F489924

General Info

Members Datasets Scaffolds Average Seq Length
1093 321 1093 484

Family's Representative Sequence

Representative Sequence 3300025924|Ga0207694_10151121|Ga0207694_101511211
Length 560
Sequence MKQIAHWALNMANQRGASYADARIVDARSRALATKNGKLGQASDSESLGLGIRVIADGAWGFSASDDLSRDAVEETAARALEIAKASARLKLDAVRLAPEKPVTAEWTTPCQIDPFGISIEQNLELLFAIDKELCAVAGVTLAETNLNFHREEQWFLSTEGTDIHQTKYSTGAGYAAYAFAGSDIQKRSYPSSYGGQWQNKGYELVHELKLLENASRIAEEAVALHKADKCPEGRFTVILEGSQLGLQIHESIGHPIELDRVLGMEANFAGTSFLTLDKLRTLRYGSDLVNVVADARQEHGPGLGTFGFDDEGVPAQCTPIVTNGLFTGYLSSRETAHMVGANRSGGTLRAENWNRLPIIRMTNVSLLPGEKPLTLEQLISDTDNGVYMETNRSWSIDDKRYNFQFGTEIGWEIKNGKRTRMLKNCSYSGITTEFWNSLDAICSRDEWVLWGTPNCGKGQPQQVMGTGHGAAPSRFRNIKVGVIVPYIDVDQNVIRFKDRTVLRIVEVDVEHLAVTTPVSAEIDDDPLMRXXXXLQCRCKIGLCLRRIGIYVAAGRECRR

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
114 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
115 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
175 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
180 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
181 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
184 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
188 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
189 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
190 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
191 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
192 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
193 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
194 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
195 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
198 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
199 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
209 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
214 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
215 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
231 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
238 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
239 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
240 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
251 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
252 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
253 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
254 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
260 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
261 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
262 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
263 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
264 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
265 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
266 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
267 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
268 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
269 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
270 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
271 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
272 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
273 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
274 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
275 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
280 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
281 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
282 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
283 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
284 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
285 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
286 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
291 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
292 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
295 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
296 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
297 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
300 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
301 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
302 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
306 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
307 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
