacteria | 3913 |
| 166 | Ga0070699_100073476 | 3300005518 | Bacteria | 2975 |
| 167 | Ga0070699_100153696 | 3300005518 | Bacteria | 2036 |
| 168 | Ga0070699_100690994 | 3300005518 | Bacteria | 932 |
| 169 | Ga0070679_100003010 | 3300005530 | Bacteria | 15398 |
| 170 | Ga0070679_100028164 | 3300005530 | Bacteria | 5537 |
| 171 | Ga0070679_100097515 | 3300005530 | Unclassified | 2927 |
| 172 | Ga0070679_100158529 | 3300005530 | Bacteria | 2237 |
| 173 | Ga0070679_100270419 | 3300005530 | Bacteria | 1654 |
| 174 | Ga0070684_100013369 | 3300005535 | Bacteria | 6615 |
| 175 | Ga0070684_100014739 | 3300005535 | Bacteria | 6343 |
| 176 | Ga0070684_100491750 | 3300005535 | Bacteria | 1136 |
| 177 | Ga0070684_100749212 | 3300005535 | Unclassified | 912 |
| 178 | Ga0070697_100012147 | 3300005536 | Bacteria | 6744 |
| 179 | Ga0070697_100045601 | 3300005536 | Bacteria | 3553 |
| 180 | Ga0070697_100139862 | 3300005536 | Bacteria | 2035 |
| 181 | Ga0070697_100320116 | 3300005536 | Unclassified | 1336 |
| 182 | Ga0070697_100503082 | 3300005536 | Bacteria | 1060 |
| 183 | Ga0068853_100010200 | 3300005539 | Bacteria | 7594 |
| 184 | Ga0068853_100218533 | 3300005539 | Bacteria | 1739 |
| 185 | Ga0070672_100024320 | 3300005543 | Bacteria | 4474 |
| 186 | Ga0070672_100035566 | 3300005543 | Bacteria | 3787 |
| 187 | Ga0070672_100103360 | 3300005543 | Bacteria | 2314 |
| 188 | Ga0070686_100327783 | 3300005544 | Bacteria | 1144 |
| 189 | Ga0070686_100779235 | 3300005544 | Bacteria | 769 |
| 190 | Ga0070695_100015845 | 3300005545 | Bacteria | 4555 |
| 191 | Ga0070695_100121367 | 3300005545 | Bacteria | 1788 |
| 192 | Ga0070695_100139183 | 3300005545 | Bacteria | 1681 |
| 193 | Ga0070695_100255072 | 3300005545 | Bacteria | 1278 |
| 194 | Ga0070695_100581348 | 3300005545 | Bacteria | 877 |
| 195 | Ga0070695_101145661 | 3300005545 | Unclassified | 638 |
| 196 | Ga0070695_101160648 | 3300005545 | Unclassified | 634 |
| 197 | Ga0070696_100004527 | 3300005546 | Bacteria | 9278 |
| 198 | Ga0070696_100135631 | 3300005546 | Bacteria | 1794 |
| 199 | Ga0070696_100159852 | 3300005546 | Unclassified | 1659 |
| 200 | Ga0070696_100807529 | 3300005546 | Archaea | 772 |
| 201 | Ga0070665_100114423 | 3300005548 | Bacteria | 2700 |
| 202 | Ga0070665_101502237 | 3300005548 | Bacteria | 682 |
| 203 | Ga0070704_100017784 | 3300005549 | Bacteria | 4531 |
| 204 | Ga0070704_100050914 | 3300005549 | Bacteria | 2914 |
| 205 | Ga0070704_100126865 | 3300005549 | Unclassified | 1970 |
| 206 | Ga0070704_100138806 | 3300005549 | Unclassified | 1895 |
| 207 | Ga0068855_100023199 | 3300005563 | Bacteria | 7434 |
| 208 | Ga0068855_100055920 | 3300005563 | Bacteria | 4632 |
| 209 | Ga0068855_100126070 | 3300005563 | Unclassified | 2927 |
| 210 | Ga0070664_100006595 | 3300005564 | Bacteria | 9358 |
| 211 | Ga0070664_100945763 | 3300005564 | Bacteria | 809 |
| 212 | Ga0068857_100038917 | 3300005577 | Unclassified | 4211 |
| 213 | Ga0068854_100002695 | 3300005578 | Bacteria | 11003 |
| 214 | Ga0068854_100042820 | 3300005578 | Bacteria | 3206 |
| 215 | Ga0068854_100062714 | 3300005578 | Bacteria | 2696 |
| 216 | Ga0068854_100088656 | 3300005578 | Unclassified | 2297 |
| 217 | Ga0068854_100170635 | 3300005578 | Unclassified | 1692 |
| 218 | Ga0068856_100017819 | 3300005614 | Bacteria | 6888 |
| 219 | Ga0068856_100662926 | 3300005614 | Unclassified | 1064 |
| 220 | Ga0068852_100096763 | 3300005616 | Bacteria | 2654 |
| 221 | Ga0068852_100109622 | 3300005616 | Unclassified | 2507 |
| 222 | Ga0068852_100236884 | 3300005616 | Bacteria | 1742 |
| 223 | Ga0068852_101025365 | 3300005616 | Bacteria | 844 |
| 224 | Ga0068859_100098561 | 3300005617 | Bacteria | 2977 |
| 225 | Ga0068859_100128099 | 3300005617 | Unclassified | 2609 |
| 226 | Ga0068859_100240252 | 3300005617 | Bacteria | 1900 |
| 227 | Ga0068859_100458432 | 3300005617 | Bacteria | 1371 |
| 228 | Ga0068859_100494967 | 3300005617 | Unclassified | 1318 |
| 229 | Ga0068859_100897864 | 3300005617 | Unclassified | 971 |
| 230 | Ga0068859_101779012 | 3300005617 | Unclassified | 681 |
| 231 | Ga0068864_100187237 | 3300005618 | Bacteria | 1895 |
| 232 | Ga0068861_100080171 | 3300005719 | Bacteria | 2553 |
| 233 | Ga0068861_100280907 | 3300005719 | Unclassified | 1434 |
| 234 | Ga0068861_100507024 | 3300005719 | Bacteria | 1092 |
| 235 | Ga0068861_101379743 | 3300005719 | Bacteria | 688 |
| 236 | Ga0068870_10012779 | 3300005840 | Bacteria | 3931 |
| 237 | Ga0068870_10048732 | 3300005840 | Bacteria | 2232 |
| 238 | Ga0068870_10068362 | 3300005840 | Unclassified | 1930 |
| 239 | Ga0068863_100320392 | 3300005841 | Unclassified | 1506 |
| 240 | Ga0068863_100432665 | 3300005841 | Bacteria | 1290 |
| 241 | Ga0068858_100004093 | 3300005842 | Bacteria | 14367 |
| 242 | Ga0068858_100078401 | 3300005842 | Bacteria | 3070 |
| 243 | Ga0068860_100094908 | 3300005843 | Unclassified | 2843 |
| 244 | Ga0068860_100115161 | 3300005843 | Unclassified | 2571 |
| 245 | Ga0068860_100169778 | 3300005843 | Bacteria | 2106 |
| 246 | Ga0068860_100173033 | 3300005843 | Unclassified | 2086 |
| 247 | Ga0068860_100255187 | 3300005843 | Unclassified | 1708 |
| 248 | Ga0068860_101616552 | 3300005843 | Bacteria | 670 |
| 249 | Ga0068860_102056788 | 3300005843 | Unclassified | 592 |
| 250 | Ga0068862_100008267 | 3300005844 | Bacteria | 8609 |
| 251 | Ga0068862_100311465 | 3300005844 | Bacteria | 1451 |
| 252 | Ga0068862_101089178 | 3300005844 | Bacteria | 794 |
| 253 | Ga0068862_101121021 | 3300005844 | Unclassified | 783 |
| 254 | Ga0070717_10047786 | 3300006028 | Unclassified | 3508 |
| 255 | Ga0070717_10500905 | 3300006028 | Unclassified | 1098 |
| 256 | Ga0070717_10684875 | 3300006028 | Unclassified | 931 |
| 257 | Ga0070715_10100109 | 3300006163 | Bacteria | 1350 |
| 258 | Ga0070715_10194680 | 3300006163 | Bacteria | 1026 |
| 259 | Ga0070716_100428650 | 3300006173 | Unclassified | 958 |
| 260 | Ga0070716_100491908 | 3300006173 | Unclassified | 903 |
| 261 | Ga0070712_100142516 | 3300006175 | Bacteria | 1831 |
| 262 | Ga0075427_10044017 | 3300006194 | Unclassified | 758 |
| 263 | Ga0097621_100001945 | 3300006237 | Bacteria | 14088 |
| 264 | Ga0097621_100013956 | 3300006237 | Bacteria | 6000 |
| 265 | Ga0097621_100774278 | 3300006237 | Bacteria | 888 |
| 266 | Ga0068871_100017288 | 3300006358 | Bacteria | 5454 |
| 267 | Ga0068871_100033020 | 3300006358 | Bacteria | 4093 |
| 268 | Ga0068871_100374542 | 3300006358 | Unclassified | 1264 |
| 269 | Ga0068871_100471878 | 3300006358 | Bacteria | 1127 |
| 270 | Ga0075428_100002503 | 3300006844 | Bacteria | 19950 |
| 271 | Ga0075428_100006937 | 3300006844 | Bacteria | 12581 |
| 272 | Ga0075428_100007581 | 3300006844 | Bacteria | 12025 |
| 273 | Ga0075428_100979434 | 3300006844 | Unclassified | 896 |
| 274 | Ga0075430_100004830 | 3300006846 | Bacteria | 11343 |
| 275 | Ga0075430_100014265 | 3300006846 | Bacteria | 6775 |
| 276 | Ga0075430_100040064 | 3300006846 | Bacteria | 3965 |
| 277 | Ga0075430_100417201 | 3300006846 | Bacteria | 1108 |
| 278 | Ga0075430_100713787 | 3300006846 | Bacteria | 826 |
| 279 | Ga0075431_100003195 | 3300006847 | Bacteria | 15850 |
| 280 | Ga0075431_100016527 | 3300006847 | Bacteria | 7490 |
| 281 | Ga0075431_100060470 | 3300006847 | Bacteria | 3909 |
| 282 | Ga0075431_100060948 | 3300006847 | Bacteria | 3893 |
| 283 | Ga0075431_100094343 | 3300006847 | Bacteria | 3088 |
| 284 | Ga0075431_100107669 | 3300006847 | Bacteria | 2876 |
| 285 | Ga0075431_100369023 | 3300006847 | Unclassified | 1441 |
| 286 | Ga0075431_100633071 | 3300006847 | Bacteria | 1051 |
| 287 | Ga0075431_100799488 | 3300006847 | Bacteria | 916 |
| 288 | Ga0075433_10001610 | 3300006852 | Bacteria | 16748 |
| 289 | Ga0075433_10002219 | 3300006852 | Bacteria | 14735 |
| 290 | Ga0075433_10003429 | 3300006852 | Bacteria | 12227 |
| 291 | Ga0075433_10035571 | 3300006852 | Bacteria | 4284 |
| 292 | Ga0075433_10117969 | 3300006852 | Bacteria | 2355 |
| 293 | Ga0075433_10201869 | 3300006852 | Bacteria | 1768 |
| 294 | Ga0075434_100001499 | 3300006871 | Bacteria | 19717 |
| 295 | Ga0075434_100006838 | 3300006871 | Bacteria | 10499 |
| 296 | Ga0075434_100007930 | 3300006871 | Bacteria | 9840 |
| 297 | Ga0075434_100008914 | 3300006871 | Bacteria | 9339 |
| 298 | Ga0075434_100017151 | 3300006871 | Bacteria | 6970 |
| 299 | Ga0075434_100030949 | 3300006871 | Bacteria | 5275 |
| 300 | Ga0075434_100047107 | 3300006871 | Bacteria | 4279 |
| 301 | Ga0075434_100107482 | 3300006871 | Bacteria | 2800 |
| 302 | Ga0075434_100311843 | 3300006871 | Unclassified | 1593 |
| 303 | Ga0075429_100007718 | 3300006880 | Bacteria | 9338 |
| 304 | Ga0075429_100029861 | 3300006880 | Bacteria | 4735 |
| 305 | Ga0075429_100125889 | 3300006880 | Bacteria | 2241 |
| 306 | Ga0075429_100211336 | 3300006880 | Bacteria | 1700 |
| 307 | Ga0075429_101550837 | 3300006880 | Unclassified | 576 |
| 308 | Ga0068865_100031879 | 3300006881 | Bacteria | 3517 |
| 309 | Ga0068865_100113921 | 3300006881 | Unclassified | 1999 |
| 310 | Ga0068865_100790636 | 3300006881 | Bacteria | 818 |
| 311 | Ga0075436_100000356 | 3300006914 | Bacteria | 29209 |
| 312 | Ga0075436_100002771 | 3300006914 | Bacteria | 12020 |
| 313 | Ga0075436_100013469 | 3300006914 | Bacteria | 5598 |
| 314 | Ga0075436_100043206 | 3300006914 | Bacteria | 3107 |
| 315 | Ga0075436_100291632 | 3300006914 | Bacteria | 1168 |
| 316 | Ga0075436_100330344 | 3300006914 | Unclassified | 1096 |
| 317 | Ga0097620_100061162 | 3300006931 | Bacteria | 3795 |
| 318 | Ga0097620_100098557 | 3300006931 | Bacteria | 2977 |
| 319 | Ga0097620_100128090 | 3300006931 | Unclassified | 2609 |
| 320 | Ga0097620_100240260 | 3300006931 | Bacteria | 1900 |
| 321 | Ga0097620_100458464 | 3300006931 | Bacteria | 1371 |
| 322 | Ga0097620_100494983 | 3300006931 | Unclassified | 1318 |
| 323 | Ga0097620_100897720 | 3300006931 | Unclassified | 971 |
| 324 | Ga0097620_101779132 | 3300006931 | Unclassified | 681 |
| 325 | Ga0075435_100000113 | 3300007076 | Bacteria | 44786 |
| 326 | Ga0075435_100015603 | 3300007076 | Bacteria | 5714 |
| 327 | Ga0075435_100040694 | 3300007076 | Bacteria | 3712 |
| 328 | Ga0075435_100044468 | 3300007076 | Bacteria | 3557 |
| 329 | Ga0075435_100079863 | 3300007076 | Bacteria | 2685 |
| 330 | Ga0075435_100095994 | 3300007076 | Bacteria | 2452 |
| 331 | Ga0075435_100232734 | 3300007076 | Bacteria | 1566 |
| 332 | Ga0075435_100394593 | 3300007076 | Bacteria | 1189 |
| 333 | Ga0075435_100825227 | 3300007076 | Bacteria | 808 |
| 334 | Ga0075435_101062891 | 3300007076 | Unclassified | 707 |
| 335 | Ga0099794_10056124 | 3300007265 | Bacteria | 1905 |
| 336 | Ga0105240_10003253 | 3300009093 | Bacteria | 25423 |
| 337 | Ga0105240_10156515 | 3300009093 | Bacteria | 2709 |
| 338 | Ga0105240_10205058 | 3300009093 | Bacteria | 2308 |
| 339 | Ga0105240_10296203 | 3300009093 | Bacteria | 1852 |
| 340 | Ga0105240_10382438 | 3300009093 | Bacteria | 1589 |
| 341 | Ga0111539_10001040 | 3300009094 | Bacteria | 36436 |
| 342 | Ga0111539_10001816 | 3300009094 | Bacteria | 28405 |
| 343 | Ga0111539_10002183 | 3300009094 | Bacteria | 26127 |
| 344 | Ga0111539_10039477 | 3300009094 | Bacteria | 5688 |
| 345 | Ga0111539_10146430 | 3300009094 | Bacteria | 2765 |
| 346 | Ga0111539_10490696 | 3300009094 | Bacteria | 1431 |
| 347 | Ga0111539_10786990 | 3300009094 | Bacteria | 1107 |
| 348 | Ga0111539_10918447 | 3300009094 | Bacteria | 1018 |
| 349 | Ga0105245_10058586 | 3300009098 | Bacteria | 3467 |
| 350 | Ga0105245_10193877 | 3300009098 | Bacteria | 1948 |
| 351 | Ga0105245_10239414 | 3300009098 | Bacteria | 1758 |
| 352 | Ga0105247_10016077 | 3300009101 | Unclassified | 4483 |
| 353 | Ga0105247_10454314 | 3300009101 | Bacteria | 924 |
| 354 | Ga0114129_10002003 | 3300009147 | Bacteria | 27888 |
| 355 | Ga0114129_10002364 | 3300009147 | Bacteria | 26182 |
| 356 | Ga0114129_10009760 | 3300009147 | Bacteria | 13687 |
| 357 | Ga0114129_10044085 | 3300009147 | Bacteria | 6275 |
| 358 | Ga0114129_10065576 | 3300009147 | Bacteria | 5068 |
| 359 | Ga0114129_10114936 | 3300009147 | Bacteria | 3710 |
| 360 | Ga0114129_10128300 | 3300009147 | Bacteria | 3485 |
| 361 | Ga0114129_10133933 | 3300009147 | Bacteria | 3402 |
| 362 | Ga0114129_10389377 | 3300009147 | Unclassified | 1839 |
| 363 | Ga0114129_10561999 | 3300009147 | Bacteria | 1482 |
| 364 | Ga0114129_10564287 | 3300009147 | Bacteria | 1479 |
| 365 | Ga0114129_10872830 | 3300009147 | Unclassified | 1142 |
| 366 | Ga0114129_11450487 | 3300009147 | Unclassified | 845 |
| 367 | Ga0114129_12041945 | 3300009147 | Bacteria | 693 |
| 368 | Ga0105243_10010615 | 3300009148 | Bacteria | 6991 |
| 369 | Ga0105243_11036677 | 3300009148 | Bacteria | 825 |
| 370 | Ga0105241_10037656 | 3300009174 | Unclassified | 3644 |
| 371 | Ga0105241_10548354 | 3300009174 | Bacteria | 1038 |
| 372 | Ga0105241_10827330 | 3300009174 | Bacteria | 855 |
| 373 | Ga0105242_10056291 | 3300009176 | Unclassified | 3218 |
| 374 | Ga0105242_10068023 | 3300009176 | Bacteria | 2946 |
| 375 | Ga0105242_10410497 | 3300009176 | Unclassified | 1266 |
| 376 | Ga0105242_10440060 | 3300009176 | Bacteria | 1226 |
| 377 | Ga0105242_11177242 | 3300009176 | Unclassified | 785 |
| 378 | Ga0105242_11926436 | 3300009176 | Unclassified | 632 |
| 379 | Ga0105248_10047176 | 3300009177 | Unclassified | 4831 |
| 380 | Ga0105248_10138848 | 3300009177 | Unclassified | 2741 |
| 381 | Ga0105248_10582010 | 3300009177 | Unclassified | 1263 |
| 382 | Ga0105248_10691240 | 3300009177 | Bacteria | 1151 |
| 383 | Ga0105248_11505434 | 3300009177 | Unclassified | 762 |
| 384 | Ga0105248_11943966 | 3300009177 | Bacteria | 668 |
| 385 | Ga0105238_10002348 | 3300009551 | Bacteria | 19032 |
| 386 | Ga0105238_10285520 | 3300009551 | Bacteria | 1632 |
| 387 | Ga0105238_10536054 | 3300009551 | Bacteria | 1174 |
| 388 | Ga0105238_12294211 | 3300009551 | Bacteria | 575 |
| 389 | Ga0105249_10000009 | 3300009553 | Bacteria | 313866 |
| 390 | Ga0105249_10425041 | 3300009553 | Bacteria | 1363 |
| 391 | Ga0105249_11302912 | 3300009553 | Bacteria | 798 |
| 392 | Ga0105249_11333149 | 3300009553 | Unclassified | 789 |
| 393 | Ga0105249_11550759 | 3300009553 | Bacteria | 735 |
| 394 | Ga0105249_12223141 | 3300009553 | Bacteria | 621 |
| 395 | Ga0105239_10520827 | 3300010375 | Bacteria | 1353 |
| 396 | Ga0105246_10766853 | 3300011119 | Unclassified | 852 |
| 397 | Ga0105246_10977784 | 3300011119 | Unclassified | 765 |
| 398 | Ga0157373_10001979 | 3300013100 | Bacteria | 15540 |
| 399 | Ga0157373_10077430 | 3300013100 | Bacteria | 2346 |
| 400 | Ga0157373_10406617 | 3300013100 | Bacteria | 976 |
| 401 | Ga0157370_10005166 | 3300013104 | Bacteria | 14723 |
| 402 | Ga0157370_10025263 | 3300013104 | Bacteria | 5880 |
| 403 | Ga0157370_10026940 | 3300013104 | Bacteria | 5669 |
| 404 | Ga0157370_10083270 | 3300013104 | Bacteria | 3008 |
| 405 | Ga0157370_10633844 | 3300013104 | Unclassified | 977 |
| 406 | Ga0157369_10033518 | 3300013105 | Bacteria | 5643 |
| 407 | Ga0157369_10077478 | 3300013105 | Unclassified | 3563 |
| 408 | Ga0157369_10095847 | 3300013105 | Bacteria | 3165 |
| 409 | Ga0157369_10366865 | 3300013105 | Unclassified | 1495 |
| 410 | Ga0157378_10112678 | 3300013297 | Bacteria | 2496 |
| 411 | Ga0157378_10453520 | 3300013297 | Bacteria | 1273 |
| 412 | Ga0157378_10934611 | 3300013297 | Bacteria | 899 |
| 413 | Ga0163162_10087734 | 3300013306 | Unclassified | 3190 |
| 414 | Ga0157372_10003100 | 3300013307 | Bacteria | 17906 |
| 415 | Ga0157372_10025597 | 3300013307 | Bacteria | 6419 |
| 416 | Ga0157372_10112196 | 3300013307 | Bacteria | 3124 |
| 417 | Ga0157372_10205499 | 3300013307 | Bacteria | 2282 |
| 418 | Ga0157372_10324786 | 3300013307 | Bacteria | 1792 |
| 419 | Ga0157372_10762270 | 3300013307 | Bacteria | 1125 |
| 420 | Ga0157372_10939269 | 3300013307 | Unclassified | 1003 |
| 421 | Ga0157375_10154373 | 3300013308 | Unclassified | 2433 |
| 422 | Ga0157375_10261427 | 3300013308 | Bacteria | 1892 |
| 423 | Ga0157375_10609711 | 3300013308 | Unclassified | 1250 |
| 424 | Ga0163163_10031924 | 3300014325 | Bacteria | 5086 |
| 425 | Ga0163163_10055432 | 3300014325 | Bacteria | 3918 |
| 426 | Ga0157380_10001150 | 3300014326 | Bacteria | 17085 |
| 427 | Ga0157380_10076789 | 3300014326 | Bacteria | 2720 |
| 428 | Ga0157380_10174919 | 3300014326 | Bacteria | 1880 |
| 429 | Ga0182008_10003880 | 3300014497 | Bacteria | 8869 |
| 430 | Ga0157377_10054391 | 3300014745 | Bacteria | 2266 |
| 431 | Ga0157377_10072114 | 3300014745 | Bacteria | 1998 |
| 432 | Ga0157377_10424550 | 3300014745 | Unclassified | 911 |
| 433 | Ga0157379_10157725 | 3300014968 | Unclassified | 2047 |
| 434 | Ga0157379_10682317 | 3300014968 | Unclassified | 963 |
| 435 | Ga0157376_10011478 | 3300014969 | Bacteria | 6532 |
| 436 | Ga0157376_10084412 | 3300014969 | Unclassified | 2734 |
| 437 | Ga0157376_10106129 | 3300014969 | Bacteria | 2464 |
| 438 | Ga0157376_10525531 | 3300014969 | Bacteria | 1167 |
| 439 | Ga0163161_10681015 | 3300017792 | Bacteria | 855 |
| 440 | Ga0224712_10043063 | 3300022467 | Unclassified | 1714 |
| 441 | Ga0207653_10000673 | 3300025885 | Bacteria | 11740 |
| 442 | Ga0207653_10100922 | 3300025885 | Unclassified | 1021 |
| 443 | Ga0207653_10156470 | 3300025885 | Unclassified | 841 |
| 444 | Ga0207653_10165287 | 3300025885 | Bacteria | 821 |
| 445 | Ga0207682_10006741 | 3300025893 | Bacteria | 4612 |
| 446 | Ga0207682_10030235 | 3300025893 | Bacteria | 2168 |
| 447 | Ga0207682_10032639 | 3300025893 | Bacteria | 2094 |
| 448 | Ga0207682_10097977 | 3300025893 | Bacteria | 1279 |
| 449 | Ga0207682_10111105 | 3300025893 | Bacteria | 1207 |
| 450 | Ga0207682_10432131 | 3300025893 | Unclassified | 623 |
| 451 | Ga0207642_10090879 | 3300025899 | Bacteria | 1507 |
| 452 | Ga0207642_10346988 | 3300025899 | Unclassified | 874 |
| 453 | Ga0207710_10072773 | 3300025900 | Unclassified | 1579 |
| 454 | Ga0207710_10232586 | 3300025900 | Bacteria | 918 |
| 455 | Ga0207688_10220066 | 3300025901 | Unclassified | 1143 |
| 456 | Ga0207688_10257494 | 3300025901 | Unclassified | 1058 |
| 457 | Ga0207680_10001175 | 3300025903 | Bacteria | 12354 |
| 458 | Ga0207680_10168416 | 3300025903 | Bacteria | 1474 |
| 459 | Ga0207680_10380976 | 3300025903 | Bacteria | 994 |
| 460 | Ga0207685_10006550 | 3300025905 | Bacteria | 3180 |
| 461 | Ga0207699_10023696 | 3300025906 | Bacteria | 3343 |
| 462 | Ga0207699_10087663 | 3300025906 | Bacteria | 1946 |
| 463 | Ga0207645_10019939 | 3300025907 | Bacteria | 4389 |
| 464 | Ga0207645_10540499 | 3300025907 | Unclassified | 790 |
| 465 | Ga0207643_10049906 | 3300025908 | Bacteria | 2372 |
| 466 | Ga0207643_10064802 | 3300025908 | Bacteria | 2092 |
| 467 | Ga0207643_10067765 | 3300025908 | Bacteria | 2049 |
| 468 | Ga0207643_10077741 | 3300025908 | Bacteria | 1919 |
| 469 | Ga0207643_10149078 | 3300025908 | Bacteria | 1401 |
| 470 | Ga0207705_10095851 | 3300025909 | Bacteria | 2178 |
| 471 | Ga0207705_11087022 | 3300025909 | Bacteria | 616 |
| 472 | Ga0207684_10024881 | 3300025910 | Bacteria | 5101 |
| 473 | Ga0207684_10062308 | 3300025910 | Bacteria | 3166 |
| 474 | Ga0207684_10121077 | 3300025910 | Bacteria | 2243 |
| 475 | Ga0207684_10142591 | 3300025910 | Unclassified | 2060 |
| 476 | Ga0207654_10134561 | 3300025911 | Bacteria | 1568 |
| 477 | Ga0207654_10270625 | 3300025911 | Bacteria | 1146 |
| 478 | Ga0207654_10353099 | 3300025911 | Unclassified | 1013 |
| 479 | Ga0207654_10503788 | 3300025911 | Bacteria | 855 |
| 480 | Ga0207707_10002830 | 3300025912 | Bacteria | 15470 |
| 481 | Ga0207707_10007025 | 3300025912 | Bacteria | 9818 |
| 482 | Ga0207707_10007538 | 3300025912 | Bacteria | 9479 |
| 483 | Ga0207707_10013449 | 3300025912 | Bacteria | 7132 |
| 484 | Ga0207707_10021885 | 3300025912 | Bacteria | 5589 |
| 485 | Ga0207707_10032395 | 3300025912 | Unclassified | 4574 |
| 486 | Ga0207707_10088716 | 3300025912 | Bacteria | 2702 |
| 487 | Ga0207695_10021370 | 3300025913 | Bacteria | 7384 |
| 488 | Ga0207695_10056919 | 3300025913 | Unclassified | 4066 |
| 489 | Ga0207695_10098767 | 3300025913 | Bacteria | 2918 |
| 490 | Ga0207695_10268700 | 3300025913 | Bacteria | 1601 |
| 491 | Ga0207695_10570005 | 3300025913 | Bacteria | 1013 |
| 492 | Ga0207663_10000013 | 3300025916 | Bacteria | 167304 |
| 493 | Ga0207663_10080312 | 3300025916 | Unclassified | 2132 |
| 494 | Ga0207663_11273394 | 3300025916 | Unclassified | 592 |
| 495 | Ga0207660_10003505 | 3300025917 | Bacteria | 10221 |
| 496 | Ga0207660_10010245 | 3300025917 | Bacteria | 6076 |
| 497 | Ga0207660_10056159 | 3300025917 | Unclassified | 2816 |
| 498 | Ga0207660_10067901 | 3300025917 | Unclassified | 2584 |
| 499 | Ga0207660_10093066 | 3300025917 | Bacteria | 2239 |
| 500 | Ga0207660_10221046 | 3300025917 | Bacteria | 1486 |
| 501 | Ga0207662_10314488 | 3300025918 | Bacteria | 1044 |
| 502 | Ga0207662_10467829 | 3300025918 | Bacteria | 864 |
| 503 | Ga0207657_10020792 | 3300025919 | Bacteria | 6194 |
| 504 | Ga0207657_10192945 | 3300025919 | Bacteria | 1642 |
| 505 | Ga0207649_10012805 | 3300025920 | Unclassified | 4667 |
| 506 | Ga0207649_10206394 | 3300025920 | Bacteria | 1391 |
| 507 | Ga0207649_10323897 | 3300025920 | Bacteria | 1133 |
| 508 | Ga0207649_11302334 | 3300025920 | Bacteria | 575 |
| 509 | Ga0207652_10005795 | 3300025921 | Bacteria | 10023 |
| 510 | Ga0207652_10009315 | 3300025921 | Bacteria | 7897 |
| 511 | Ga0207652_10014537 | 3300025921 | Bacteria | 6378 |
| 512 | Ga0207652_10021992 | 3300025921 | Bacteria | 5269 |
| 513 | Ga0207652_10022261 | 3300025921 | Bacteria | 5241 |
| 514 | Ga0207652_10263694 | 3300025921 | Bacteria | 1554 |
| 515 | Ga0207646_10016789 | 3300025922 | Bacteria | 6867 |
| 516 | Ga0207646_10043666 | 3300025922 | Bacteria | 4025 |
| 517 | Ga0207646_10058473 | 3300025922 | Bacteria | 3443 |
| 518 | Ga0207646_10076093 | 3300025922 | Bacteria | 2999 |
| 519 | Ga0207646_10637444 | 3300025922 | Bacteria | 955 |
| 520 | Ga0207646_10946639 | 3300025922 | Unclassified | 763 |
| 521 | Ga0207646_11099901 | 3300025922 | Unclassified | 700 |
| 522 | Ga0207681_10046539 | 3300025923 | Bacteria | 2918 |
| 523 | Ga0207681_10050799 | 3300025923 | Unclassified | 2806 |
| 524 | Ga0207681_10063307 | 3300025923 | Bacteria | 2550 |
| 525 | Ga0207681_11248536 | 3300025923 | Unclassified | 624 |
| 526 | Ga0207694_10002177 | 3300025924 | Bacteria | 16104 |
| 527 | Ga0207694_10025230 | 3300025924 | Bacteria | 4517 |
| 528 | Ga0207694_10950141 | 3300025924 | Bacteria | 727 |
| 529 | Ga0207650_10007194 | 3300025925 | Bacteria | 7586 |
| 530 | Ga0207650_10009678 | 3300025925 | Bacteria | 6589 |
| 531 | Ga0207650_10570392 | 3300025925 | Unclassified | 950 |
| 532 | Ga0207659_10001467 | 3300025926 | Bacteria | 14057 |
| 533 | Ga0207659_10006964 | 3300025926 | Bacteria | 6945 |
| 534 | Ga0207659_10022504 | 3300025926 | Bacteria | 4197 |
| 535 | Ga0207659_10035440 | 3300025926 | Bacteria | 3449 |
| 536 | Ga0207659_10048830 | 3300025926 | Bacteria | 2999 |
| 537 | Ga0207659_10106881 | 3300025926 | Unclassified | 2120 |
| 538 | Ga0207659_10422999 | 3300025926 | Bacteria | 1118 |
| 539 | Ga0207659_10793903 | 3300025926 | Unclassified | 813 |
| 540 | Ga0207659_10867018 | 3300025926 | Unclassified | 776 |
| 541 | Ga0207687_10069169 | 3300025927 | Unclassified | 2517 |
| 542 | Ga0207687_10395740 | 3300025927 | Bacteria | 1135 |
| 543 | Ga0207700_10032936 | 3300025928 | Bacteria | 3703 |
| 544 | Ga0207700_10323861 | 3300025928 | Bacteria | 1336 |
| 545 | Ga0207664_10625874 | 3300025929 | Bacteria | 967 |
| 546 | Ga0207664_11308958 | 3300025929 | Unclassified | 644 |
| 547 | Ga0207644_10071660 | 3300025931 | Bacteria | 2536 |
| 548 | Ga0207644_11242437 | 3300025931 | Unclassified | 626 |
| 549 | Ga0207690_10070974 | 3300025932 | Bacteria | 2401 |
| 550 | Ga0207706_10080228 | 3300025933 | Bacteria | 2869 |
| 551 | Ga0207706_10290195 | 3300025933 | Bacteria | 1426 |
| 552 | Ga0207706_10542795 | 3300025933 | Unclassified | 1001 |
| 553 | Ga0207686_10036639 | 3300025934 | Bacteria | 2954 |
| 554 | Ga0207686_10100650 | 3300025934 | Bacteria | 1929 |
| 555 | Ga0207686_10294769 | 3300025934 | Bacteria | 1202 |
| 556 | Ga0207686_10910024 | 3300025934 | Bacteria | 710 |
| 557 | Ga0207686_11458017 | 3300025934 | Unclassified | 564 |
| 558 | Ga0207709_10020091 | 3300025935 | Bacteria | 3765 |
| 559 | Ga0207709_11132387 | 3300025935 | Unclassified | 643 |