308 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
309 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
310 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
311 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
312 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
313 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
316 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
317 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
318 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
321 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 1.01
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.85
Rhizosphere 93.6
Stem 0
Stem Tuber 0
Unclassified 1.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10003686 3300001991 Unclassified 2445
2 JGI24034J26672_10003488 3300002239 Unclassified 2197
3 JGI24751J29686_10003684 3300002459 Bacteria 3085
4 Ga0065712_10081078 3300005290 Unclassified 3041
5 Ga0070658_10028614 3300005327 Bacteria 4475
6 Ga0070683_100000007 3300005329 Bacteria 342155
7 Ga0070683_100014041 3300005329 Bacteria 6995
8 Ga0070683_100023082 3300005329 Bacteria 5563
9 Ga0070683_100030449 3300005329 Bacteria 4899
10 Ga0070683_100039473 3300005329 Bacteria 4334
11 Ga0070683_100046567 3300005329 Bacteria 4007
12 Ga0070683_100072735 3300005329 Bacteria 3210
13 Ga0070683_100089547 3300005329 Bacteria 2888
14 Ga0070690_100006966 3300005330 Bacteria 6438
15 Ga0070690_100065457 3300005330 Bacteria 2350
16 Ga0070670_100004282 3300005331 Bacteria 11942
17 Ga0068869_100005013 3300005334 Bacteria 8292
18 Ga0068869_100167945 3300005334 Bacteria 1712
19 Ga0070680_100005314 3300005336 Bacteria 9745
20 Ga0070680_100019473 3300005336 Bacteria 5377
21 Ga0070680_100111622 3300005336 Bacteria 2276
22 Ga0070680_100193270 3300005336 Bacteria 1715
23 Ga0070682_100086313 3300005337 Bacteria 2043
24 Ga0068868_100007852 3300005338 Bacteria 7616
25 Ga0068868_100012000 3300005338 Bacteria 6323
26 Ga0068868_100048572 3300005338 Bacteria 3329
27 Ga0068868_100085114 3300005338 Bacteria 2540
28 Ga0070660_100011738 3300005339 Bacteria 6237
29 Ga0070660_100044380 3300005339 Bacteria 3400
30 Ga0070691_10013656 3300005341 Bacteria 3723
31 Ga0070692_10048078 3300005345 Bacteria 2209
32 Ga0070669_100031982 3300005353 Unclassified 3800
33 Ga0070675_100017919 3300005354 Bacteria 5633
34 Ga0070673_100043351 3300005364 Unclassified 3476
35 Ga0070688_100007005 3300005365 Bacteria 6060
36 Ga0070688_100010707 3300005365 Bacteria 5067
37 Ga0070709_10000342 3300005434 Bacteria 29015
38 Ga0070709_10000415 3300005434 Bacteria 25969
39 Ga0070709_10002535 3300005434 Bacteria 9880
40 Ga0070709_10005534 3300005434 Bacteria 6839
41 Ga0070709_10008424 3300005434 Bacteria 5666
42 Ga0070709_10029236 3300005434 Bacteria 3295
43 Ga0070709_10051108 3300005434 Unclassified 2593
44 Ga0070709_10083938 3300005434 Unclassified 2085
45 Ga0070709_10095462 3300005434 Unclassified 1969
46 Ga0070714_100005417 3300005435 Bacteria 9735
47 Ga0070714_100006221 3300005435 Bacteria 9188
48 Ga0070714_100020121 3300005435 Bacteria 5446
49 Ga0070714_100037113 3300005435 Bacteria 4093
50 Ga0070714_100040314 3300005435 Bacteria 3936
51 Ga0070714_100048825 3300005435 Bacteria 3601
52 Ga0070714_100087185 3300005435 Bacteria 2729
53 Ga0070714_100088528 3300005435 Bacteria 2709
54 Ga0070714_100093185 3300005435 Bacteria 2641
55 Ga0070714_100097627 3300005435 Bacteria 2583
56 Ga0070713_100000349 3300005436 Bacteria 30061
57 Ga0070713_100000464 3300005436 Bacteria 25883
58 Ga0070713_100004858 3300005436 Bacteria 9111
59 Ga0070713_100007744 3300005436 Bacteria 7563
60 Ga0070713_100009782 3300005436 Bacteria 6892
61 Ga0070713_100016994 3300005436 Bacteria 5486
62 Ga0070713_100027388 3300005436 Bacteria 4487
63 Ga0070713_100034947 3300005436 Bacteria 4043
64 Ga0070713_100064591 3300005436 Bacteria 3072
65 Ga0070713_100072689 3300005436 Bacteria 2909
66 Ga0070713_100090480 3300005436 Bacteria 2630
67 Ga0070713_100126854 3300005436 Bacteria 2246
68 Ga0070713_100134550 3300005436 Bacteria 2183
69 Ga0070713_100174204 3300005436 Unclassified 1929
70 Ga0070713_100206947 3300005436 Bacteria 1775
71 Ga0070710_10012685 3300005437 Bacteria 4193
72 Ga0070710_10015228 3300005437 Bacteria 3889
73 Ga0070710_10052095 3300005437 Bacteria 2301
74 Ga0070711_100003499 3300005439 Bacteria 9155
75 Ga0070711_100003874 3300005439 Bacteria 8785