| 560 | Ga0207670_10021987 | 3300025936 | Bacteria | 3944 |
| 561 | Ga0207670_10423268 | 3300025936 | Bacteria | 1069 |
| 562 | Ga0207670_10695398 | 3300025936 | Bacteria | 841 |
| 563 | Ga0207669_10019056 | 3300025937 | Bacteria | 3564 |
| 564 | Ga0207669_10151286 | 3300025937 | Bacteria | 1626 |
| 565 | Ga0207669_10277566 | 3300025937 | Unclassified | 1262 |
| 566 | Ga0207669_10288038 | 3300025937 | Bacteria | 1242 |
| 567 | Ga0207704_10124302 | 3300025938 | Bacteria | 1773 |
| 568 | Ga0207704_10365956 | 3300025938 | Bacteria | 1127 |
| 569 | Ga0207704_10436336 | 3300025938 | Bacteria | 1042 |
| 570 | Ga0207665_10038396 | 3300025939 | Bacteria | 3188 |
| 571 | Ga0207665_10471380 | 3300025939 | Bacteria | 966 |
| 572 | Ga0207665_10616366 | 3300025939 | Unclassified | 848 |
| 573 | Ga0207691_10007331 | 3300025940 | Bacteria | 10639 |
| 574 | Ga0207691_10041190 | 3300025940 | Bacteria | 4265 |
| 575 | Ga0207691_10071130 | 3300025940 | Unclassified | 3140 |
| 576 | Ga0207691_10153365 | 3300025940 | Bacteria | 2025 |
| 577 | Ga0207711_10103535 | 3300025941 | Unclassified | 2521 |
| 578 | Ga0207689_10009577 | 3300025942 | Bacteria | 8355 |
| 579 | Ga0207689_10014114 | 3300025942 | Bacteria | 6799 |
| 580 | Ga0207689_10105281 | 3300025942 | Bacteria | 2318 |
| 581 | Ga0207689_10201671 | 3300025942 | Bacteria | 1642 |
| 582 | Ga0207689_10210998 | 3300025942 | Bacteria | 1604 |
| 583 | Ga0207689_10512921 | 3300025942 | Bacteria | 1005 |
| 584 | Ga0207661_10009843 | 3300025944 | Bacteria | 6867 |
| 585 | Ga0207661_10153781 | 3300025944 | Bacteria | 1990 |
| 586 | Ga0207661_11488821 | 3300025944 | Bacteria | 620 |
| 587 | Ga0207679_10005731 | 3300025945 | Bacteria | 7792 |
| 588 | Ga0207679_10021948 | 3300025945 | Bacteria | 4339 |
| 589 | Ga0207679_10023338 | 3300025945 | Bacteria | 4228 |
| 590 | Ga0207679_10214703 | 3300025945 | Bacteria | 1615 |
| 591 | Ga0207679_10247528 | 3300025945 | Bacteria | 1513 |
| 592 | Ga0207679_10261240 | 3300025945 | Bacteria | 1477 |
| 593 | Ga0207679_11057306 | 3300025945 | Bacteria | 744 |
| 594 | Ga0207667_10129191 | 3300025949 | Bacteria | 2602 |
| 595 | Ga0207667_10199440 | 3300025949 | Bacteria | 2053 |
| 596 | Ga0207667_10276822 | 3300025949 | Bacteria | 1715 |
| 597 | Ga0207667_11627545 | 3300025949 | Unclassified | 614 |
| 598 | Ga0207651_10069913 | 3300025960 | Bacteria | 2481 |
| 599 | Ga0207651_10309015 | 3300025960 | Unclassified | 1318 |
| 600 | Ga0207651_10540898 | 3300025960 | Bacteria | 1012 |
| 601 | Ga0207712_10000080 | 3300025961 | Bacteria | 114486 |
| 602 | Ga0207712_10483688 | 3300025961 | Unclassified | 1056 |
| 603 | Ga0207712_10634788 | 3300025961 | Unclassified | 927 |
| 604 | Ga0207712_11097374 | 3300025961 | Bacteria | 708 |
| 605 | Ga0207712_11803443 | 3300025961 | Unclassified | 548 |
| 606 | Ga0207668_10000945 | 3300025972 | Bacteria | 17477 |
| 607 | Ga0207668_10051906 | 3300025972 | Unclassified | 2835 |
| 608 | Ga0207668_10920680 | 3300025972 | Bacteria | 779 |
| 609 | Ga0207640_10006646 | 3300025981 | Bacteria | 6354 |
| 610 | Ga0207640_10009883 | 3300025981 | Bacteria | 5356 |
| 611 | Ga0207640_10014824 | 3300025981 | Unclassified | 4496 |
| 612 | Ga0207640_10129659 | 3300025981 | Unclassified | 1821 |
| 613 | Ga0207658_10324987 | 3300025986 | Unclassified | 1333 |
| 614 | Ga0207658_11108654 | 3300025986 | Unclassified | 723 |
| 615 | Ga0207677_10129935 | 3300026023 | Bacteria | 1911 |
| 616 | Ga0207703_10027965 | 3300026035 | Unclassified | 4440 |
| 617 | Ga0207703_10145042 | 3300026035 | Unclassified | 2064 |
| 618 | Ga0207703_10457435 | 3300026035 | Bacteria | 1193 |
| 619 | Ga0207639_10011420 | 3300026041 | Bacteria | 6168 |
| 620 | Ga0207678_10068626 | 3300026067 | Bacteria | 3041 |
| 621 | Ga0207678_10069971 | 3300026067 | Unclassified | 3009 |
| 622 | Ga0207678_10452100 | 3300026067 | Unclassified | 1117 |
| 623 | Ga0207708_10047164 | 3300026075 | Bacteria | 3281 |
| 624 | Ga0207708_10066583 | 3300026075 | Bacteria | 2754 |
| 625 | Ga0207708_10079001 | 3300026075 | Bacteria | 2527 |
| 626 | Ga0207708_10138002 | 3300026075 | Bacteria | 1911 |
| 627 | Ga0207708_10184107 | 3300026075 | Bacteria | 1659 |
| 628 | Ga0207708_10727579 | 3300026075 | Unclassified | 850 |
| 629 | Ga0207702_10158068 | 3300026078 | Bacteria | 2068 |
| 630 | Ga0207702_10341188 | 3300026078 | Bacteria | 1431 |
| 631 | Ga0207641_10339745 | 3300026088 | Bacteria | 1429 |
| 632 | Ga0207648_10004141 | 3300026089 | Bacteria | 15006 |
| 633 | Ga0207648_10105931 | 3300026089 | Unclassified | 2467 |
| 634 | Ga0207648_10420506 | 3300026089 | Unclassified | 1213 |
| 635 | Ga0207648_10592881 | 3300026089 | Archaea | 1021 |
| 636 | Ga0207676_10002798 | 3300026095 | Bacteria | 12399 |
| 637 | Ga0207676_10082041 | 3300026095 | Bacteria | 2621 |
| 638 | Ga0207676_10320891 | 3300026095 | Bacteria | 1422 |
| 639 | Ga0207676_10612805 | 3300026095 | Unclassified | 1047 |
| 640 | Ga0207674_10079729 | 3300026116 | Bacteria | 3277 |
| 641 | Ga0207674_11470889 | 3300026116 | Unclassified | 650 |
| 642 | Ga0207674_11527030 | 3300026116 | Bacteria | 637 |
| 643 | Ga0207675_100105136 | 3300026118 | Unclassified | 2661 |
| 644 | Ga0207675_100140924 | 3300026118 | Bacteria | 2290 |
| 645 | Ga0207675_100190766 | 3300026118 | Bacteria | 1966 |
| 646 | Ga0207675_100193580 | 3300026118 | Bacteria | 1951 |
| 647 | Ga0207675_100325863 | 3300026118 | Bacteria | 1501 |
| 648 | Ga0207675_100432440 | 3300026118 | Bacteria | 1302 |
| 649 | Ga0207675_100485347 | 3300026118 | Bacteria | 1228 |
| 650 | Ga0207683_10349013 | 3300026121 | Unclassified | 1358 |
| 651 | Ga0207683_10354994 | 3300026121 | Bacteria | 1346 |
| 652 | Ga0207683_10751744 | 3300026121 | Unclassified | 905 |
| 653 | Ga0207698_10012351 | 3300026142 | Bacteria | 5585 |
| 654 | Ga0207698_10186175 | 3300026142 | Bacteria | 1844 |
| 655 | Ga0207698_10438187 | 3300026142 | Bacteria | 1258 |
| 656 | Ga0207698_10601847 | 3300026142 | Bacteria | 1084 |
| 657 | Ga0210002_1040301 | 3300027617 | Unclassified | 792 |
| 658 | Ga0209588_1026634 | 3300027671 | Bacteria | 1836 |
| 659 | Ga0209971_1019408 | 3300027682 | Bacteria | 1613 |
| 660 | Ga0209974_10116270 | 3300027876 | Unclassified | 945 |
| 661 | Ga0207428_10000145 | 3300027907 | Bacteria | 96603 |
| 662 | Ga0207428_10000692 | 3300027907 | Bacteria | 39155 |
| 663 | Ga0207428_10012689 | 3300027907 | Bacteria | 7388 |
| 664 | Ga0207428_10022308 | 3300027907 | Bacteria | 5346 |
| 665 | Ga0268266_10058863 | 3300028379 | Unclassified | 3309 |
| 666 | Ga0268266_11010878 | 3300028379 | Bacteria | 805 |
| 667 | Ga0268266_11428627 | 3300028379 | Bacteria | 667 |
| 668 | Ga0268265_10031263 | 3300028380 | Bacteria | 3843 |
| 669 | Ga0268265_10172604 | 3300028380 | Bacteria | 1849 |
| 670 | Ga0268265_10212169 | 3300028380 | Bacteria | 1688 |
| 671 | Ga0268265_11763364 | 3300028380 | Unclassified | 625 |
| 672 | Ga0268264_10038372 | 3300028381 | Unclassified | 3953 |
| 673 | Ga0268264_10109961 | 3300028381 | Bacteria | 2412 |
| 674 | Ga0268264_10204946 | 3300028381 | Unclassified | 1807 |
| 675 | Ga0268264_10362474 | 3300028381 | Unclassified | 1383 |
| 676 | Ga0268264_10669658 | 3300028381 | Bacteria | 1028 |
| 677 | Ga0268264_11511854 | 3300028381 | Unclassified | 682 |
| 678 | Ga0307408_100120771 | 3300031548 | Bacteria | 2029 |
| 679 | Ga0307408_100147946 | 3300031548 | Bacteria | 1851 |
| 680 | Ga0307408_100271444 | 3300031548 | Unclassified | 1408 |
| 681 | Ga0307408_100374397 | 3300031548 | Bacteria | 1215 |
| 682 | Ga0307408_100505207 | 3300031548 | Unclassified | 1059 |
| 683 | Ga0307405_10013579 | 3300031731 | Bacteria | 4349 |
| 684 | Ga0307405_10022153 | 3300031731 | Bacteria | 3587 |
| 685 | Ga0307405_10055004 | 3300031731 | Bacteria | 2488 |
| 686 | Ga0307405_10168006 | 3300031731 | Bacteria | 1561 |
| 687 | Ga0307405_11122896 | 3300031731 | Unclassified | 676 |
| 688 | Ga0307413_10001185 | 3300031824 | Bacteria | 9614 |
| 689 | Ga0307413_10004760 | 3300031824 | Bacteria | 5958 |
| 690 | Ga0307413_10026259 | 3300031824 | Bacteria | 3207 |
| 691 | Ga0307413_10071242 | 3300031824 | Bacteria | 2189 |
| 692 | Ga0307413_10079897 | 3300031824 | Bacteria | 2092 |
| 693 | Ga0307413_10081647 | 3300031824 | Bacteria | 2074 |
| 694 | Ga0307413_10807980 | 3300031824 | Bacteria | 789 |
| 695 | Ga0307413_11455570 | 3300031824 | Unclassified | 604 |
| 696 | Ga0307410_10002120 | 3300031852 | Bacteria | 9423 |
| 697 | Ga0307410_10090223 | 3300031852 | Bacteria | 2173 |
| 698 | Ga0307410_10179115 | 3300031852 | Unclassified | 1603 |
| 699 | Ga0307410_10197032 | 3300031852 | Bacteria | 1535 |
| 700 | Ga0307410_10221700 | 3300031852 | Unclassified | 1455 |
| 701 | Ga0307410_10263685 | 3300031852 | Unclassified | 1344 |
| 702 | Ga0307410_10320471 | 3300031852 | Unclassified | 1230 |
| 703 | Ga0307410_10512625 | 3300031852 | Unclassified | 988 |
| 704 | Ga0307410_10563839 | 3300031852 | Bacteria | 945 |
| 705 | Ga0307406_10011159 | 3300031901 | Bacteria | 5091 |
| 706 | Ga0307406_10015520 | 3300031901 | Bacteria | 4410 |
| 707 | Ga0307406_10016675 | 3300031901 | Bacteria | 4275 |
| 708 | Ga0307406_10121951 | 3300031901 | Bacteria | 1814 |
| 709 | Ga0307406_10292469 | 3300031901 | Unclassified | 1247 |
| 710 | Ga0307406_10526177 | 3300031901 | Unclassified | 963 |
| 711 | Ga0307406_11095203 | 3300031901 | Bacteria | 688 |
| 712 | Ga0307407_10000365 | 3300031903 | Bacteria | 13609 |
| 713 | Ga0307407_10001077 | 3300031903 | Bacteria | 9485 |
| 714 | Ga0307407_10014326 | 3300031903 | Bacteria | 3878 |
| 715 | Ga0307407_10020187 | 3300031903 | Bacteria | 3408 |
| 716 | Ga0307407_10035113 | 3300031903 | Unclassified | 2751 |
| 717 | Ga0307407_10074815 | 3300031903 | Bacteria | 2028 |
| 718 | Ga0307407_10129409 | 3300031903 | Unclassified | 1612 |
| 719 | Ga0307407_10693013 | 3300031903 | Unclassified | 767 |
| 720 | Ga0307412_10018673 | 3300031911 | Bacteria | 4179 |
| 721 | Ga0307412_10020364 | 3300031911 | Bacteria | 4036 |
| 722 | Ga0307412_10026436 | 3300031911 | Bacteria | 3607 |
| 723 | Ga0307412_10193373 | 3300031911 | Unclassified | 1540 |
| 724 | Ga0307412_10262531 | 3300031911 | Bacteria | 1347 |
| 725 | Ga0307409_100041085 | 3300031995 | Bacteria | 3451 |
| 726 | Ga0307409_100054525 | 3300031995 | Bacteria | 3079 |
| 727 | Ga0307409_100219625 | 3300031995 | Unclassified | 1715 |
| 728 | Ga0307409_100474349 | 3300031995 | Unclassified | 1212 |
| 729 | Ga0307409_100600829 | 3300031995 | Bacteria | 1087 |
| 730 | Ga0307409_100683918 | 3300031995 | Bacteria | 1023 |
| 731 | Ga0307409_100757429 | 3300031995 | Unclassified | 975 |
| 732 | Ga0307416_100002522 | 3300032002 | Bacteria | 10532 |
| 733 | Ga0307416_100029905 | 3300032002 | Bacteria | 4078 |
| 734 | Ga0307416_100041259 | 3300032002 | Bacteria | 3592 |
| 735 | Ga0307416_100104241 | 3300032002 | Bacteria | 2479 |
| 736 | Ga0307416_100154740 | 3300032002 | Unclassified | 2109 |
| 737 | Ga0307416_100232016 | 3300032002 | Unclassified | 1780 |
| 738 | Ga0307416_100389814 | 3300032002 | Unclassified | 1426 |
| 739 | Ga0307416_100458935 | 3300032002 | Bacteria | 1328 |
| 740 | Ga0307416_100751074 | 3300032002 | Bacteria | 1068 |
| 741 | Ga0307414_10030341 | 3300032004 | Bacteria | 3530 |
| 742 | Ga0307414_10114859 | 3300032004 | Bacteria | 2057 |
| 743 | Ga0307414_10157526 | 3300032004 | Bacteria | 1800 |
| 744 | Ga0307414_10216344 | 3300032004 | Unclassified | 1570 |
| 745 | Ga0307414_10294651 | 3300032004 | Bacteria | 1369 |
| 746 | Ga0307414_10333627 | 3300032004 | Unclassified | 1295 |
| 747 | Ga0307414_10377849 | 3300032004 | Bacteria | 1224 |
| 748 | Ga0307414_11449064 | 3300032004 | Bacteria | 638 |
| 749 | Ga0307411_10000550 | 3300032005 | Bacteria | 13311 |
| 750 | Ga0307411_10006618 | 3300032005 | Bacteria | 5814 |
| 751 | Ga0307411_10015046 | 3300032005 | Bacteria | 4328 |
| 752 | Ga0307411_10016003 | 3300032005 | Bacteria | 4234 |
| 753 | Ga0307411_10051760 | 3300032005 | Bacteria | 2681 |
| 754 | Ga0307411_10101967 | 3300032005 | Bacteria | 2032 |
| 755 | Ga0307411_10954433 | 3300032005 | Unclassified | 765 |
| 756 | Ga0307415_100011767 | 3300032126 | Bacteria | 5026 |