76 Ga0070711_100017670 3300005439 Bacteria 4544
77 Ga0070711_100068354 3300005439 Bacteria 2496
78 Ga0070711_100086589 3300005439 Bacteria 2247
79 Ga0070711_100102978 3300005439 Bacteria 2080
80 Ga0070711_100119529 3300005439 Bacteria 1947
81 Ga0070705_100000468 3300005440 Bacteria 23258
82 Ga0070694_100096265 3300005444 Unclassified 2086
83 Ga0070708_100000839 3300005445 Bacteria 23134
84 Ga0070708_100001971 3300005445 Bacteria 15827
85 Ga0070708_100006430 3300005445 Bacteria 9356
86 Ga0070708_100006468 3300005445 Bacteria 9325
87 Ga0070708_100044091 3300005445 Bacteria 3921
88 Ga0070708_100077925 3300005445 Bacteria 2995
89 Ga0070708_100159797 3300005445 Unclassified 2099
90 Ga0070708_100242697 3300005445 Bacteria 1691
91 Ga0070663_100026331 3300005455 Bacteria 3939
92 Ga0070681_10000340 3300005458 Bacteria 37661
93 Ga0070681_10001097 3300005458 Bacteria 23133
94 Ga0070681_10017801 3300005458 Bacteria 7099
95 Ga0070681_10061622 3300005458 Unclassified 3725
96 Ga0070681_10080972 3300005458 Bacteria 3203
97 Ga0070681_10157790 3300005458 Bacteria 2193
98 Ga0070681_10160529 3300005458 Bacteria 2172
99 Ga0068867_100004171 3300005459 Bacteria 10169
100 Ga0068867_100018277 3300005459 Bacteria 4982
101 Ga0070685_10015105 3300005466 Bacteria 4098
102 Ga0070706_100000063 3300005467 Bacteria 129205
103 Ga0070706_100000173 3300005467 Bacteria 81500
104 Ga0070706_100001330 3300005467 Bacteria 26281
105 Ga0070706_100002605 3300005467 Bacteria 18061
106 Ga0070706_100006446 3300005467 Bacteria 11078
107 Ga0070706_100018145 3300005467 Bacteria 6491
108 Ga0070706_100025394 3300005467 Bacteria 5451
109 Ga0070706_100040755 3300005467 Bacteria 4287
110 Ga0070706_100053822 3300005467 Bacteria 3715
111 Ga0070706_100085928 3300005467 Bacteria 2915
112 Ga0070707_100000808 3300005468 Bacteria 30955
113 Ga0070707_100000815 3300005468 Bacteria 30849
114 Ga0070707_100001494 3300005468 Bacteria 22796
115 Ga0070707_100003183 3300005468 Bacteria 15523
116 Ga0070707_100009403 3300005468 Bacteria 9072
117 Ga0070707_100009720 3300005468 Bacteria 8938
118 Ga0070707_100023040 3300005468 Bacteria 5890
119 Ga0070707_100036034 3300005468 Bacteria 4720
120 Ga0070707_100055862 3300005468 Bacteria 3785
121 Ga0070707_100125994 3300005468 Archaea 2488
122 Ga0070707_100238346 3300005468 Bacteria 1771
123 Ga0070698_100000002 3300005471 Bacteria 139184
124 Ga0070698_100002711 3300005471 Bacteria 19475
125 Ga0070698_100004166 3300005471 Bacteria 15899
126 Ga0070698_100009217 3300005471 Bacteria 10592
127 Ga0070698_100009390 3300005471 Bacteria 10489
128 Ga0070698_100023346 3300005471 Bacteria 6466
129 Ga0070698_100099640 3300005471 Bacteria 2879
130 Ga0070698_100101060 3300005471 Bacteria 2856
131 Ga0070698_100161281 3300005471 Bacteria 2186
132 Ga0070699_100001260 3300005518 Bacteria 23321
133 Ga0070699_100004975 3300005518 Bacteria 11715
134 Ga0070699_100005395 3300005518 Archaea 11213
135 Ga0070699_100014668 3300005518 Bacteria 6739
136 Ga0070699_100040937 3300005518 Bacteria 4011
137 Ga0070679_100003222 3300005530 Bacteria 14910
138 Ga0070679_100004339 3300005530 Bacteria 13103
139 Ga0070679_100014582 3300005530 Bacteria 7551
140 Ga0070679_100032884 3300005530 Bacteria 5133
141 Ga0070679_100143669 3300005530 Bacteria 2365
142 Ga0070684_100000021 3300005535 Bacteria 132928
143 Ga0070684_100006489 3300005535 Bacteria 9058
144 Ga0070684_100012044 3300005535 Bacteria 6914
145 Ga0070684_100057565 3300005535 Bacteria 3394
146 Ga0070684_100104855 3300005535 Bacteria 2530
147 Ga0070684_100155719 3300005535 Bacteria 2072
148 Ga0070697_100000015 3300005536 Bacteria 143397
149 Ga0070697_100000389 3300005536 Bacteria 34237
150 Ga0070697_100001978 3300005536 Bacteria 15681
151 Ga0070697_100002164 3300005536 Bacteria 15055
152 Ga0070697_100009479 3300005536 Archaea 7609
153 Ga0070697_100012622 3300005536 Bacteria 6617
154 Ga0070697_100013157 3300005536 Bacteria 6488
155 Ga0070697_100015949 3300005536 Bacteria 5905
156 Ga0070697_100031784 3300005536 Unclassified 4247
157 Ga0070697_100041007 3300005536 Unclassified 3746
158 Ga0070697_100046900 3300005536 Bacteria 3503
159 Ga0070697_100126628 3300005536 Bacteria 2140
160 Ga0070697_100127096 3300005536 Bacteria 2136
161 Ga0070697_100160984 3300005536 Unclassified 1896
162 Ga0068853_100042750 3300005539 Bacteria 3876
163 Ga0068853_100047205 3300005539 Bacteria 3695
164 Ga0070672_100007893 3300005543 Bacteria 7266
165 Ga0070672_100095253 3300005543 Bacteria 2407
166 Ga0070695_100020180 3300005545 Bacteria 4068
167 Ga0070695_100029186 3300005545 Unclassified 3426
168 Ga0070695_100055457 3300005545 Unclassified 2554
169 Ga0070696_100000158 3300005546 Bacteria 37863
170 Ga0070696_100001999 3300005546 Bacteria 13376
171 Ga0070696_100016914 3300005546 Bacteria 4920
172 Ga0070696_100030717 3300005546 Unclassified 3680
173 Ga0070696_100078062 3300005546 Bacteria 2340
174 Ga0070696_100089507 3300005546 Unclassified 2189
175 Ga0070693_100000065 3300005547 Bacteria 42786
176 Ga0070693_100039811 3300005547 Bacteria 2635
177 Ga0070665_100001525 3300005548 Bacteria 26822
178 Ga0070665_100275668 3300005548 Bacteria 1684
179 Ga0070704_100000207 3300005549 Bacteria 24460
180 Ga0070704_100001301 3300005549 Bacteria 13201
181 Ga0068855_100000514 3300005563 Bacteria 47680
182 Ga0068855_100006580 3300005563 Bacteria 14125
183 Ga0068855_100013304 3300005563 Bacteria 9926
184 Ga0068855_100017550 3300005563 Bacteria 8606
185 Ga0068855_100022860 3300005563 Bacteria 7494
186 Ga0068855_100032688 3300005563 Bacteria 6211
187 Ga0068855_100041740 3300005563 Bacteria 5436
188 Ga0068855_100045845 3300005563 Bacteria 5169
189 Ga0068855_100064896 3300005563 Bacteria 4258
190 Ga0068855_100091517 3300005563 Unclassified 3508
191 Ga0068855_100231229 3300005563 Bacteria 2070
192 Ga0070664_100001065 3300005564 Bacteria 21596
193 Ga0070664_100158701 3300005564 Bacteria 2000
194 Ga0070664_100206070 3300005564 Bacteria 1756
195 Ga0068857_100025348 3300005577 Bacteria 5221
196 Ga0068854_100000010 3300005578 Bacteria 173462
197 Ga0068854_100010143 3300005578 Bacteria 6103
198 Ga0068854_100016041 3300005578 Bacteria 4984
199 Ga0068854_100083367 3300005578 Bacteria 2364
200 Ga0068854_100085082 3300005578 Bacteria 2341
201 Ga0068856_100002688 3300005614 Bacteria 18226
202 Ga0068856_100002732 3300005614 Bacteria 18063
203 Ga0068856_100004305 3300005614 Bacteria 14208
204 Ga0068856_100007427 3300005614 Bacteria 10694
205 Ga0068856_100014465 3300005614 Bacteria 7624
206 Ga0068856_100019599 3300005614 Bacteria 6566
207 Ga0068856_100023496 3300005614 Bacteria 5994
208 Ga0068856_100081384 3300005614 Bacteria 3213
209 Ga0068856_100239830 3300005614 Bacteria 1828
210 Ga0070702_100001776 3300005615 Bacteria 8958
211 Ga0068852_100004761 3300005616 Bacteria 9638
212 Ga0068852_100014167 3300005616 Bacteria 6125
213 Ga0068852_100034018 3300005616 Bacteria 4238
214 Ga0068859_100008790 3300005617 Bacteria 10198
215 Ga0068859_100018009 3300005617 Bacteria 7097
216 Ga0068864_100000466 3300005618 Bacteria 35031
217 Ga0068866_10028536 3300005718 Bacteria 2660
218 Ga0068866_10048944 3300005718 Bacteria 2139
219 Ga0068866_10056358 3300005718 Bacteria 2021
220 Ga0068866_10064889 3300005718 Bacteria 1908
221 Ga0068851_10009283 3300005834 Unclassified 4566
222 Ga0068851_10018430 3300005834 Unclassified 3361
223 Ga0068863_100001330 3300005841 Bacteria 24613
224 Ga0068863_100014350 3300005841 Bacteria 7630
225 Ga0068863_100026901 3300005841 Bacteria 5486
226 Ga0068863_100027217 3300005841 Bacteria 5452
227 Ga0068863_100082210 3300005841 Bacteria 3052
228 Ga0068858_100001017 3300005842 Bacteria 28912
229 Ga0068858_100003905 3300005842 Bacteria 14724
230 Ga0068858_100004164 3300005842 Bacteria 14231
231 Ga0068858_100017610 3300005842 Bacteria 6697
232 Ga0068858_100026410 3300005842 Bacteria 5396
233 Ga0068860_100017683 3300005843 Bacteria 6946
234 Ga0068860_100064272 3300005843 Unclassified 3486
235 Ga0068860_100086236 3300005843 Bacteria 2988
236 Ga0068860_100115139 3300005843 Bacteria 2571
237 Ga0068862_100170857 3300005844 Bacteria 1946
238 Ga0081455_10059710 3300005937 Bacteria 3218
239 Ga0081455_10072539 3300005937 Bacteria 2850
240 Ga0081538_10026741 3300005981 Bacteria 4025
241 Ga0081539_10003804 3300005985 Bacteria 17766
242 Ga0081539_10008689 3300005985 Bacteria 8742
243 Ga0081539_10067069 3300005985 Bacteria 1942
244 Ga0070717_10001227 3300006028 Bacteria 17447
245 Ga0070717_10010164 3300006028 Bacteria 7089
246 Ga0070717_10016939 3300006028 Bacteria 5661
247 Ga0070717_10021861 3300006028 Bacteria 5047
248 Ga0070717_10025498 3300006028 Bacteria 4703
249 Ga0070717_10052211 3300006028 Bacteria 3367
250 Ga0070717_10063584 3300006028 Unclassified 3063
251 Ga0070717_10067061 3300006028 Bacteria 2985