| 757 | Ga0307415_100021693 | 3300032126 | Bacteria | 3953 |
| 758 | Ga0307415_100047267 | 3300032126 | Bacteria | 2896 |
| 759 | Ga0307415_100072953 | 3300032126 | Unclassified | 2419 |
| 760 | Ga0307415_100075212 | 3300032126 | Bacteria | 2390 |
| 761 | Ga0307415_100140040 | 3300032126 | Bacteria | 1846 |
| 762 | Ga0307415_100154435 | 3300032126 | Bacteria | 1770 |
| 763 | Ga0307415_100258973 | 3300032126 | Unclassified | 1418 |
| 764 | Ga0307415_100622730 | 3300032126 | Unclassified | 963 |
| 765 | Ga0307415_101063413 | 3300032126 | Unclassified | 756 |
| 766 | Ga0373930_0001310 | 3300034816 | Unclassified | 3668 |
| 767 | Ga0373959_0008146 | 3300034820 | Bacteria | 1776 |
| 768 | Ga0373938_0000261 | 3300034957 | Bacteria | 8280 |
| 769 | Ga0373928_0015902 | 3300035084 | Bacteria | 1535 |
| 770 | Ga0373929_0002196 | 3300035085 | Bacteria | 3618 |
| 771 | Ga0373934_0081709 | 3300035086 | Bacteria | 1299 |
| 772 | Ga0373951_0001055 | 3300035091 | Bacteria | 7404 |
| 773 | Ga0373923_0059176 | 3300035111 | Unclassified | 1624 |
| 774 | Ga0373932_0000295 | 3300035112 | Bacteria | 15002 |
| 775 | Ga0373936_0006646 | 3300035113 | Bacteria | 4354 |
| 776 | Ga0373936_0336548 | 3300035113 | Bacteria | 686 |
| 777 | Ga0373941_0174088 | 3300035115 | Bacteria | 804 |
| 778 | Ga0373945_0068053 | 3300035116 | Bacteria | 1342 |
| 779 | Ga0373956_0409280 | 3300035119 | Bacteria | 647 |
| 780 | Ga0373957_0110651 | 3300035120 | Bacteria | 1106 |
| 781 | Ga0373960_0000409 | 3300035121 | Bacteria | 8403 |
| 782 | Ga0373943_0105195 | 3300035170 | Bacteria | 1481 |
| 783 | Ga0373955_0064428 | 3300035172 | Unclassified | 2032 |
| 784 | Ga0373955_0090254 | 3300035172 | Bacteria | 1745 |
| 785 | Ga0373955_0200184 | 3300035172 | Bacteria | 1189 |
| 786 | Ga0373942_0020624 | 3300035207 | Unclassified | 1656 |
| 787 | Ga0373961_0016250 | 3300035241 | Bacteria | 1915 |
| 788 | Ga0373924_0003321 | 3300035410 | Bacteria | 5520 |
| 789 | Ga0373931_0001102 | 3300035691 | Bacteria | 11455 |
| 790 | Ga0373935_0019518 | 3300035692 | Bacteria | 4134 |
| 791 | Ga0373935_0769848 | 3300035692 | Archaea | 710 |
| 792 | Ga0373927_0137851 | 3300035695 | Bacteria | 1595 |
| 793 | Ga0373933_0119766 | 3300035724 | Bacteria | 1648 |
| 794 | Ga0373933_0181363 | 3300035724 | Bacteria | 1343 |
| 795 | Ga0373937_0062208 | 3300036401 | Bacteria | 3431 |
| 796 | Ga0373937_0193787 | 3300036401 | Archaea | 1910 |
| 797 | Ga0373937_0256292 | 3300036401 | Unclassified | 1649 |
| 798 | Ga0373937_0724066 | 3300036401 | Bacteria | 942 |
| 799 | Ga0373925_0144578 | 3300037068 | Bacteria | 1863 |
| 800 | Ga0439453_0046629 | 3300041408 | Unclassified | 865 |
| 801 | Ga0439443_028279 | 3300042003 | Bacteria | 914 |
| 802 | Ga0450920_100502 | 3300042122 | Bacteria | 600 |
| 803 | Ga0450898_018975 | 3300042134 | Unclassified | 1195 |
| 804 | Ga0439446_0075283 | 3300042156 | Bacteria | 1038 |
| 805 | Ga0439435_0005143 | 3300042436 | Bacteria | 2862 |
| 806 | Ga0439444_0009784 | 3300042437 | Unclassified | 1518 |
| 807 | Ga0439444_0110971 | 3300042437 | Unclassified | 631 |
| 808 | Ga0439460_0156337 | 3300042461 | Bacteria | 763 |
| 809 | Ga0439440_0098698 | 3300042993 | Unclassified | 792 |
| 810 | Ga0466957_0346827 | 3300044842 | Unclassified | 1007 |
| 811 | Ga0451576_0018415 | 3300045051 | Bacteria | 7656 |
| 812 | Ga0451576_0063120 | 3300045051 | Bacteria | 3861 |
| 813 | Ga0451576_0251398 | 3300045051 | Bacteria | 1847 |
| 814 | Ga0451576_0555020 | 3300045051 | Bacteria | 1207 |
| 815 | Ga0495592_0113301 | 3300046454 | Bacteria | 1917 |
| 816 | Ga0495592_0212729 | 3300046454 | Unclassified | 1297 |
| 817 | Ga0495603_0178197 | 3300046455 | Bacteria | 1230 |
| 818 | Ga0495629_0780302 | 3300046459 | Unclassified | 631 |
| 819 | Ga0495653_0027217 | 3300046463 | Bacteria | 4577 |
| 820 | Ga0495580_0057515 | 3300046472 | Unclassified | 2737 |
| 821 | Ga0495580_0277722 | 3300046472 | Bacteria | 1143 |
| 822 | Ga0495580_0328525 | 3300046472 | Bacteria | 1039 |
| 823 | Ga0495580_0495935 | 3300046472 | Bacteria | 816 |
| 824 | Ga0495582_0022337 | 3300046473 | Unclassified | 3463 |
| 825 | Ga0495639_0497865 | 3300046475 | Unclassified | 622 |
| 826 | Ga0495662_0004851 | 3300046476 | Bacteria | 6737 |
| 827 | Ga0495662_0019565 | 3300046476 | Bacteria | 3276 |
| 828 | Ga0495662_0248448 | 3300046476 | Unclassified | 876 |
| 829 | Ga0495664_0002656 | 3300046477 | Bacteria | 9618 |
| 830 | Ga0495664_0150220 | 3300046477 | Bacteria | 1413 |
| 831 | Ga0495664_0492913 | 3300046477 | Unclassified | 732 |
| 832 | Ga0495594_0020193 | 3300046499 | Bacteria | 3548 |
| 833 | Ga0495594_0134160 | 3300046499 | Bacteria | 1403 |
| 834 | Ga0495608_0001637 | 3300046511 | Bacteria | 16083 |
| 835 | Ga0495608_0010805 | 3300046511 | Bacteria | 6362 |
| 836 | Ga0495608_0020234 | 3300046511 | Bacteria | 4574 |
| 837 | Ga0495618_0001991 | 3300046514 | Bacteria | 13397 |
| 838 | Ga0495618_0122350 | 3300046514 | Unclassified | 1666 |
| 839 | Ga0495628_0005641 | 3300046516 | Bacteria | 10955 |
| 840 | Ga0495628_0196175 | 3300046516 | Unclassified | 1523 |
| 841 | Ga0495628_0604431 | 3300046516 | Unclassified | 783 |
| 842 | Ga0495630_0003056 | 3300046517 | Bacteria | 11600 |
| 843 | Ga0495630_0018823 | 3300046517 | Bacteria | 5075 |
| 844 | Ga0495630_0096237 | 3300046517 | Bacteria | 2238 |
| 845 | Ga0495643_0002275 | 3300046522 | Bacteria | 15527 |
| 846 | Ga0495652_0013533 | 3300046529 | Bacteria | 7341 |
| 847 | Ga0495652_0061162 | 3300046529 | Bacteria | 3180 |
| 848 | Ga0495652_0278201 | 3300046529 | Unclassified | 1227 |
| 849 | Ga0495665_0014159 | 3300046531 | Bacteria | 4305 |
| 850 | Ga0495665_0366661 | 3300046531 | Unclassified | 733 |
| 851 | Ga0495640_0029246 | 3300046533 | Bacteria | 3958 |
| 852 | Ga0495586_0003746 | 3300046535 | Bacteria | 8147 |
| 853 | Ga0495586_0064693 | 3300046535 | Bacteria | 1993 |
| 854 | Ga0495586_0075406 | 3300046535 | Bacteria | 1846 |
| 855 | Ga0495586_0094288 | 3300046535 | Unclassified | 1656 |
| 856 | Ga0495586_0124250 | 3300046535 | Bacteria | 1443 |
| 857 | Ga0495586_0579320 | 3300046535 | Unclassified | 648 |
| 858 | Ga0495587_0028361 | 3300046536 | Bacteria | 3404 |
| 859 | Ga0495587_0186450 | 3300046536 | Bacteria | 1175 |
| 860 | Ga0495587_0351144 | 3300046536 | Unclassified | 822 |
| 861 | Ga0495598_0007473 | 3300046537 | Bacteria | 2510 |
| 862 | Ga0495598_0028619 | 3300046537 | Unclassified | 1547 |
| 863 | Ga0495621_0062339 | 3300046539 | Bacteria | 1357 |
| 864 | Ga0495621_0234507 | 3300046539 | Unclassified | 746 |
| 865 | Ga0495645_0011238 | 3300046543 | Bacteria | 6295 |
| 866 | Ga0495645_0012084 | 3300046543 | Bacteria | 6084 |
| 867 | Ga0495645_0028039 | 3300046543 | Bacteria | 4092 |
| 868 | Ga0495645_0036000 | 3300046543 | Unclassified | 3609 |
| 869 | Ga0495645_0514047 | 3300046543 | Bacteria | 747 |
| 870 | Ga0495633_0053110 | 3300046558 | Bacteria | 1908 |
| 871 | Ga0495667_0005477 | 3300046559 | Bacteria | 8577 |
| 872 | Ga0495667_0009891 | 3300046559 | Bacteria | 6458 |
| 873 | Ga0495656_0278175 | 3300046615 | Unclassified | 852 |
| 874 | Ga0495634_0010232 | 3300046642 | Bacteria | 6877 |
| 875 | Ga0495634_0017938 | 3300046642 | Bacteria | 5044 |
| 876 | Ga0495634_0021492 | 3300046642 | Bacteria | 4560 |
| 877 | Ga0495634_0286649 | 3300046642 | Bacteria | 999 |
| 878 | Ga0495635_0001727 | 3300046663 | Bacteria | 14708 |
| 879 | Ga0495635_0054941 | 3300046663 | Bacteria | 2743 |
| 880 | Ga0495635_0374341 | 3300046663 | Unclassified | 948 |
| 881 | Ga0495659_0016559 | 3300046664 | Bacteria | 2434 |
| 882 | Ga0495659_0271467 | 3300046664 | Bacteria | 711 |
| 883 | Ga0495588_0042163 | 3300046674 | Bacteria | 2333 |
| 884 | Ga0495657_0009376 | 3300046675 | Bacteria | 7425 |
| 885 | Ga0495657_0327391 | 3300046675 | Bacteria | 910 |
| 886 | Ga0495599_0022725 | 3300046678 | Bacteria | 3916 |
| 887 | Ga0495599_0025293 | 3300046678 | Bacteria | 3715 |
| 888 | Ga0495599_0036091 | 3300046678 | Bacteria | 3103 |
| 889 | Ga0495623_0237001 | 3300046679 | Bacteria | 1032 |
| 890 | Ga0495646_0016822 | 3300046680 | Bacteria | 4645 |
| 891 | Ga0495646_0081311 | 3300046680 | Bacteria | 1888 |
| 892 | Ga0495647_0082643 | 3300046681 | Bacteria | 1305 |
| 893 | Ga0495658_0021669 | 3300046683 | Unclassified | 3391 |
| 894 | Ga0495658_0034523 | 3300046683 | Bacteria | 2776 |
| 895 | Ga0495658_0142410 | 3300046683 | Bacteria | 1467 |
| 896 | Ga0495658_0224770 | 3300046683 | Bacteria | 1176 |
| 897 | Ga0495669_0000961 | 3300046684 | Bacteria | 12028 |
| 898 | Ga0495613_0000660 | 3300046689 | Bacteria | 27311 |
| 899 | Ga0495613_0039334 | 3300046689 | Bacteria | 3506 |
| 900 | Ga0495613_0300090 | 3300046689 | Bacteria | 1112 |
| 901 | Ga0495613_0482872 | 3300046689 | Bacteria | 836 |
| 902 | Ga0495624_0038629 | 3300046690 | Bacteria | 3066 |
| 903 | Ga0495600_0026246 | 3300046809 | Bacteria | 3759 |
| 904 | Ga0495600_0094354 | 3300046809 | Bacteria | 1951 |
| 905 | Ga0495600_0729065 | 3300046809 | Bacteria | 595 |
| 906 | Ga0495581_0060118 | 3300047315 | Bacteria | 2196 |
| 907 | Ga0495581_0195763 | 3300047315 | Bacteria | 1182 |
| 908 | Ga0495604_0019986 | 3300047317 | Bacteria | 5352 |
| 909 | Ga0495604_0158472 | 3300047317 | Unclassified | 1601 |
| 910 | Ga0495674_0001358 | 3300047319 | Bacteria | 23862 |
| 911 | Ga0495674_0012140 | 3300047319 | Bacteria | 8118 |
| 912 | Ga0495674_0450974 | 3300047319 | Unclassified | 1034 |
| 913 | Ga0495680_0016397 | 3300047322 | Bacteria | 6366 |
| 914 | Ga0495680_0019575 | 3300047322 | Bacteria | 5710 |
| 915 | Ga0495680_0464592 | 3300047322 | Unclassified | 864 |
| 916 | Ga0495675_0037732 | 3300047444 | Bacteria | 3077 |
| 917 | Ga0495675_0269970 | 3300047444 | Bacteria | 1017 |
| 918 | Ga0495684_0000093 | 3300047471 | Bacteria | 63048 |
| 919 | Ga0495684_0000933 | 3300047471 | Bacteria | 23728 |
| 920 | Ga0495684_0053774 | 3300047471 | Bacteria | 3071 |
| 921 | Ga0495602_0019077 | 3300048088 | Bacteria | 6821 |
| 922 | Ga0495602_0277085 | 3300048088 | Bacteria | 1237 |
| 923 | Ga0495614_0275871 | 3300048089 | Bacteria | 773 |
| 924 | Ga0496101_0002576 | 3300048904 | Bacteria | 11134 |
| 925 | Ga0496102_0618846 | 3300048905 | Unclassified | 1006 |
| 926 | Ga0496102_1182710 | 3300048905 | Bacteria | 684 |
| 927 | Ga0496103_0555938 | 3300048906 | Bacteria | 732 |
| 928 | Ga0496104_0136031 | 3300048907 | Bacteria | 2361 |
| 929 | Ga0496104_0274869 | 3300048907 | Bacteria | 1597 |
| 930 | Ga0496104_0799810 | 3300048907 | Unclassified | 849 |
| 931 | Ga0496105_0287579 | 3300048908 | Bacteria | 1324 |
| 932 | Ga0496106_0099875 | 3300048909 | Bacteria | 2250 |
| 933 | Ga0496107_0026822 | 3300048910 | Bacteria | 4088 |
| 934 | Ga0496108_0268443 | 3300048911 | Unclassified | 1485 |
| 935 | Ga0496109_0248934 | 3300048912 | Bacteria | 1673 |
| 936 | Ga0496109_0639166 | 3300048912 | Bacteria | 1001 |
| 937 | Ga0496114_0003266 | 3300048917 | Bacteria | 12451 |
| 938 | Ga0496114_1084045 | 3300048917 | Bacteria | 686 |
| 939 | Ga0501295_041730 | 3300049518 | Unclassified | 954 |
| 940 | Ga0501298_126917 | 3300049521 | Unclassified | 606 |
| 941 | Ga0501031_0037755 | 3300049568 | Bacteria | 3153 |
| 942 | Ga0501033_0125534 | 3300049570 | Bacteria | 1861 |
| 943 | Ga0501033_0241992 | 3300049570 | Unclassified | 1280 |
| 944 | Ga0501033_0433941 | 3300049570 | Bacteria | 914 |
| 945 | Ga0501036_0181269 | 3300049572 | Bacteria | 1773 |
| 946 | Ga0501038_0113592 | 3300049574 | Bacteria | 2241 |
| 947 | Ga0501038_0138229 | 3300049574 | Bacteria | 1995 |
| 948 | Ga0501038_0184466 | 3300049574 | Unclassified | 1682 |
| 949 | Ga0501039_0017435 | 3300049575 | Bacteria | 5508 |
| 950 | Ga0501039_0224368 | 3300049575 | Bacteria | 1477 |
| 951 | Ga0501039_0381213 | 3300049575 | Bacteria | 1108 |
| 952 | Ga0501039_0761222 | 3300049575 | Unclassified | 756 |
| 953 | Ga0501040_0009109 | 3300049576 | Bacteria | 6462 |
| 954 | Ga0501040_0021834 | 3300049576 | Bacteria | 4280 |
| 955 | Ga0501040_0023204 | 3300049576 | Bacteria | 4159 |
| 956 | Ga0501040_0263209 | 3300049576 | Bacteria | 1231 |
| 957 | Ga0501040_0575922 | 3300049576 | Bacteria | 813 |
| 958 | Ga0501041_0013143 | 3300049577 | Bacteria | 4905 |
| 959 | Ga0501041_0138649 | 3300049577 | Bacteria | 1516 |
| 960 | Ga0501041_0142191 | 3300049577 | Unclassified | 1496 |
| 961 | Ga0501042_0052005 | 3300049578 | Unclassified | 2922 |
| 962 | Ga0501042_0182853 | 3300049578 | Unclassified | 1512 |
| 963 | Ga0501042_0333182 | 3300049578 | Unclassified | 1097 |
| 964 | Ga0501043_0125938 | 3300049579 | Bacteria | 2009 |
| 965 | Ga0501046_0010812 | 3300049580 | Bacteria | 7824 |
| 966 | Ga0501046_0289442 | 3300049580 | Unclassified | 1198 |
| 967 | Ga0501048_0008220 | 3300049582 | Bacteria | 7894 |
| 968 | Ga0501048_0026440 | 3300049582 | Bacteria | 4226 |
| 969 | Ga0501048_0056555 | 3300049582 | Bacteria | 2783 |
| 970 | Ga0501048_0218816 | 3300049582 | Unclassified | 1351 |
| 971 | Ga0501048_0581862 | 3300049582 | Unclassified | 804 |
| 972 | Ga0501068_0370664 | 3300049584 | Unclassified | 921 |
| 973 | Ga0501071_0066880 | 3300049587 | Bacteria | 2613 |
| 974 | Ga0501072_0002602 | 3300049588 | Bacteria | 13518 |
| 975 | Ga0501072_0163877 | 3300049588 | Unclassified | 1774 |
| 976 | Ga0501072_0273077 | 3300049588 | Unclassified | 1345 |
| 977 | Ga0501074_0260539 | 3300049590 | Bacteria | 1233 |
| 978 | Ga0501074_0402585 | 3300049590 | Bacteria | 971 |
| 979 | Ga0501075_0008675 | 3300049591 | Bacteria | 7088 |
| 980 | Ga0501075_0018602 | 3300049591 | Bacteria | 5031 |
| 981 | Ga0501075_0023507 | 3300049591 | Bacteria | 4514 |
| 982 | Ga0501075_0046692 | 3300049591 | Unclassified | 3253 |
| 983 | Ga0501075_0528375 | 3300049591 | Unclassified | 900 |
| 984 | Ga0501076_0012213 | 3300049592 | Bacteria | 6421 |
| 985 | Ga0501076_0027129 | 3300049592 | Bacteria | 4443 |
| 986 | Ga0501076_0469397 | 3300049592 | Bacteria | 1036 |
| 987 | Ga0501076_0716569 | 3300049592 | Bacteria | 826 |
| 988 | Ga0501077_0373458 | 3300049593 | Unclassified | 911 |
| 989 | Ga0501249_045470 | 3300049679 | Unclassified | 1002 |
| 990 | Ga0501259_090407 | 3300049688 | Unclassified | 687 |
| 991 | Ga0501225_0151308 | 3300049705 | Unclassified | 708 |
| 992 | Ga0501245_023953 | 3300049708 | Bacteria | 973 |
| 993 | Ga0501079_0002609 | 3300049741 | Bacteria | 13100 |
| 994 | Ga0501079_0023234 | 3300049741 | Bacteria | 4760 |
| 995 | Ga0501079_0529135 | 3300049741 | Unclassified | 927 |
| 996 | Ga0501080_0361286 | 3300049742 | Unclassified | 1310 |
| 997 | Ga0501081_0004156 | 3300049743 | Bacteria | 9284 |
| 998 | Ga0501081_0023628 | 3300049743 | Bacteria | 4122 |
| 999 | Ga0501083_0207966 | 3300049744 | Unclassified | 1276 |
| 1000 | Ga0501283_031482 | 3300049779 | Bacteria | 891 |
| 1001 | Ga0501035_0398121 | 3300049822 | Bacteria | 1146 |
| 1002 | Ga0501044_0721664 | 3300049823 | Unclassified | 881 |
| 1003 | Ga0501045_0013782 | 3300049824 | Bacteria | 5716 |
| 1004 | Ga0501045_0194038 | 3300049824 | Unclassified | 1513 |
| 1005 | nmdc:mga05p37_119123_c1 | 3300050507 | Bacteria | 3243 |
| 1006 | nmdc:mga05p37_15475_c1 | 3300050507 | Bacteria | 9167 |
| 1007 | nmdc:mga05p37_173911_c1 | 3300050507 | Unclassified | 2625 |
| 1008 | nmdc:mga05p37_205927_c1 | 3300050507 | Bacteria | 2380 |
| 1009 | nmdc:mga05p37_240333_c1 | 3300050507 | Unclassified | 2178 |
| 1010 | nmdc:mga05p37_298137_c1 | 3300050507 | Bacteria | 1916 |
| 1011 | nmdc:mga05p37_30049_c1 | 3300050507 | Bacteria | 6631 |
| 1012 | nmdc:mga05p37_552226_c1 | 3300050507 | Bacteria | 1311 |
| 1013 | nmdc:mga05p37_66678_c1 | 3300050507 | Bacteria | 4427 |
| 1014 | nmdc:mga05p37_90180_c1 | 3300050507 | Bacteria | 3778 |
| 1015 | nmdc:mga09592_205827_c1 | 3300050508 | Bacteria | 1704 |
| 1016 | nmdc:mga09592_24906_c1 | 3300050508 | Bacteria | 4949 |
| 1017 | nmdc:mga09592_24955_c1 | 3300050508 | Bacteria | 4945 |
| 1018 | nmdc:mga09592_328846_c1 | 3300050508 | Bacteria | 1324 |
| 1019 | nmdc:mga09592_583282_c1 | 3300050508 | Bacteria | 959 |
| 1020 | nmdc:mga09592_8477_c1 | 3300050508 | Bacteria | 8359 |
| 1021 | nmdc:mga0qj67_144255_c1 | 3300050509 | Bacteria | 1931 |
| 1022 | nmdc:mga0qj67_29343_c1 | 3300050509 | Bacteria | 4273 |
| 1023 | nmdc:mga0qj67_296341_c1 | 3300050509 | Bacteria | 1311 |
| 1024 | nmdc:mga0qj67_368851_c1 | 3300050509 | Bacteria | 1160 |
| 1025 | nmdc:mga0qj67_398362_c1 | 3300050509 | Bacteria | 1111 |
| 1026 | nmdc:mga0qj67_6585_c1 | 3300050509 | Bacteria | 8533 |
| 1027 | nmdc:mga06r32_108831_c1 | 3300050510 | Bacteria | 2725 |
| 1028 | nmdc:mga06r32_351857_c1 | 3300050510 | Bacteria | 1457 |
| 1029 | nmdc:mga06r32_420973_c1 | 3300050510 | Bacteria | 1317 |
| 1030 | nmdc:mga06r32_52364_c1 | 3300050510 | Bacteria | 3909 |
| 1031 | nmdc:mga06r32_58480_c1 | 3300050510 | Bacteria | 3705 |
| 1032 | nmdc:mga06r32_81180_c1 | 3300050510 | Bacteria | 3158 |
| 1033 | nmdc:mga06r32_9055_c1 | 3300050510 | Bacteria | 8971 |
| 1034 | nmdc:mga08y16_1236150_c1 | 3300050511 | Bacteria | 716 |
| 1035 | nmdc:mga08y16_1256019_c1 | 3300050511 | Bacteria | 709 |
| 1036 | nmdc:mga08y16_1481509_c1 | 3300050511 | Bacteria | 640 |
| 1037 | nmdc:mga08y16_23945_c1 | 3300050511 | Bacteria | 6448 |
| 1038 | nmdc:mga08y16_29084_c1 | 3300050511 | Bacteria | 5824 |
| 1039 | nmdc:mga08y16_3223_c1 | 3300050511 | Bacteria | 16894 |
| 1040 | nmdc:mga08y16_39561_c1 | 3300050511 | Bacteria | 4948 |
| 1041 | nmdc:mga08y16_433555_c1 | 3300050511 | Bacteria | 1342 |
| 1042 | nmdc:mga0n895_1181_c1 | 3300050512 | Bacteria | 19181 |
| 1043 | nmdc:mga0n895_131304_c1 | 3300050512 | Unclassified | 2530 |
| 1044 | nmdc:mga0n895_42997_c1 | 3300050512 | Bacteria | 4400 |
| 1045 | nmdc:mga0n895_477858_c1 | 3300050512 | Bacteria | 1257 |
| 1046 | nmdc:mga0n895_5310_c1 | 3300050512 | Bacteria | 10734 |
| 1047 | nmdc:mga0n895_6206_c1 | 3300050512 | Bacteria | 10109 |
| 1048 | nmdc:mga0n895_698289_c1 | 3300050512 | Bacteria | 1011 |
| 1049 | nmdc:mga0n895_81276_c1 | 3300050512 | Unclassified | 3230 |
| 1050 | nmdc:mga0n895_85934_c1 | 3300050512 | Unclassified | 3141 |
| 1051 | nmdc:mga0n895_93_c1 | 3300050512 | Bacteria | 52210 |
| 1052 | nmdc:mga0rr50_1034464_c1 | 3300050513 | Bacteria | 699 |
| 1053 | nmdc:mga0rr50_10_c1 | 3300050513 | Bacteria | 218067 |
| 1054 | nmdc:mga0rr50_1215733_c1 | 3300050513 | Bacteria | 640 |
| 1055 | nmdc:mga0rr50_139526_c1 | 3300050513 | Unclassified | 1949 |
| 1056 | nmdc:mga0rr50_1405144_c1 | 3300050513 | Unclassified | 591 |
| 1057 | nmdc:mga0rr50_259485_c1 | 3300050513 | Bacteria | 1446 |
| 1058 | nmdc:mga0rr50_373555_c1 | 3300050513 | Bacteria | 1202 |
| 1059 | nmdc:mga0rr50_502563_c1 | 3300050513 | Bacteria | 1031 |
| 1060 | nmdc:mga0rr50_67314_c1 | 3300050513 | Bacteria | 1696 |
| 1061 | nmdc:mga0rr50_967005_c1 | 3300050513 | Unclassified | 726 |
| 1062 | nmdc:mga08x19_115055_c1 | 3300050514 | Bacteria | 1798 |
| 1063 | nmdc:mga08x19_122196_c1 | 3300050514 | Bacteria | 1747 |
| 1064 | nmdc:mga08x19_185732_c2 | 3300050514 | Unclassified | 1086 |
| 1065 | nmdc:mga08x19_209_c1 | 3300050514 | Bacteria | 44732 |
| 1066 | nmdc:mga08x19_2161_c1 | 3300050514 | Bacteria | 12011 |
| 1067 | nmdc:mga08x19_323447_c1 | 3300050514 | Unclassified | 1074 |
| 1068 | nmdc:mga08x19_502034_c1 | 3300050514 | Bacteria | 856 |
| 1069 | nmdc:mga08x19_825_c1 | 3300050514 | Bacteria | 19672 |
| 1070 | nmdc:mga0a205_1242_c1 | 3300050515 | Bacteria | 21367 |
| 1071 | nmdc:mga0a205_197592_c1 | 3300050515 | Bacteria | 1902 |
| 1072 | nmdc:mga0a205_198189_c1 | 3300050515 | Bacteria | 653 |
| 1073 | nmdc:mga0a205_27924_c1 | 3300050515 | Bacteria | 5391 |
| 1074 | nmdc:mga0a205_280581_c1 | 3300050515 | Unclassified | 781 |
| 1075 | nmdc:mga0a205_367583_c1 | 3300050515 | Bacteria | 1305 |
| 1076 | nmdc:mga0a205_47171_c1 | 3300050515 | Bacteria | 4156 |
| 1077 | nmdc:mga0a205_627_c1 | 3300050515 | Bacteria | 28069 |
| 1078 | nmdc:mga0a205_636_c1 | 3300050515 | Bacteria | 27881 |
| 1079 | Ga0495601_0018203 | 3300053077 | Unclassified | 4273 |
| 1080 | Ga0495601_0493894 | 3300053077 | Bacteria | 790 |
| 1081 | Ga0495612_0058729 | 3300053078 | Bacteria | 1590 |
| 1082 | Ga0495595_0015200 | 3300053084 | Bacteria | 3280 |
| 1083 | Ga0495595_0135353 | 3300053084 | Bacteria | 1207 |
| 1084 | Ga0495595_0200640 | 3300053084 | Unclassified | 993 |
| 1085 | Ga0495619_0001650 | 3300053085 | Bacteria | 14726 |
| 1086 | Ga0495619_0028076 | 3300053085 | Bacteria | 3628 |
| 1087 | Ga0501084_0022075 | 3300054114 | Bacteria | 5309 |
| 1088 | Ga0501084_0127226 | 3300054114 | Bacteria | 2144 |
| 1089 | Ga0501084_0507715 | 3300054114 | Bacteria | 1019 |
| 1090 | Ga0587088_071909 | 3300059508 | Bacteria | 723 |
| 1091 | Ga0501082_0022918 | 3300060353 | Bacteria | 5381 |
| 1092 | Ga0501082_0032098 | 3300060353 | Bacteria | 4531 |
| 1093 | Ga0501082_0049883 | 3300060353 | Bacteria | 3609 |
| 1094 | Ga0501082_0764221 | 3300060353 | Bacteria | 846 |
| 1095 | Ga0530510_0002558 | 3300061734 | Bacteria | 12502 |
| 1096 | Ga0530510_0214388 | 3300061734 | Bacteria | 1430 |
| 1097 | Ga0070679_100024119 | |||
| 1098 | JGI24749J21850_1038148 | |||
| 1099 | Ga0058862_12487656 | |||
| 1100 | Ga0065714_10176379 | |||
| 1101 | Ga0065712_10008736 | |||
| 1102 | Ga0065712_10028594 | |||
| 1103 | Ga0065712_10067883 | |||
| 1104 | Ga0065715_10104455 | |||
| 1105 | Ga0065715_10235989 | |||
| 1106 | Ga0065715_10340988 | |||
| 1107 | Ga0065715_10487116 | |||
| 1108 | Ga0065715_10649786 | |||
| 1109 | Ga0065707_10085013 | |||
| 1110 | Ga0065707_10312359 | |||
| 1111 | Ga0065707_10359125 | |||
| 1112 | Ga0065707_10405574 | |||
| 1113 | Ga0065707_10812297 | |||
| 1114 | Ga0070658_10107917 | |||
| 1115 | Ga0070658_10124341 | |||
| 1116 | Ga0070658_10180694 | |||
| 1117 | Ga0070676_10200534 | |||
| 1118 | Ga0070683_100000764 | |||
| 1119 | Ga0070683_100001074 | |||
| 1120 | Ga0070683_100263331 | |||
| 1121 | Ga0070690_100032609 | |||
| 1122 | Ga0070690_100032909 | |||
| 1123 | Ga0070670_100000634 | |||
| 1124 | Ga0070670_100254378 | |||
| 1125 | Ga0070670_100593515 | |||
| 1126 | Ga0070677_10031074 | |||
| 1127 | Ga0070677_10281103 | |||
| 1128 | Ga0070677_10606364 | |||
| 1129 | Ga0068869_100007269 | |||
| 1130 | Ga0068869_100831342 | |||
| 1131 | Ga0070666_10004319 | |||
| 1132 | Ga0070666_10105189 | |||
| 1133 | Ga0070666_10181925 | |||
| 1134 | Ga0070680_100025294 | |||
| 1135 | Ga0070680_100039309 | |||
| 1136 | Ga0070680_100060089 | |||
| 1137 | Ga0070680_100071431 | |||
| 1138 | Ga0070680_100112443 | |||
| 1139 | Ga0070680_100115438 | |||
| 1140 | Ga0070680_100500722 | |||
| 1141 | Ga0070680_100563572 | |||
| 1142 | Ga0070680_100599160 | |||
| 1143 | Ga0070682_100176842 | |||
| 1144 | Ga0070682_100221968 | |||
| 1145 | Ga0068868_100060711 | |||
| 1146 | Ga0070660_100017230 | |||
| 1147 | Ga0070660_100720061 | |||
| 1148 | Ga0070689_100085603 | |||
| 1149 | Ga0070689_100674574 | |||
| 1150 | Ga0070691_10024745 | |||
| 1151 | Ga0070691_10058787 | |||
| 1152 | Ga0070691_10442094 | |||
| 1153 | Ga0070687_100236678 | |||
| 1154 | Ga0070687_100346622 | |||
| 1155 | Ga0070687_100347583 | |||
| 1156 | Ga0070661_100008643 | |||
| 1157 | Ga0070661_100013274 | |||
| 1158 | Ga0070661_100061807 | |||
| 1159 | Ga0070661_100086991 | |||
| 1160 | Ga0070661_100343835 | |||
| 1161 | Ga0070661_100850582 | |||
| 1162 | Ga0070661_101112262 | |||
| 1163 | Ga0070692_10169154 | |||
| 1164 | Ga0070668_100030893 | |||
| 1165 | Ga0070668_100076947 | |||
| 1166 | Ga0070668_100433767 | |||
| 1167 | Ga0070668_101210325 | |||
| 1168 | Ga0070668_101326221 | |||
| 1169 | Ga0070669_100038469 | |||
| 1170 | Ga0070669_100181590 | |||
| 1171 | Ga0070669_100219522 | |||
| 1172 | Ga0070669_101050532 | |||
| 1173 | Ga0070675_100008647 | |||
| 1174 | Ga0070675_100009676 | |||
| 1175 | Ga0070675_100009716 | |||
| 1176 | Ga0070675_100065891 | |||
| 1177 | Ga0070675_100082773 | |||
| 1178 | Ga0070675_100088027 | |||
| 1179 | Ga0070675_100773314 | |||
| 1180 | Ga0070671_100552582 | |||
| 1181 | Ga0070671_100921924 | |||
| 1182 | Ga0070674_100000664 | |||
| 1183 | Ga0070674_100065114 | |||
| 1184 | Ga0070674_100149122 | |||
| 1185 | Ga0070674_100386909 | |||
| 1186 | Ga0070674_100451414 | |||
| 1187 | Ga0070673_100052234 | |||
| 1188 | Ga0070673_100204206 | |||
| 1189 | Ga0070673_100218639 | |||
| 1190 | Ga0070673_100222531 | |||
| 1191 | Ga0070688_100040267 | |||
| 1192 | Ga0070688_100388544 | |||