252 Ga0070717_10095760 3300006028 Bacteria 2513
253 Ga0070717_10129222 3300006028 Bacteria 2171
254 Ga0070715_10004069 3300006163 Bacteria 4749
255 Ga0070715_10004165 3300006163 Bacteria 4705
256 Ga0070716_100004195 3300006173 Bacteria 6855
257 Ga0070716_100004349 3300006173 Bacteria 6762
258 Ga0070716_100007388 3300006173 Bacteria 5406
259 Ga0070716_100008396 3300006173 Bacteria 5122
260 Ga0070716_100010833 3300006173 Bacteria 4585
261 Ga0070716_100027213 3300006173 Unclassified 3069
262 Ga0070716_100096768 3300006173 Unclassified 1800
263 Ga0070712_100000401 3300006175 Bacteria 24660
264 Ga0070712_100000586 3300006175 Bacteria 21238
265 Ga0070712_100003006 3300006175 Bacteria 10438
266 Ga0070712_100004555 3300006175 Bacteria 8559
267 Ga0070712_100016090 3300006175 Bacteria 4827
268 Ga0070712_100044874 3300006175 Bacteria 3049
269 Ga0070712_100052070 3300006175 Bacteria 2854
270 Ga0070712_100054559 3300006175 Unclassified 2794
271 Ga0070712_100075357 3300006175 Bacteria 2426
272 Ga0097621_100001928 3300006237 Bacteria 14158
273 Ga0097621_100005841 3300006237 Bacteria 8693
274 Ga0097621_100036487 3300006237 Unclassified 3933
275 Ga0097621_100067811 3300006237 Bacteria 2941
276 Ga0097621_100072133 3300006237 Bacteria 2856
277 Ga0068871_100000058 3300006358 Bacteria 59490
278 Ga0068871_100002915 3300006358 Bacteria 11730
279 Ga0068871_100006073 3300006358 Bacteria 8499
280 Ga0068871_100030270 3300006358 Bacteria 4261
281 Ga0068871_100032706 3300006358 Unclassified 4112
282 Ga0075428_100063842 3300006844 Bacteria 4032
283 Ga0075430_100003335 3300006846 Bacteria 13447
284 Ga0075430_100018493 3300006846 Bacteria 5930
285 Ga0075430_100038276 3300006846 Unclassified 4063
286 Ga0075430_100047424 3300006846 Bacteria 3628
287 Ga0075431_100003894 3300006847 Bacteria 14530
288 Ga0075431_100040689 3300006847 Bacteria 4790
289 Ga0075431_100124670 3300006847 Bacteria 2658
290 Ga0075431_100134681 3300006847 Bacteria 2547
291 Ga0075433_10000901 3300006852 Bacteria 20949
292 Ga0075433_10003804 3300006852 Bacteria 11687
293 Ga0075433_10018081 3300006852 Bacteria 5852
294 Ga0075433_10022629 3300006852 Bacteria 5278
295 Ga0075433_10068654 3300006852 Bacteria 3112
296 Ga0075434_100000140 3300006871 Bacteria 44001
297 Ga0075434_100000987 3300006871 Bacteria 23010
298 Ga0075434_100002070 3300006871 Bacteria 17440
299 Ga0075434_100006334 3300006871 Bacteria 10850
300 Ga0075434_100021397 3300006871 Bacteria 6285
301 Ga0075434_100024946 3300006871 Bacteria 5847
302 Ga0075434_100035108 3300006871 Bacteria 4956
303 Ga0075434_100036065 3300006871 Bacteria 4890
304 Ga0075434_100047370 3300006871 Bacteria 4266
305 Ga0075434_100072082 3300006871 Bacteria 3446
306 Ga0075434_100257451 3300006871 Bacteria 1764
307 Ga0075429_100000530 3300006880 Bacteria 28977
308 Ga0075429_100141745 3300006880 Unclassified 2104
309 Ga0068865_100091462 3300006881 Bacteria 2208
310 Ga0075436_100001850 3300006914 Bacteria 14520
311 Ga0075436_100002747 3300006914 Bacteria 12099
312 Ga0075436_100004935 3300006914 Bacteria 9165
313 Ga0075436_100006615 3300006914 Bacteria 7943
314 Ga0075436_100010290 3300006914 Bacteria 6404
315 Ga0075436_100015558 3300006914 Bacteria 5208
316 Ga0075436_100017439 3300006914 Bacteria 4916
317 Ga0075436_100024752 3300006914 Bacteria 4128
318 Ga0075436_100034305 3300006914 Unclassified 3499
319 Ga0075436_100088506 3300006914 Bacteria 2151
320 Ga0075436_100124548 3300006914 Bacteria 1805
321 Ga0097620_100008790 3300006931 Bacteria 10198
322 Ga0097620_100018009 3300006931 Bacteria 7097
323 Ga0075435_100002553 3300007076 Bacteria 12129
324 Ga0075435_100052451 3300007076 Bacteria 3288
325 Ga0075435_100055269 3300007076 Bacteria 3206
326 Ga0075435_100085774 3300007076 Bacteria 2592
327 Ga0075435_100161802 3300007076 Bacteria 1886
328 Ga0099794_10012827 3300007265 Bacteria 3631
329 Ga0099794_10037928 3300007265 Unclassified 2282
330 Ga0105240_10000948 3300009093 Bacteria 51646
331 Ga0105240_10001342 3300009093 Bacteria 42197
332 Ga0105240_10010328 3300009093 Bacteria 13136
333 Ga0105240_10011876 3300009093 Bacteria 12085
334 Ga0105240_10016500 3300009093 Bacteria 9997
335 Ga0105240_10025672 3300009093 Bacteria 7739
336 Ga0105240_10033712 3300009093 Bacteria 6612
337 Ga0105240_10041454 3300009093 Bacteria 5877
338 Ga0105240_10057336 3300009093 Bacteria 4867