| 1193 | Ga0070688_100546849 | |||
| 1194 | Ga0070659_100070695 | |||
| 1195 | Ga0070659_100458522 | |||
| 1196 | Ga0070659_101245674 | |||
| 1197 | Ga0070667_100229132 | |||
| 1198 | Ga0070709_10021097 | |||
| 1199 | Ga0070709_10035734 | |||
| 1200 | Ga0070709_10180433 | |||
| 1201 | Ga0070709_10200696 | |||
| 1202 | Ga0070714_100007464 | |||
| 1203 | Ga0070714_100491330 | |||
| 1204 | Ga0070714_100571204 | |||
| 1205 | Ga0070714_100859851 | |||
| 1206 | Ga0070713_100049913 | |||
| 1207 | Ga0070713_100205246 | |||
| 1208 | Ga0070710_10221506 | |||
| 1209 | Ga0070711_100000009 | |||
| 1210 | Ga0070711_100042571 | |||
| 1211 | Ga0070705_100546158 | |||
| 1212 | Ga0070700_100034745 | |||
| 1213 | Ga0070700_100052768 | |||
| 1214 | Ga0070700_100258641 | |||
| 1215 | Ga0070694_100003241 | |||
| 1216 | Ga0070694_100067431 | |||
| 1217 | Ga0070694_100129931 | |||
| 1218 | Ga0070694_100218984 | |||
| 1219 | Ga0070708_100038507 | |||
| 1220 | Ga0070708_100074725 | |||
| 1221 | Ga0070708_100209998 | |||
| 1222 | Ga0070708_100449655 | |||
| 1223 | Ga0070708_100665187 | |||
| 1224 | Ga0070708_100928361 | |||
| 1225 | Ga0070663_100070771 | |||
| 1226 | Ga0070663_100076568 | |||
| 1227 | Ga0070678_100079118 | |||
| 1228 | Ga0070678_100313600 | |||
| 1229 | Ga0070678_101372611 | |||
| 1230 | Ga0070662_100079683 | |||
| 1231 | Ga0070662_100233188 | |||
| 1232 | Ga0070662_100599159 | |||
| 1233 | Ga0070681_10008231 | |||
| 1234 | Ga0070681_10040036 | |||
| 1235 | Ga0070681_10052833 | |||
| 1236 | Ga0070681_10158613 | |||
| 1237 | Ga0070681_10170587 | |||
| 1238 | Ga0068867_100237661 | |||
| 1239 | Ga0068867_100246127 | |||
| 1240 | Ga0070685_10276492 | |||
| 1241 | Ga0070706_100033685 | |||
| 1242 | Ga0070706_100132617 | |||
| 1243 | Ga0070706_100174635 | |||
| 1244 | Ga0070706_100291623 | |||
| 1245 | Ga0070706_100652794 | |||
| 1246 | Ga0070706_101002993 | |||
| 1247 | Ga0070706_101347236 | |||
| 1248 | Ga0070707_100010894 | |||
| 1249 | Ga0070707_100051229 | |||
| 1250 | Ga0070707_100070873 | |||
| 1251 | Ga0070707_100111704 | |||
| 1252 | Ga0070707_100165017 | |||
| 1253 | Ga0070707_100182062 | |||
| 1254 | Ga0070707_100359616 | |||
| 1255 | Ga0070707_100448139 | |||
| 1256 | Ga0070698_100000520 | |||
| 1257 | Ga0070698_100187329 | |||
| 1258 | Ga0070698_100210750 | |||
| 1259 | Ga0070698_100380074 | |||
| 1260 | Ga0070699_100017273 | |||
| 1261 | Ga0070699_100042946 | |||
| 1262 | Ga0070699_100073476 | |||
| 1263 | Ga0070699_100153696 | |||
| 1264 | Ga0070699_100690994 | |||
| 1265 | Ga0070679_100003010 | |||
| 1266 | Ga0070679_100028164 | |||
| 1267 | Ga0070679_100097515 | |||
| 1268 | Ga0070679_100158529 | |||
| 1269 | Ga0070679_100270419 | |||
| 1270 | Ga0070684_100013369 | |||
| 1271 | Ga0070684_100014739 | |||
| 1272 | Ga0070684_100491750 | |||
| 1273 | Ga0070684_100749212 | |||
| 1274 | Ga0070697_100012147 | |||
| 1275 | Ga0070697_100045601 | |||
| 1276 | Ga0070697_100139862 | |||
| 1277 | Ga0070697_100320116 | |||
| 1278 | Ga0070697_100503082 | |||
| 1279 | Ga0068853_100010200 | |||
| 1280 | Ga0068853_100218533 | |||
| 1281 | Ga0070672_100024320 | |||
| 1282 | Ga0070672_100035566 | |||
| 1283 | Ga0070672_100103360 | |||
| 1284 | Ga0070686_100327783 | |||
| 1285 | Ga0070686_100779235 | |||
| 1286 | Ga0070695_100015845 | |||
| 1287 | Ga0070695_100121367 | |||
| 1288 | Ga0070695_100139183 | |||
| 1289 | Ga0070695_100255072 | |||
| 1290 | Ga0070695_100581348 | |||
| 1291 | Ga0070695_101145661 | |||
| 1292 | Ga0070695_101160648 | |||
| 1293 | Ga0070696_100004527 | |||
| 1294 | Ga0070696_100135631 | |||
| 1295 | Ga0070696_100159852 | |||
| 1296 | Ga0070696_100807529 | |||
| 1297 | Ga0070665_100114423 | |||
| 1298 | Ga0070665_101502237 | |||
| 1299 | Ga0070704_100017784 | |||
| 1300 | Ga0070704_100050914 | |||
| 1301 | Ga0070704_100126865 | |||
| 1302 | Ga0070704_100138806 | |||
| 1303 | Ga0068855_100023199 | |||
| 1304 | Ga0068855_100055920 | |||
| 1305 | Ga0068855_100126070 | |||
| 1306 | Ga0070664_100006595 | |||
| 1307 | Ga0070664_100945763 | |||
| 1308 | Ga0068857_100038917 | |||
| 1309 | Ga0068854_100002695 | |||
| 1310 | Ga0068854_100042820 | |||
| 1311 | Ga0068854_100062714 | |||
| 1312 | Ga0068854_100088656 | |||
| 1313 | Ga0068854_100170635 | |||
| 1314 | Ga0068856_100017819 | |||
| 1315 | Ga0068856_100662926 | |||
| 1316 | Ga0068852_100096763 | |||
| 1317 | Ga0068852_100109622 | |||
| 1318 | Ga0068852_100236884 | |||
| 1319 | Ga0068852_101025365 | |||
| 1320 | Ga0068859_100098561 | |||
| 1321 | Ga0068859_100128099 | |||
| 1322 | Ga0068859_100240252 | |||
| 1323 | Ga0068859_100458432 | |||
| 1324 | Ga0068859_100494967 | |||
| 1325 | Ga0068859_100897864 | |||
| 1326 | Ga0068859_101779012 | |||
| 1327 | Ga0068864_100187237 | |||
| 1328 | Ga0068861_100080171 | |||
| 1329 | Ga0068861_100280907 | |||
| 1330 | Ga0068861_100507024 | |||
| 1331 | Ga0068861_101379743 | |||
| 1332 | Ga0068870_10012779 | |||
| 1333 | Ga0068870_10048732 | |||
| 1334 | Ga0068870_10068362 | |||
| 1335 | Ga0068863_100320392 | |||
| 1336 | Ga0068863_100432665 | |||
| 1337 | Ga0068858_100004093 | |||
| 1338 | Ga0068858_100078401 | |||
| 1339 | Ga0068860_100094908 | |||
| 1340 | Ga0068860_100115161 | |||
| 1341 | Ga0068860_100169778 | |||
| 1342 | Ga0068860_100173033 | |||
| 1343 | Ga0068860_100255187 | |||
| 1344 | Ga0068860_101616552 | |||
| 1345 | Ga0068860_102056788 | |||
| 1346 | Ga0068862_100008267 | |||
| 1347 | Ga0068862_100311465 | |||
| 1348 | Ga0068862_101089178 | |||
| 1349 | Ga0068862_101121021 | |||
| 1350 | Ga0070717_10047786 | |||
| 1351 | Ga0070717_10500905 | |||
| 1352 | Ga0070717_10684875 | |||
| 1353 | Ga0070715_10100109 | |||
| 1354 | Ga0070715_10194680 | |||
| 1355 | Ga0070716_100428650 | |||
| 1356 | Ga0070716_100491908 | |||
| 1357 | Ga0070712_100142516 | |||
| 1358 | Ga0075427_10044017 | |||
| 1359 | Ga0097621_100001945 | |||
| 1360 | Ga0097621_100013956 | |||
| 1361 | Ga0097621_100774278 | |||
| 1362 | Ga0068871_100017288 | |||
| 1363 | Ga0068871_100033020 | |||
| 1364 | Ga0068871_100374542 | |||
| 1365 | Ga0068871_100471878 | |||
| 1366 | Ga0075428_100002503 | |||
| 1367 | Ga0075428_100006937 | |||
| 1368 | Ga0075428_100007581 | |||
| 1369 | Ga0075428_100979434 | |||
| 1370 | Ga0075430_100004830 | |||
| 1371 | Ga0075430_100014265 | |||
| 1372 | Ga0075430_100040064 | |||
| 1373 | Ga0075430_100417201 | |||
| 1374 | Ga0075430_100713787 | |||
| 1375 | Ga0075431_100003195 | |||
| 1376 | Ga0075431_100016527 | |||
| 1377 | Ga0075431_100060470 | |||
| 1378 | Ga0075431_100060948 | |||
| 1379 | Ga0075431_100094343 | |||
| 1380 | Ga0075431_100107669 | |||
| 1381 | Ga0075431_100369023 | |||
| 1382 | Ga0075431_100633071 | |||
| 1383 | Ga0075431_100799488 | |||
| 1384 | Ga0075433_10001610 | |||
| 1385 | Ga0075433_10002219 | |||
| 1386 | Ga0075433_10003429 | |||
| 1387 | Ga0075433_10035571 | |||
| 1388 | Ga0075433_10117969 | |||
| 1389 | Ga0075433_10201869 | |||
| 1390 | Ga0075434_100001499 | |||
| 1391 | Ga0075434_100006838 | |||
| 1392 | Ga0075434_100007930 | |||
| 1393 | Ga0075434_100008914 | |||
| 1394 | Ga0075434_100017151 | |||
| 1395 | Ga0075434_100030949 | |||
| 1396 | Ga0075434_100047107 | |||
| 1397 | Ga0075434_100107482 | |||
| 1398 | Ga0075434_100311843 | |||
| 1399 | Ga0075429_100007718 | |||
| 1400 | Ga0075429_100029861 | |||
| 1401 | Ga0075429_100125889 | |||
| 1402 | Ga0075429_100211336 | |||
| 1403 | Ga0075429_101550837 | |||
| 1404 | Ga0068865_100031879 | |||
| 1405 | Ga0068865_100113921 | |||
| 1406 | Ga0068865_100790636 | |||
| 1407 | Ga0075436_100000356 | |||
| 1408 | Ga0075436_100002771 | |||
| 1409 | Ga0075436_100013469 | |||
| 1410 | Ga0075436_100043206 | |||
| 1411 | Ga0075436_100291632 | |||
| 1412 | Ga0075436_100330344 | |||
| 1413 | Ga0097620_100061162 | |||
| 1414 | Ga0097620_100098557 | |||
| 1415 | Ga0097620_100128090 | |||
| 1416 | Ga0097620_100240260 | |||
| 1417 | Ga0097620_100458464 | |||
| 1418 | Ga0097620_100494983 | |||
| 1419 | Ga0097620_100897720 | |||
| 1420 | Ga0097620_101779132 | |||
| 1421 | Ga0075435_100000113 | |||
| 1422 | Ga0075435_100015603 | |||
| 1423 | Ga0075435_100040694 | |||
| 1424 | Ga0075435_100044468 | |||
| 1425 | Ga0075435_100079863 | |||
| 1426 | Ga0075435_100095994 | |||
| 1427 | Ga0075435_100232734 | |||
| 1428 | Ga0075435_100394593 | |||
| 1429 | Ga0075435_100825227 | |||
| 1430 | Ga0075435_101062891 | |||
| 1431 | Ga0099794_10056124 | |||
| 1432 | Ga0105240_10003253 | |||
| 1433 | Ga0105240_10156515 | |||
| 1434 | Ga0105240_10205058 | |||
| 1435 | Ga0105240_10296203 | |||
| 1436 | Ga0105240_10382438 | |||
| 1437 | Ga0111539_10001040 | |||
| 1438 | Ga0111539_10001816 | |||
| 1439 | Ga0111539_10002183 | |||
| 1440 | Ga0111539_10039477 | |||
| 1441 | Ga0111539_10146430 | |||
| 1442 | Ga0111539_10490696 | |||
| 1443 | Ga0111539_10786990 | |||
| 1444 | Ga0111539_10918447 | |||
| 1445 | Ga0105245_10058586 | |||
| 1446 | Ga0105245_10193877 | |||
| 1447 | Ga0105245_10239414 | |||
| 1448 | Ga0105247_10016077 | |||
| 1449 | Ga0105247_10454314 | |||
| 1450 | Ga0114129_10002003 | |||
| 1451 | Ga0114129_10002364 | |||
| 1452 | Ga0114129_10009760 | |||
| 1453 | Ga0114129_10044085 | |||
| 1454 | Ga0114129_10065576 | |||
| 1455 | Ga0114129_10114936 | |||
| 1456 | Ga0114129_10128300 | |||
| 1457 | Ga0114129_10133933 | |||
| 1458 | Ga0114129_10389377 | |||
| 1459 | Ga0114129_10561999 | |||
| 1460 | Ga0114129_10564287 | |||
| 1461 | Ga0114129_10872830 | |||
| 1462 | Ga0114129_11450487 | |||
| 1463 | Ga0114129_12041945 | |||
| 1464 | Ga0105243_10010615 | |||
| 1465 | Ga0105243_11036677 | |||
| 1466 | Ga0105241_10037656 | |||
| 1467 | Ga0105241_10548354 | |||
| 1468 | Ga0105241_10827330 | |||
| 1469 | Ga0105242_10056291 | |||
| 1470 | Ga0105242_10068023 | |||
| 1471 | Ga0105242_10410497 | |||
| 1472 | Ga0105242_10440060 | |||
| 1473 | Ga0105242_11177242 | |||
| 1474 | Ga0105242_11926436 | |||
| 1475 | Ga0105248_10047176 | |||
| 1476 | Ga0105248_10138848 | |||
| 1477 | Ga0105248_10582010 | |||
| 1478 | Ga0105248_10691240 | |||
| 1479 | Ga0105248_11505434 | |||
| 1480 | Ga0105248_11943966 | |||
| 1481 | Ga0105238_10002348 | |||
| 1482 | Ga0105238_10285520 | |||
| 1483 | Ga0105238_10536054 | |||
| 1484 | Ga0105238_12294211 | |||
| 1485 | Ga0105249_10000009 | |||
| 1486 | Ga0105249_10425041 | |||
| 1487 | Ga0105249_11302912 | |||
| 1488 | Ga0105249_11333149 | |||
| 1489 | Ga0105249_11550759 | |||
| 1490 | Ga0105249_12223141 | |||
| 1491 | Ga0105239_10520827 | |||
| 1492 | Ga0105246_10766853 | |||
| 1493 | Ga0105246_10977784 | |||
| 1494 | Ga0157373_10001979 | |||
| 1495 | Ga0157373_10077430 | |||
| 1496 | Ga0157373_10406617 | |||
| 1497 | Ga0157370_10005166 | |||
| 1498 | Ga0157370_10025263 | |||
| 1499 | Ga0157370_10026940 | |||
| 1500 | Ga0157370_10083270 | |||
| 1501 | Ga0157370_10633844 | |||
| 1502 | Ga0157369_10033518 | |||
| 1503 | Ga0157369_10077478 | |||
| 1504 | Ga0157369_10095847 | |||
| 1505 | Ga0157369_10366865 | |||
| 1506 | Ga0157378_10112678 | |||
| 1507 | Ga0157378_10453520 | |||
| 1508 | Ga0157378_10934611 | |||
| 1509 | Ga0163162_10087734 | |||
| 1510 | Ga0157372_10003100 | |||
| 1511 | Ga0157372_10025597 | |||
| 1512 | Ga0157372_10112196 | |||
| 1513 | Ga0157372_10205499 | |||
| 1514 | Ga0157372_10324786 | |||
| 1515 | Ga0157372_10762270 | |||
| 1516 | Ga0157372_10939269 | |||
| 1517 | Ga0157375_10154373 | |||
| 1518 | Ga0157375_10261427 | |||
| 1519 | Ga0157375_10609711 | |||
| 1520 | Ga0163163_10031924 | |||
| 1521 | Ga0163163_10055432 | |||
| 1522 | Ga0157380_10001150 | |||
| 1523 | Ga0157380_10076789 | |||
| 1524 | Ga0157380_10174919 | |||
| 1525 | Ga0182008_10003880 | |||
| 1526 | Ga0157377_10054391 | |||
| 1527 | Ga0157377_10072114 | |||
| 1528 | Ga0157377_10424550 | |||
| 1529 | Ga0157379_10157725 | |||
| 1530 | Ga0157379_10682317 | |||
| 1531 | Ga0157376_10011478 | |||
| 1532 | Ga0157376_10084412 | |||
| 1533 | Ga0157376_10106129 | |||
| 1534 | Ga0157376_10525531 | |||
| 1535 | Ga0163161_10681015 | |||
| 1536 | Ga0224712_10043063 | |||
| 1537 | Ga0207653_10000673 | |||
| 1538 | Ga0207653_10100922 | |||
| 1539 | Ga0207653_10156470 | |||
| 1540 | Ga0207653_10165287 | |||
| 1541 | Ga0207682_10006741 | |||
| 1542 | Ga0207682_10030235 | |||
| 1543 | Ga0207682_10032639 | |||
| 1544 | Ga0207682_10097977 | |||
| 1545 | Ga0207682_10111105 | |||
| 1546 | Ga0207682_10432131 | |||
| 1547 | Ga0207642_10090879 | |||
| 1548 | Ga0207642_10346988 | |||
| 1549 | Ga0207710_10072773 | |||
| 1550 | Ga0207710_10232586 | |||
| 1551 | Ga0207688_10220066 | |||
| 1552 | Ga0207688_10257494 | |||
| 1553 | Ga0207680_10001175 | |||
| 1554 | Ga0207680_10168416 | |||
| 1555 | Ga0207680_10380976 | |||
| 1556 | Ga0207685_10006550 | |||
| 1557 | Ga0207699_10023696 | |||
| 1558 | Ga0207699_10087663 | |||
| 1559 | Ga0207645_10019939 | |||
| 1560 | Ga0207645_10540499 | |||
| 1561 | Ga0207643_10049906 | |||
| 1562 | Ga0207643_10064802 | |||
| 1563 | Ga0207643_10067765 | |||
| 1564 | Ga0207643_10077741 | |||
| 1565 | Ga0207643_10149078 | |||
| 1566 | Ga0207705_10095851 | |||
| 1567 | Ga0207705_11087022 | |||
| 1568 | Ga0207684_10024881 | |||
| 1569 | Ga0207684_10062308 | |||
| 1570 | Ga0207684_10121077 | |||
| 1571 | Ga0207684_10142591 | |||
| 1572 | Ga0207654_10134561 | |||
| 1573 | Ga0207654_10270625 | |||
| 1574 | Ga0207654_10353099 | |||
| 1575 | Ga0207654_10503788 | |||
| 1576 | Ga0207707_10002830 | |||
| 1577 | Ga0207707_10007025 | |||
| 1578 | Ga0207707_10007538 | |||
| 1579 | Ga0207707_10013449 | |||
| 1580 | Ga0207707_10021885 | |||
| 1581 | Ga0207707_10032395 | |||
| 1582 | Ga0207707_10088716 | |||
| 1583 | Ga0207695_10021370 | |||
| 1584 | Ga0207695_10056919 | |||
| 1585 | Ga0207695_10098767 | |||
| 1586 | Ga0207695_10268700 | |||
| 1587 | Ga0207695_10570005 | |||
| 1588 | Ga0207663_10000013 | |||
| 1589 | Ga0207663_10080312 | |||
| 1590 | Ga0207663_11273394 | |||
| 1591 | Ga0207660_10003505 | |||
| 1592 | Ga0207660_10010245 | |||
| 1593 | Ga0207660_10056159 | |||
| 1594 | Ga0207660_10067901 | |||
| 1595 | Ga0207660_10093066 | |||
| 1596 | Ga0207660_10221046 | |||
| 1597 | Ga0207662_10314488 | |||
| 1598 | Ga0207662_10467829 | |||
| 1599 | Ga0207657_10020792 | |||
| 1600 | Ga0207657_10192945 | |||
| 1601 | Ga0207649_10012805 | |||
| 1602 | Ga0207649_10206394 | |||
| 1603 | Ga0207649_10323897 | |||
| 1604 | Ga0207649_11302334 | |||
| 1605 | Ga0207652_10005795 | |||
| 1606 | Ga0207652_10009315 | |||
| 1607 | Ga0207652_10014537 | |||
| 1608 | Ga0207652_10021992 | |||
| 1609 | Ga0207652_10022261 | |||
| 1610 | Ga0207652_10263694 | |||
| 1611 | Ga0207646_10016789 | |||
| 1612 | Ga0207646_10043666 | |||
| 1613 | Ga0207646_10058473 | |||
| 1614 | Ga0207646_10076093 | |||
| 1615 | Ga0207646_10637444 | |||
| 1616 | Ga0207646_10946639 | |||
| 1617 | Ga0207646_11099901 | |||
| 1618 | Ga0207681_10046539 | |||
| 1619 | Ga0207681_10050799 | |||
| 1620 | Ga0207681_10063307 | |||
| 1621 | Ga0207681_11248536 | |||
| 1622 | Ga0207694_10002177 | |||
| 1623 | Ga0207694_10025230 | |||
| 1624 | Ga0207694_10950141 | |||
| 1625 | Ga0207650_10007194 | |||
| 1626 | Ga0207650_10009678 | |||
| 1627 | Ga0207650_10570392 | |||
| 1628 | Ga0207659_10001467 | |||
| 1629 | Ga0207659_10006964 | |||
| 1630 | Ga0207659_10022504 | |||
| 1631 | Ga0207659_10035440 | |||
| 1632 | Ga0207659_10048830 | |||
| 1633 | Ga0207659_10106881 | |||
| 1634 | Ga0207659_10422999 | |||
| 1635 | Ga0207659_10793903 | |||
| 1636 | Ga0207659_10867018 | |||
| 1637 | Ga0207687_10069169 | |||
| 1638 | Ga0207687_10395740 | |||
| 1639 | Ga0207700_10032936 | |||
| 1640 | Ga0207700_10323861 | |||
| 1641 | Ga0207664_10625874 | |||
| 1642 | Ga0207664_11308958 | |||
| 1643 | Ga0207644_10071660 | |||
| 1644 | Ga0207644_11242437 | |||
| 1645 | Ga0207690_10070974 | |||
| 1646 | Ga0207706_10080228 | |||
| 1647 | Ga0207706_10290195 | |||
| 1648 | Ga0207706_10542795 | |||
| 1649 | Ga0207686_10036639 | |||
| 1650 | Ga0207686_10100650 | |||
| 1651 | Ga0207686_10294769 | |||
| 1652 | Ga0207686_10910024 | |||
| 1653 | Ga0207686_11458017 | |||
| 1654 | Ga0207709_10020091 | |||
| 1655 | Ga0207709_11132387 | |||
| 1656 | Ga0207670_10021987 | |||
| 1657 | Ga0207670_10423268 | |||
| 1658 | Ga0207670_10695398 | |||
| 1659 | Ga0207669_10019056 | |||
| 1660 | Ga0207669_10151286 | |||
| 1661 | Ga0207669_10277566 | |||
| 1662 | Ga0207669_10288038 | |||
| 1663 | Ga0207704_10124302 | |||
| 1664 | Ga0207704_10365956 | |||
| 1665 | Ga0207704_10436336 | |||
| 1666 | Ga0207665_10038396 | |||
| 1667 | Ga0207665_10471380 | |||
| 1668 | Ga0207665_10616366 | |||
| 1669 | Ga0207691_10007331 | |||
| 1670 | Ga0207691_10041190 | |||
| 1671 | Ga0207691_10071130 | |||
| 1672 | Ga0207691_10153365 | |||
| 1673 | Ga0207711_10103535 | |||
| 1674 | Ga0207689_10009577 | |||
| 1675 | Ga0207689_10014114 | |||
| 1676 | Ga0207689_10105281 | |||
| 1677 | Ga0207689_10201671 | |||
| 1678 | Ga0207689_10210998 | |||
| 1679 | Ga0207689_10512921 | |||
| 1680 | Ga0207661_10009843 | |||
| 1681 | Ga0207661_10153781 | |||
| 1682 | Ga0207661_11488821 | |||
| 1683 | Ga0207679_10005731 | |||
| 1684 | Ga0207679_10021948 | |||
| 1685 | Ga0207679_10023338 | |||
| 1686 | Ga0207679_10214703 | |||
| 1687 | Ga0207679_10247528 | |||
| 1688 | Ga0207679_10261240 | |||
| 1689 | Ga0207679_11057306 | |||
| 1690 | Ga0207667_10129191 | |||
| 1691 | Ga0207667_10199440 | |||
| 1692 | Ga0207667_10276822 | |||
| 1693 | Ga0207667_11627545 | |||
| 1694 | Ga0207651_10069913 | |||
| 1695 | Ga0207651_10309015 | |||
| 1696 | Ga0207651_10540898 | |||
| 1697 | Ga0207712_10000080 | |||
| 1698 | Ga0207712_10483688 | |||
| 1699 | Ga0207712_10634788 | |||
| 1700 | Ga0207712_11097374 | |||
| 1701 | Ga0207712_11803443 | |||
| 1702 | Ga0207668_10000945 | |||
| 1703 | Ga0207668_10051906 | |||
| 1704 | Ga0207668_10920680 | |||
| 1705 | Ga0207640_10006646 | |||
| 1706 | Ga0207640_10009883 | |||
| 1707 | Ga0207640_10014824 | |||
| 1708 | Ga0207640_10129659 | |||
| 1709 | Ga0207658_10324987 | |||
| 1710 | Ga0207658_11108654 | |||
| 1711 | Ga0207677_10129935 | |||
| 1712 | Ga0207703_10027965 | |||
| 1713 | Ga0207703_10145042 | |||
| 1714 | Ga0207703_10457435 | |||
| 1715 | Ga0207639_10011420 | |||
| 1716 | Ga0207678_10068626 | |||
| 1717 | Ga0207678_10069971 | |||
| 1718 | Ga0207678_10452100 | |||
| 1719 | Ga0207708_10047164 | |||
| 1720 | Ga0207708_10066583 | |||
| 1721 | Ga0207708_10079001 | |||
| 1722 | Ga0207708_10138002 | |||
| 1723 | Ga0207708_10184107 | |||
| 1724 | Ga0207708_10727579 | |||
| 1725 | Ga0207702_10158068 | |||
| 1726 | Ga0207702_10341188 | |||
| 1727 | Ga0207641_10339745 | |||
| 1728 | Ga0207648_10004141 | |||
| 1729 | Ga0207648_10105931 | |||
| 1730 | Ga0207648_10420506 | |||
| 1731 | Ga0207648_10592881 | |||
| 1732 | Ga0207676_10002798 | |||
| 1733 | Ga0207676_10082041 | |||
| 1734 | Ga0207676_10320891 | |||
| 1735 | Ga0207676_10612805 | |||
| 1736 | Ga0207674_10079729 | |||
| 1737 | Ga0207674_11470889 | |||
| 1738 | Ga0207674_11527030 | |||
| 1739 | Ga0207675_100105136 | |||
| 1740 | Ga0207675_100140924 | |||
| 1741 | Ga0207675_100190766 | |||
| 1742 | Ga0207675_100193580 | |||
| 1743 | Ga0207675_100325863 | |||
| 1744 | Ga0207675_100432440 | |||
| 1745 | Ga0207675_100485347 | |||
| 1746 | Ga0207683_10349013 | |||
| 1747 | Ga0207683_10354994 | |||
| 1748 | Ga0207683_10751744 | |||
| 1749 | Ga0207698_10012351 | |||
| 1750 | Ga0207698_10186175 | |||
| 1751 | Ga0207698_10438187 | |||
| 1752 | Ga0207698_10601847 | |||
| 1753 | Ga0210002_1040301 | |||
| 1754 | Ga0209588_1026634 | |||
| 1755 | Ga0209971_1019408 | |||
| 1756 | Ga0209974_10116270 | |||
| 1757 | Ga0207428_10000145 | |||
| 1758 | Ga0207428_10000692 | |||
| 1759 | Ga0207428_10012689 | |||
| 1760 | Ga0207428_10022308 | |||
| 1761 | Ga0268266_10058863 | |||
| 1762 | Ga0268266_11010878 | |||
| 1763 | Ga0268266_11428627 | |||
| 1764 | Ga0268265_10031263 | |||
| 1765 | Ga0268265_10172604 | |||
| 1766 | Ga0268265_10212169 | |||
| 1767 | Ga0268265_11763364 | |||
| 1768 | Ga0268264_10038372 | |||
| 1769 | Ga0268264_10109961 | |||
| 1770 | Ga0268264_10204946 | |||
| 1771 | Ga0268264_10362474 | |||
| 1772 | Ga0268264_10669658 | |||
| 1773 | Ga0268264_11511854 | |||
| 1774 | Ga0307408_100120771 | |||
| 1775 | Ga0307408_100147946 | |||
| 1776 | Ga0307408_100271444 | |||
| 1777 | Ga0307408_100374397 | |||
| 1778 | Ga0307408_100505207 | |||
| 1779 | Ga0307405_10013579 | |||
| 1780 | Ga0307405_10022153 | |||
| 1781 | Ga0307405_10055004 | |||
| 1782 | Ga0307405_10168006 | |||
| 1783 | Ga0307405_11122896 | |||
| 1784 | Ga0307413_10001185 | |||
| 1785 | Ga0307413_10004760 | |||
| 1786 | Ga0307413_10026259 | |||
| 1787 | Ga0307413_10071242 | |||
| 1788 | Ga0307413_10079897 | |||
| 1789 | Ga0307413_10081647 | |||
| 1790 | Ga0307413_10807980 | |||
| 1791 | Ga0307413_11455570 | |||
| 1792 | Ga0307410_10002120 | |||
| 1793 | Ga0307410_10090223 | |||
| 1794 | Ga0307410_10179115 | |||
| 1795 | Ga0307410_10197032 | |||
| 1796 | Ga0307410_10221700 | |||
| 1797 | Ga0307410_10263685 | |||
| 1798 | Ga0307410_10320471 | |||
| 1799 | Ga0307410_10512625 | |||
| 1800 | Ga0307410_10563839 | |||
| 1801 | Ga0307406_10011159 | |||
| 1802 | Ga0307406_10015520 | |||
| 1803 | Ga0307406_10016675 | |||
| 1804 | Ga0307406_10121951 | |||
| 1805 | Ga0307406_10292469 | |||
| 1806 | Ga0307406_10526177 | |||
| 1807 | Ga0307406_11095203 | |||
| 1808 | Ga0307407_10000365 | |||
| 1809 | Ga0307407_10001077 | |||
| 1810 | Ga0307407_10014326 | |||
| 1811 | Ga0307407_10020187 | |||
| 1812 | Ga0307407_10035113 | |||
| 1813 | Ga0307407_10074815 | |||
| 1814 | Ga0307407_10129409 | |||
| 1815 | Ga0307407_10693013 | |||
| 1816 | Ga0307412_10018673 | |||
| 1817 | Ga0307412_10020364 | |||
| 1818 | Ga0307412_10026436 | |||
| 1819 | Ga0307412_10193373 | |||
| 1820 | Ga0307412_10262531 | |||
| 1821 | Ga0307409_100041085 | |||
| 1822 | Ga0307409_100054525 | |||
| 1823 | Ga0307409_100219625 | |||
| 1824 | Ga0307409_100474349 | |||
| 1825 | Ga0307409_100600829 | |||
| 1826 | Ga0307409_100683918 | |||
| 1827 | Ga0307409_100757429 | |||
| 1828 | Ga0307416_100002522 | |||
| 1829 | Ga0307416_100029905 | |||
| 1830 | Ga0307416_100041259 | |||
| 1831 | Ga0307416_100104241 | |||
| 1832 | Ga0307416_100154740 | |||
| 1833 | Ga0307416_100232016 | |||
| 1834 | Ga0307416_100389814 | |||
| 1835 | Ga0307416_100458935 | |||
| 1836 | Ga0307416_100751074 | |||
| 1837 | Ga0307414_10030341 | |||
| 1838 | Ga0307414_10114859 | |||
| 1839 | Ga0307414_10157526 | |||
| 1840 | Ga0307414_10216344 | |||
| 1841 | Ga0307414_10294651 | |||
| 1842 | Ga0307414_10333627 | |||
| 1843 | Ga0307414_10377849 | |||
| 1844 | Ga0307414_11449064 | |||
| 1845 | Ga0307411_10000550 | |||
| 1846 | Ga0307411_10006618 | |||
| 1847 | Ga0307411_10015046 | |||
| 1848 | Ga0307411_10016003 | |||
| 1849 | Ga0307411_10051760 | |||
| 1850 | Ga0307411_10101967 | |||
| 1851 | Ga0307411_10954433 | |||
| 1852 | Ga0307415_100011767 | |||
| 1853 | Ga0307415_100021693 | |||
| 1854 | Ga0307415_100047267 | |||
| 1855 | Ga0307415_100072953 | |||
| 1856 | Ga0307415_100075212 | |||
| 1857 | Ga0307415_100140040 | |||
| 1858 | Ga0307415_100154435 | |||
| 1859 | Ga0307415_100258973 | |||
| 1860 | Ga0307415_100622730 | |||
| 1861 | Ga0307415_101063413 | |||
| 1862 | Ga0373930_0001310 | |||
| 1863 | Ga0373959_0008146 | |||
| 1864 | Ga0373938_0000261 | |||
| 1865 | Ga0373928_0015902 | |||
| 1866 | Ga0373929_0002196 | |||
| 1867 | Ga0373934_0081709 | |||
| 1868 | Ga0373951_0001055 | |||
| 1869 | Ga0373923_0059176 | |||
| 1870 | Ga0373932_0000295 | |||
| 1871 | Ga0373936_0006646 | |||
| 1872 | Ga0373936_0336548 | |||
| 1873 | Ga0373941_0174088 | |||
| 1874 | Ga0373945_0068053 | |||
| 1875 | Ga0373956_0409280 | |||
| 1876 | Ga0373957_0110651 | |||
| 1877 | Ga0373960_0000409 | |||
| 1878 | Ga0373943_0105195 | |||
| 1879 | Ga0373955_0064428 | |||
| 1880 | Ga0373955_0090254 | |||
| 1881 | Ga0373955_0200184 | |||
| 1882 | Ga0373942_0020624 | |||
| 1883 | Ga0373961_0016250 | |||
| 1884 | Ga0373924_0003321 | |||
| 1885 | Ga0373931_0001102 | |||
| 1886 | Ga0373935_0019518 | |||
| 1887 | Ga0373935_0769848 | |||
| 1888 | Ga0373927_0137851 | |||
| 1889 | Ga0373933_0119766 | |||
| 1890 | Ga0373933_0181363 | |||
| 1891 | Ga0373937_0062208 | |||
| 1892 | Ga0373937_0193787 | |||
| 1893 | Ga0373937_0256292 | |||
| 1894 | Ga0373937_0724066 | |||
| 1895 | Ga0373925_0144578 | |||
| 1896 | Ga0439453_0046629 | |||
| 1897 | Ga0439443_028279 | |||