339 Ga0105240_10058901 3300009093 Bacteria 4794
340 Ga0105240_10062556 3300009093 Bacteria 4633
341 Ga0105240_10082066 3300009093 Bacteria 3959
342 Ga0105240_10166595 3300009093 Unclassified 2613
343 Ga0105240_10201088 3300009093 Bacteria 2335
344 Ga0105240_10229670 3300009093 Bacteria 2157
345 Ga0111539_10000378 3300009094 Bacteria 55103
346 Ga0111539_10307441 3300009094 Bacteria 1845
347 Ga0105245_10002938 3300009098 Bacteria 15306
348 Ga0105245_10025367 3300009098 Bacteria 5213
349 Ga0105245_10025823 3300009098 Bacteria 5166
350 Ga0105245_10048797 3300009098 Bacteria 3788
351 Ga0105245_10068593 3300009098 Bacteria 3214
352 Ga0105245_10069721 3300009098 Bacteria 3188
353 Ga0105245_10071780 3300009098 Unclassified 3145
354 Ga0114129_10000075 3300009147 Bacteria 91461
355 Ga0114129_10040059 3300009147 Bacteria 6607
356 Ga0114129_10308329 3300009147 Bacteria 2108
357 Ga0114129_10341170 3300009147 Bacteria 1987
358 Ga0105241_10051512 3300009174 Bacteria 3140
359 Ga0105241_10062577 3300009174 Bacteria 2869
360 Ga0105241_10074141 3300009174 Bacteria 2650
361 Ga0105241_10086825 3300009174 Bacteria 2461
362 Ga0105248_10046507 3300009177 Bacteria 4864
363 Ga0105248_10193671 3300009177 Bacteria 2290
364 Ga0105237_10001632 3300009545 Bacteria 29125
365 Ga0105237_10009361 3300009545 Bacteria 10493
366 Ga0105237_10023109 3300009545 Bacteria 6375
367 Ga0105237_10033561 3300009545 Bacteria 5200
368 Ga0105237_10129759 3300009545 Unclassified 2515
369 Ga0105237_10131539 3300009545 Bacteria 2497
370 Ga0105238_10000419 3300009551 Bacteria 44758
371 Ga0105238_10020549 3300009551 Bacteria 6723
372 Ga0105238_10224602 3300009551 Bacteria 1854
373 Ga0105239_10009924 3300010375 Bacteria 10689
374 Ga0105239_10082527 3300010375 Bacteria 3540
375 Ga0105239_10151276 3300010375 Bacteria 2590
376 Ga0105246_10013488 3300011119 Bacteria 5124
377 Ga0157373_10002219 3300013100 Bacteria 14694
378 Ga0157373_10005992 3300013100 Bacteria 9094
379 Ga0157371_10027086 3300013102 Bacteria 4161
380 Ga0157370_10007410 3300013104 Bacteria 11948
381 Ga0157370_10026110 3300013104 Bacteria 5771
382 Ga0157370_10059913 3300013104 Unclassified 3616
383 Ga0157369_10001273 3300013105 Bacteria 31309
384 Ga0157369_10028229 3300013105 Bacteria 6212
385 Ga0157369_10031967 3300013105 Bacteria 5790
386 Ga0157369_10035694 3300013105 Bacteria 5450
387 Ga0157369_10056145 3300013105 Bacteria 4249
388 Ga0157369_10089556 3300013105 Bacteria 3285
389 Ga0157369_10104530 3300013105 Unclassified 3015
390 Ga0157369_10180322 3300013105 Bacteria 2222
391 Ga0157374_10000236 3300013296 Bacteria 51341
392 Ga0157374_10000722 3300013296 Bacteria 28854
393 Ga0157374_10000771 3300013296 Bacteria 28014
394 Ga0157374_10002785 3300013296 Bacteria 14683
395 Ga0157374_10247418 3300013296 Bacteria 1754
396 Ga0157378_10000119 3300013297 Bacteria 75908
397 Ga0157378_10001314 3300013297 Bacteria 22359
398 Ga0157378_10001479 3300013297 Bacteria 21219
399 Ga0157378_10002703 3300013297 Bacteria 15805
400 Ga0157378_10003622 3300013297 Bacteria 13669
401 Ga0157378_10012740 3300013297 Bacteria 7360
402 Ga0157378_10028050 3300013297 Bacteria 4965
403 Ga0157378_10036101 3300013297 Bacteria 4374
404 Ga0157378_10204309 3300013297 Bacteria 1870
405 Ga0157378_10243375 3300013297 Bacteria 1719
406 Ga0163162_10031676 3300013306 Bacteria 5245
407 Ga0157372_10000497 3300013307 Bacteria 43246
408 Ga0157372_10000995 3300013307 Bacteria 30940
409 Ga0157372_10002841 3300013307 Bacteria 18717
410 Ga0157372_10004064 3300013307 Bacteria 15685
411 Ga0157372_10006842 3300013307 Bacteria 12129
412 Ga0157372_10050540 3300013307 Unclassified 4624
413 Ga0157372_10193618 3300013307 Unclassified 2355
414 Ga0157375_10105183 3300013308 Bacteria 2912
415 Ga0163163_10050996 3300014325 Bacteria 4078
416 Ga0163163_10092351 3300014325 Bacteria 3042
417 Ga0157380_10084763 3300014326 Bacteria 2599
418 Ga0182008_10002320 3300014497 Bacteria 11988
419 Ga0157377_10006251 3300014745 Bacteria 5671
420 Ga0157379_10004138 3300014968 Bacteria 12380
421 Ga0157379_10004974 3300014968 Bacteria 11407
422 Ga0157379_10005382 3300014968 Bacteria 10994
423 Ga0157379_10047901 3300014968 Bacteria 3815
424 Ga0157379_10080281 3300014968 Bacteria 2922
425 Ga0157376_10000037 3300014969 Bacteria 138129
426 Ga0157376_10008975 3300014969 Bacteria 7240
427 Ga0157376_10080074 3300014969 Bacteria 2801
428 Ga0157376_10254396 3300014969 Bacteria 1642
429 Ga0182007_10017164 3300015262 Bacteria 2652
430 Ga0163161_10009234 3300017792 Bacteria 6817
431 Ga0206356_10046556 3300020070 Bacteria 16777
432 Ga0206353_10581244 3300020082 Bacteria 3599
433 Ga0206353_12057544 3300020082 Bacteria 2608
434 Ga0213873_10006723 3300021358 Unclassified 2274
435 Ga0213873_10010471 3300021358 Bacteria 1956
436 Ga0213876_10002859 3300021384 Bacteria 10033
437 Ga0213875_10005848 3300021388 Bacteria 6542
438 Ga0213875_10037905 3300021388 Unclassified 2271
439 Ga0224569_101491 3300022732 Bacteria 1959
440 Ga0224572_1006665 3300024225 Bacteria 2093
441 Ga0224572_1012324 3300024225 Bacteria 1624
442 Ga0228598_1000392 3300024227 Bacteria 8806
443 Ga0228598_1002432 3300024227 Bacteria 4066
444 Ga0207692_10041723 3300025898 Bacteria 2274
445 Ga0207642_10004968 3300025899 Bacteria 4310
446 Ga0207642_10068661 3300025899 Bacteria 1678
447 Ga0207688_10008814 3300025901 Bacteria 5489
448 Ga0207647_10000903 3300025904 Bacteria 22977
449 Ga0207647_10010492 3300025904 Bacteria 6542
450 Ga0207685_10009160 3300025905 Bacteria 2862
451 Ga0207685_10021750 3300025905 Unclassified 2155
452 Ga0207699_10000059 3300025906 Bacteria 94698
453 Ga0207699_10003310 3300025906 Bacteria 7682
454 Ga0207699_10006411 3300025906 Bacteria 5695
455 Ga0207699_10008819 3300025906 Bacteria 4994
456 Ga0207699_10020177 3300025906 Bacteria 3567
457 Ga0207699_10039166 3300025906 Unclassified 2722
458 Ga0207699_10075199 3300025906 Unclassified 2077
459 Ga0207699_10124858 3300025906 Bacteria 1670
460 Ga0207645_10001602 3300025907 Bacteria 18439
461 Ga0207643_10004784 3300025908 Bacteria 7253
462 Ga0207705_10016962 3300025909 Bacteria 5216
463 Ga0207684_10000018 3300025910 Bacteria 361536
464 Ga0207684_10000267 3300025910 Bacteria 77172
465 Ga0207684_10001875 3300025910 Bacteria 21872
466 Ga0207684_10016631 3300025910 Bacteria 6315
467 Ga0207684_10033302 3300025910 Unclassified 4381
468 Ga0207684_10034314 3300025910 Bacteria 4312
469 Ga0207684_10072921 3300025910 Bacteria 2916
470 Ga0207654_10021049 3300025911 Unclassified 3464
471 Ga0207654_10054194 3300025911 Bacteria 2317
472 Ga0207654_10085190 3300025911 Bacteria 1912
473 Ga0207707_10033504 3300025912 Bacteria 4495
474 Ga0207707_10056674 3300025912 Bacteria 3410
475 Ga0207707_10062989 3300025912 Bacteria 3228
476 Ga0207707_10085766 3300025912 Bacteria 2751
477 Ga0207707_10093595 3300025912 Unclassified 2625
478 Ga0207707_10124957 3300025912 Bacteria 2250
479 Ga0207695_10005967 3300025913 Bacteria 15931
480 Ga0207695_10008345 3300025913 Bacteria 12975
481 Ga0207695_10010643 3300025913 Bacteria 11237
482 Ga0207695_10012611 3300025913 Bacteria 10128
483 Ga0207695_10021905 3300025913 Bacteria 7274
484 Ga0207695_10047992 3300025913 Bacteria 4512
485 Ga0207695_10082350 3300025913 Bacteria 3254
486 Ga0207695_10102053 3300025913 Unclassified 2862
487 Ga0207695_10165806 3300025913 Bacteria 2137
488 Ga0207671_10004346 3300025914 Bacteria 13598
489 Ga0207671_10012796 3300025914 Bacteria 6725
490 Ga0207693_10000142 3300025915 Bacteria 65780
491 Ga0207693_10000215 3300025915 Bacteria 53182
492 Ga0207693_10001652 3300025915 Bacteria 19684
493 Ga0207693_10002184 3300025915 Bacteria 17057
494 Ga0207693_10005175 3300025915 Bacteria 10917
495 Ga0207693_10007280 3300025915 Bacteria 9106
496 Ga0207693_10012264 3300025915 Bacteria 6927
497 Ga0207693_10012627 3300025915 Bacteria 6824
498 Ga0207693_10052764 3300025915 Bacteria 3189
499 Ga0207693_10065088 3300025915 Bacteria 2855
500 Ga0207693_10066342 3300025915 Bacteria 2826
501 Ga0207663_10000512 3300025916 Bacteria 17004
502 Ga0207663_10003671 3300025916 Bacteria 7546
503 Ga0207663_10008379 3300025916 Bacteria 5400
504 Ga0207663_10024515 3300025916 Bacteria 3475
505 Ga0207663_10072603 3300025916 Bacteria 2225
506 Ga0207663_10085250 3300025916 Bacteria 2080
507 Ga0207663_10086469 3300025916 Bacteria 2068
508 Ga0207660_10012171 3300025917 Bacteria 5623
509 Ga0207660_10035700 3300025917 Unclassified 3453
510 Ga0207662_10002927 3300025918 Bacteria 8666
511 Ga0207657_10001367 3300025919 Bacteria 26016
512 Ga0207657_10002030 3300025919 Bacteria 21872
513 Ga0207657_10077912 3300025919 Bacteria 2792
514 Ga0207649_10000149 3300025920 Bacteria 57837
515 Ga0207652_10003389 3300025921 Bacteria 13162
516 Ga0207652_10009107 3300025921 Bacteria 7994
517 Ga0207652_10014985 3300025921 Bacteria 6289