| 1898 | Ga0450920_100502 | |||
| 1899 | Ga0450898_018975 | |||
| 1900 | Ga0439446_0075283 | |||
| 1901 | Ga0439435_0005143 | |||
| 1902 | Ga0439444_0009784 | |||
| 1903 | Ga0439444_0110971 | |||
| 1904 | Ga0439460_0156337 | |||
| 1905 | Ga0439440_0098698 | |||
| 1906 | Ga0466957_0346827 | |||
| 1907 | Ga0451576_0018415 | |||
| 1908 | Ga0451576_0063120 | |||
| 1909 | Ga0451576_0251398 | |||
| 1910 | Ga0451576_0555020 | |||
| 1911 | Ga0495592_0113301 | |||
| 1912 | Ga0495592_0212729 | |||
| 1913 | Ga0495603_0178197 | |||
| 1914 | Ga0495629_0780302 | |||
| 1915 | Ga0495653_0027217 | |||
| 1916 | Ga0495580_0057515 | |||
| 1917 | Ga0495580_0277722 | |||
| 1918 | Ga0495580_0328525 | |||
| 1919 | Ga0495580_0495935 | |||
| 1920 | Ga0495582_0022337 | |||
| 1921 | Ga0495639_0497865 | |||
| 1922 | Ga0495662_0004851 | |||
| 1923 | Ga0495662_0019565 | |||
| 1924 | Ga0495662_0248448 | |||
| 1925 | Ga0495664_0002656 | |||
| 1926 | Ga0495664_0150220 | |||
| 1927 | Ga0495664_0492913 | |||
| 1928 | Ga0495594_0020193 | |||
| 1929 | Ga0495594_0134160 | |||
| 1930 | Ga0495608_0001637 | |||
| 1931 | Ga0495608_0010805 | |||
| 1932 | Ga0495608_0020234 | |||
| 1933 | Ga0495618_0001991 | |||
| 1934 | Ga0495618_0122350 | |||
| 1935 | Ga0495628_0005641 | |||
| 1936 | Ga0495628_0196175 | |||
| 1937 | Ga0495628_0604431 | |||
| 1938 | Ga0495630_0003056 | |||
| 1939 | Ga0495630_0018823 | |||
| 1940 | Ga0495630_0096237 | |||
| 1941 | Ga0495643_0002275 | |||
| 1942 | Ga0495652_0013533 | |||
| 1943 | Ga0495652_0061162 | |||
| 1944 | Ga0495652_0278201 | |||
| 1945 | Ga0495665_0014159 | |||
| 1946 | Ga0495665_0366661 | |||
| 1947 | Ga0495640_0029246 | |||
| 1948 | Ga0495586_0003746 | |||
| 1949 | Ga0495586_0064693 | |||
| 1950 | Ga0495586_0075406 | |||
| 1951 | Ga0495586_0094288 | |||
| 1952 | Ga0495586_0124250 | |||
| 1953 | Ga0495586_0579320 | |||
| 1954 | Ga0495587_0028361 | |||
| 1955 | Ga0495587_0186450 | |||
| 1956 | Ga0495587_0351144 | |||
| 1957 | Ga0495598_0007473 | |||
| 1958 | Ga0495598_0028619 | |||
| 1959 | Ga0495621_0062339 | |||
| 1960 | Ga0495621_0234507 | |||
| 1961 | Ga0495645_0011238 | |||
| 1962 | Ga0495645_0012084 | |||
| 1963 | Ga0495645_0028039 | |||
| 1964 | Ga0495645_0036000 | |||
| 1965 | Ga0495645_0514047 | |||
| 1966 | Ga0495633_0053110 | |||
| 1967 | Ga0495667_0005477 | |||
| 1968 | Ga0495667_0009891 | |||
| 1969 | Ga0495656_0278175 | |||
| 1970 | Ga0495634_0010232 | |||
| 1971 | Ga0495634_0017938 | |||
| 1972 | Ga0495634_0021492 | |||
| 1973 | Ga0495634_0286649 | |||
| 1974 | Ga0495635_0001727 | |||
| 1975 | Ga0495635_0054941 | |||
| 1976 | Ga0495635_0374341 | |||
| 1977 | Ga0495659_0016559 | |||
| 1978 | Ga0495659_0271467 | |||
| 1979 | Ga0495588_0042163 | |||
| 1980 | Ga0495657_0009376 | |||
| 1981 | Ga0495657_0327391 | |||
| 1982 | Ga0495599_0022725 | |||
| 1983 | Ga0495599_0025293 | |||
| 1984 | Ga0495599_0036091 | |||
| 1985 | Ga0495623_0237001 | |||
| 1986 | Ga0495646_0016822 | |||
| 1987 | Ga0495646_0081311 | |||
| 1988 | Ga0495647_0082643 | |||
| 1989 | Ga0495658_0021669 | |||
| 1990 | Ga0495658_0034523 | |||
| 1991 | Ga0495658_0142410 | |||
| 1992 | Ga0495658_0224770 | |||
| 1993 | Ga0495669_0000961 | |||
| 1994 | Ga0495613_0000660 | |||
| 1995 | Ga0495613_0039334 | |||
| 1996 | Ga0495613_0300090 | |||
| 1997 | Ga0495613_0482872 | |||
| 1998 | Ga0495624_0038629 | |||
| 1999 | Ga0495600_0026246 | |||
| 2000 | Ga0495600_0094354 | |||
| 2001 | Ga0495600_0729065 | |||
| 2002 | Ga0495581_0060118 | |||
| 2003 | Ga0495581_0195763 | |||
| 2004 | Ga0495604_0019986 | |||
| 2005 | Ga0495604_0158472 | |||
| 2006 | Ga0495674_0001358 | |||
| 2007 | Ga0495674_0012140 | |||
| 2008 | Ga0495674_0450974 | |||
| 2009 | Ga0495680_0016397 | |||
| 2010 | Ga0495680_0019575 | |||
| 2011 | Ga0495680_0464592 | |||
| 2012 | Ga0495675_0037732 | |||
| 2013 | Ga0495675_0269970 | |||
| 2014 | Ga0495684_0000093 | |||
| 2015 | Ga0495684_0000933 | |||
| 2016 | Ga0495684_0053774 | |||
| 2017 | Ga0495602_0019077 | |||
| 2018 | Ga0495602_0277085 | |||
| 2019 | Ga0495614_0275871 | |||
| 2020 | Ga0496101_0002576 | |||
| 2021 | Ga0496102_0618846 | |||
| 2022 | Ga0496102_1182710 | |||
| 2023 | Ga0496103_0555938 | |||
| 2024 | Ga0496104_0136031 | |||
| 2025 | Ga0496104_0274869 | |||
| 2026 | Ga0496104_0799810 | |||
| 2027 | Ga0496105_0287579 | |||
| 2028 | Ga0496106_0099875 | |||
| 2029 | Ga0496107_0026822 | |||
| 2030 | Ga0496108_0268443 | |||
| 2031 | Ga0496109_0248934 | |||
| 2032 | Ga0496109_0639166 | |||
| 2033 | Ga0496114_0003266 | |||
| 2034 | Ga0496114_1084045 | |||
| 2035 | Ga0501295_041730 | |||
| 2036 | Ga0501298_126917 | |||
| 2037 | Ga0501031_0037755 | |||
| 2038 | Ga0501033_0125534 | |||
| 2039 | Ga0501033_0241992 | |||
| 2040 | Ga0501033_0433941 | |||
| 2041 | Ga0501036_0181269 | |||
| 2042 | Ga0501038_0113592 | |||
| 2043 | Ga0501038_0138229 | |||
| 2044 | Ga0501038_0184466 | |||
| 2045 | Ga0501039_0017435 | |||
| 2046 | Ga0501039_0224368 | |||
| 2047 | Ga0501039_0381213 | |||
| 2048 | Ga0501039_0761222 | |||
| 2049 | Ga0501040_0009109 | |||
| 2050 | Ga0501040_0021834 | |||
| 2051 | Ga0501040_0023204 | |||
| 2052 | Ga0501040_0263209 | |||
| 2053 | Ga0501040_0575922 | |||
| 2054 | Ga0501041_0013143 | |||
| 2055 | Ga0501041_0138649 | |||
| 2056 | Ga0501041_0142191 | |||
| 2057 | Ga0501042_0052005 | |||
| 2058 | Ga0501042_0182853 | |||
| 2059 | Ga0501042_0333182 | |||
| 2060 | Ga0501043_0125938 | |||
| 2061 | Ga0501046_0010812 | |||
| 2062 | Ga0501046_0289442 | |||
| 2063 | Ga0501048_0008220 | |||
| 2064 | Ga0501048_0026440 | |||
| 2065 | Ga0501048_0056555 | |||
| 2066 | Ga0501048_0218816 | |||
| 2067 | Ga0501048_0581862 | |||
| 2068 | Ga0501068_0370664 | |||
| 2069 | Ga0501071_0066880 | |||
| 2070 | Ga0501072_0002602 | |||
| 2071 | Ga0501072_0163877 | |||
| 2072 | Ga0501072_0273077 | |||
| 2073 | Ga0501074_0260539 | |||
| 2074 | Ga0501074_0402585 | |||
| 2075 | Ga0501075_0008675 | |||
| 2076 | Ga0501075_0018602 | |||
| 2077 | Ga0501075_0023507 | |||
| 2078 | Ga0501075_0046692 | |||
| 2079 | Ga0501075_0528375 | |||
| 2080 | Ga0501076_0012213 | |||
| 2081 | Ga0501076_0027129 | |||
| 2082 | Ga0501076_0469397 | |||
| 2083 | Ga0501076_0716569 | |||
| 2084 | Ga0501077_0373458 | |||
| 2085 | Ga0501249_045470 | |||
| 2086 | Ga0501259_090407 | |||
| 2087 | Ga0501225_0151308 | |||
| 2088 | Ga0501245_023953 | |||
| 2089 | Ga0501079_0002609 | |||
| 2090 | Ga0501079_0023234 | |||
| 2091 | Ga0501079_0529135 | |||
| 2092 | Ga0501080_0361286 | |||
| 2093 | Ga0501081_0004156 | |||
| 2094 | Ga0501081_0023628 | |||
| 2095 | Ga0501083_0207966 | |||
| 2096 | Ga0501283_031482 | |||
| 2097 | Ga0501035_0398121 | |||
| 2098 | Ga0501044_0721664 | |||
| 2099 | Ga0501045_0013782 | |||
| 2100 | Ga0501045_0194038 | |||
| 2101 | nmdc:mga05p37_119123_c1 | |||
| 2102 | nmdc:mga05p37_15475_c1 | |||
| 2103 | nmdc:mga05p37_173911_c1 | |||
| 2104 | nmdc:mga05p37_205927_c1 | |||
| 2105 | nmdc:mga05p37_240333_c1 | |||
| 2106 | nmdc:mga05p37_298137_c1 | |||
| 2107 | nmdc:mga05p37_30049_c1 | |||
| 2108 | nmdc:mga05p37_552226_c1 | |||
| 2109 | nmdc:mga05p37_66678_c1 | |||
| 2110 | nmdc:mga05p37_90180_c1 | |||
| 2111 | nmdc:mga09592_205827_c1 | |||
| 2112 | nmdc:mga09592_24906_c1 | |||
| 2113 | nmdc:mga09592_24955_c1 | |||
| 2114 | nmdc:mga09592_328846_c1 | |||
| 2115 | nmdc:mga09592_583282_c1 | |||
| 2116 | nmdc:mga09592_8477_c1 | |||
| 2117 | nmdc:mga0qj67_144255_c1 | |||
| 2118 | nmdc:mga0qj67_29343_c1 | |||
| 2119 | nmdc:mga0qj67_296341_c1 | |||
| 2120 | nmdc:mga0qj67_368851_c1 | |||
| 2121 | nmdc:mga0qj67_398362_c1 | |||
| 2122 | nmdc:mga0qj67_6585_c1 | |||
| 2123 | nmdc:mga06r32_108831_c1 | |||
| 2124 | nmdc:mga06r32_351857_c1 | |||
| 2125 | nmdc:mga06r32_420973_c1 | |||
| 2126 | nmdc:mga06r32_52364_c1 | |||
| 2127 | nmdc:mga06r32_58480_c1 | |||
| 2128 | nmdc:mga06r32_81180_c1 | |||
| 2129 | nmdc:mga06r32_9055_c1 | |||
| 2130 | nmdc:mga08y16_1236150_c1 | |||
| 2131 | nmdc:mga08y16_1256019_c1 | |||
| 2132 | nmdc:mga08y16_1481509_c1 | |||
| 2133 | nmdc:mga08y16_23945_c1 | |||
| 2134 | nmdc:mga08y16_29084_c1 | |||
| 2135 | nmdc:mga08y16_3223_c1 | |||
| 2136 | nmdc:mga08y16_39561_c1 | |||
| 2137 | nmdc:mga08y16_433555_c1 | |||
| 2138 | nmdc:mga0n895_1181_c1 | |||
| 2139 | nmdc:mga0n895_131304_c1 | |||
| 2140 | nmdc:mga0n895_42997_c1 | |||
| 2141 | nmdc:mga0n895_477858_c1 | |||
| 2142 | nmdc:mga0n895_5310_c1 | |||
| 2143 | nmdc:mga0n895_6206_c1 | |||
| 2144 | nmdc:mga0n895_698289_c1 | |||
| 2145 | nmdc:mga0n895_81276_c1 | |||
| 2146 | nmdc:mga0n895_85934_c1 | |||
| 2147 | nmdc:mga0n895_93_c1 | |||
| 2148 | nmdc:mga0rr50_1034464_c1 | |||
| 2149 | nmdc:mga0rr50_10_c1 | |||
| 2150 | nmdc:mga0rr50_1215733_c1 | |||
| 2151 | nmdc:mga0rr50_139526_c1 | |||
| 2152 | nmdc:mga0rr50_1405144_c1 | |||
| 2153 | nmdc:mga0rr50_259485_c1 | |||
| 2154 | nmdc:mga0rr50_373555_c1 | |||
| 2155 | nmdc:mga0rr50_502563_c1 | |||
| 2156 | nmdc:mga0rr50_67314_c1 | |||
| 2157 | nmdc:mga0rr50_967005_c1 | |||
| 2158 | nmdc:mga08x19_115055_c1 | |||
| 2159 | nmdc:mga08x19_122196_c1 | |||
| 2160 | nmdc:mga08x19_185732_c2 | |||
| 2161 | nmdc:mga08x19_209_c1 | |||
| 2162 | nmdc:mga08x19_2161_c1 | |||
| 2163 | nmdc:mga08x19_323447_c1 | |||
| 2164 | nmdc:mga08x19_502034_c1 | |||
| 2165 | nmdc:mga08x19_825_c1 | |||
| 2166 | nmdc:mga0a205_1242_c1 | |||
| 2167 | nmdc:mga0a205_197592_c1 | |||
| 2168 | nmdc:mga0a205_198189_c1 | |||
| 2169 | nmdc:mga0a205_27924_c1 | |||
| 2170 | nmdc:mga0a205_280581_c1 | |||
| 2171 | nmdc:mga0a205_367583_c1 | |||
| 2172 | nmdc:mga0a205_47171_c1 | |||
| 2173 | nmdc:mga0a205_627_c1 | |||
| 2174 | nmdc:mga0a205_636_c1 | |||
| 2175 | Ga0495601_0018203 | |||
| 2176 | Ga0495601_0493894 | |||
| 2177 | Ga0495612_0058729 | |||
| 2178 | Ga0495595_0015200 | |||
| 2179 | Ga0495595_0135353 | |||
| 2180 | Ga0495595_0200640 | |||
| 2181 | Ga0495619_0001650 | |||
| 2182 | Ga0495619_0028076 | |||
| 2183 | Ga0501084_0022075 | |||
| 2184 | Ga0501084_0127226 | |||
| 2185 | Ga0501084_0507715 | |||
| 2186 | Ga0587088_071909 | |||
| 2187 | Ga0501082_0022918 | |||
| 2188 | Ga0501082_0032098 | |||
| 2189 | Ga0501082_0049883 | |||
| 2190 | Ga0501082_0764221 | |||
| 2191 | Ga0530510_0002558 | |||
| 2192 | Ga0530510_0214388 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1y13-assembly1.cif.gz_A | structural analysis of plasmodium falciparum 6-pyruvoyl tetrahydropterin synthase (ptps) | 0.9251 | 6 | 166 |
| 2a0s-assembly1.cif.gz_A | crystal structure of 6-pyruvoyl tetrahydropterin synthase (ptps) from plasmodium vivax at 2.2 a resolution | 0.9234 | 5 | 166 |
| 3lze-assembly1.cif.gz_A | plasmodium vivax 6-pyruvoyltetrahydropterin synthase (ptps), e37c catalytic residue mutant | 0.9232 | 5 | 166 |
| 3m0n-assembly1.cif.gz_A | plasmodium vivax 6-pyruvoyltetrahydropterin synthase (ptps), e37a catalytic residue mutant | 0.9231 | 5 | 166 |
| 2a0s-assembly1.cif.gz_A | crystal structure of 6-pyruvoyl tetrahydropterin synthase (ptps) from plasmodium vivax at 2.2 a resolution | 0.9126 | 5 | 166 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58668_4_160_3.30.479.10 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.9418 | 16 | 166 | 3.30.479.10 |
| af_Q58668_4_160_3.30.479.10 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.8901 | 16 | 166 | 3.30.479.10 |
| 1y13C00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.8854 | 6 | 166 | 3.30.479.10 |
| 1y13C00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.8699 | 6 | 166 | 3.30.479.10 |
| af_K7TQJ5_29_131_2.60.40.150 | Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain | 0.8301 | 86 | 108 | 2.60.40.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9PIQ1-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9616 | 5 | 166 |
GO:0016829
GO:0046872 |
| AF-A0A7C4J6K3-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9607 | 5 | 165 |
GO:0046872
GO:0070497 |
| AF-A0A7Y2JRS7-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9581 | 5 | 167 |
GO:0016829
GO:0046872 |
| AF-A0A1F4ELN8-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9567 | 1 | 128 |
GO:0046872
GO:0070497 |
| AF-A0A2G1WDL1-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9519 | 5 | 165 |
GO:0046872
GO:0070497 |