518 Ga0207652_10018977 3300025921 Bacteria 5648
519 Ga0207652_10032119 3300025921 Unclassified 4410
520 Ga0207652_10075593 3300025921 Bacteria 2936
521 Ga0207646_10000001 3300025922 Bacteria 1242027
522 Ga0207646_10000006 3300025922 Bacteria 510716
523 Ga0207646_10000017 3300025922 Bacteria 324386
524 Ga0207646_10000019 3300025922 Bacteria 282855
525 Ga0207646_10001228 3300025922 Bacteria 32199
526 Ga0207646_10002636 3300025922 Bacteria 21066
527 Ga0207646_10004228 3300025922 Bacteria 15703
528 Ga0207646_10008098 3300025922 Bacteria 10592
529 Ga0207646_10009914 3300025922 Bacteria 9370
530 Ga0207646_10014287 3300025922 Unclassified 7548
531 Ga0207646_10047704 3300025922 Unclassified 3841
532 Ga0207646_10061057 3300025922 Bacteria 3365
533 Ga0207646_10141232 3300025922 Bacteria 2169
534 Ga0207681_10084825 3300025923 Bacteria 2246
535 Ga0207694_10063774 3300025924 Bacteria 2871
536 Ga0207694_10151121 3300025924 Unclassified 1871
537 Ga0207650_10000442 3300025925 Bacteria 35606
538 Ga0207659_10028334 3300025926 Unclassified 3805
539 Ga0207687_10002511 3300025927 Bacteria 12449
540 Ga0207687_10032250 3300025927 Bacteria 3547
541 Ga0207687_10037775 3300025927 Bacteria 3297
542 Ga0207687_10171987 3300025927 Bacteria 1671
543 Ga0207700_10000028 3300025928 Bacteria 135555
544 Ga0207700_10000200 3300025928 Bacteria 35788
545 Ga0207700_10004203 3300025928 Bacteria 8455
546 Ga0207700_10005255 3300025928 Bacteria 7717
547 Ga0207700_10005553 3300025928 Bacteria 7567
548 Ga0207700_10009464 3300025928 Bacteria 6089
549 Ga0207700_10014401 3300025928 Bacteria 5181
550 Ga0207700_10014517 3300025928 Bacteria 5163
551 Ga0207700_10111214 3300025928 Bacteria 2204
552 Ga0207700_10159460 3300025928 Bacteria 1872
553 Ga0207700_10183072 3300025928 Bacteria 1756
554 Ga0207700_10200210 3300025928 Bacteria 1682
555 Ga0207664_10000033 3300025929 Bacteria 176549
556 Ga0207664_10014549 3300025929 Bacteria 5686
557 Ga0207664_10021505 3300025929 Bacteria 4799
558 Ga0207664_10035338 3300025929 Bacteria 3855
559 Ga0207664_10045521 3300025929 Bacteria 3441
560 Ga0207664_10047224 3300025929 Unclassified 3382
561 Ga0207664_10062443 3300025929 Bacteria 2975
562 Ga0207664_10065469 3300025929 Bacteria 2910
563 Ga0207664_10072894 3300025929 Bacteria 2770
564 Ga0207706_10000651 3300025933 Bacteria 36655
565 Ga0207706_10013270 3300025933 Bacteria 7496
566 Ga0207686_10053038 3300025934 Unclassified 2534
567 Ga0207686_10071236 3300025934 Unclassified 2236
568 Ga0207709_10077835 3300025935 Bacteria 2127
569 Ga0207709_10120402 3300025935 Bacteria 1771
570 Ga0207670_10041122 3300025936 Unclassified 3038
571 Ga0207704_10100559 3300025938 Unclassified 1926
572 Ga0207665_10000086 3300025939 Bacteria 60660
573 Ga0207665_10000313 3300025939 Bacteria 33592
574 Ga0207665_10005910 3300025939 Bacteria 8145
575 Ga0207665_10007051 3300025939 Bacteria 7441
576 Ga0207665_10007816 3300025939 Bacteria 7058
577 Ga0207665_10012072 3300025939 Bacteria 5670
578 Ga0207665_10012828 3300025939 Bacteria 5511
579 Ga0207665_10015989 3300025939 Bacteria 4927
580 Ga0207665_10016855 3300025939 Bacteria 4798
581 Ga0207665_10049177 3300025939 Bacteria 2832
582 Ga0207691_10005111 3300025940 Bacteria 12662
583 Ga0207711_10047104 3300025941 Bacteria 3685
584 Ga0207689_10000788 3300025942 Bacteria 30435
585 Ga0207689_10008927 3300025942 Bacteria 8691
586 Ga0207689_10098509 3300025942 Bacteria 2402
587 Ga0207661_10000010 3300025944 Bacteria 375338
588 Ga0207661_10000213 3300025944 Bacteria 37493
589 Ga0207661_10019337 3300025944 Bacteria 5076
590 Ga0207661_10021196 3300025944 Bacteria 4869
591 Ga0207661_10022102 3300025944 Bacteria 4782
592 Ga0207661_10044423 3300025944 Bacteria 3512
593 Ga0207661_10089568 3300025944 Bacteria 2560
594 Ga0207679_10000080 3300025945 Bacteria 84997
595 Ga0207679_10103673 3300025945 Bacteria 2230
596 Ga0207667_10000103 3300025949 Bacteria 135265
597 Ga0207667_10000669 3300025949 Bacteria 44388
598 Ga0207667_10018202 3300025949 Bacteria 7884
599 Ga0207667_10025711 3300025949 Bacteria 6440
600 Ga0207667_10030236 3300025949 Bacteria 5861
601 Ga0207667_10054355 3300025949 Bacteria 4212
602 Ga0207651_10071562 3300025960 Bacteria 2458
603 Ga0207668_10011337 3300025972 Bacteria 5412
604 Ga0207640_10000004 3300025981 Bacteria 489403
605 Ga0207640_10038070 3300025981 Bacteria 3032
606 Ga0207640_10163867 3300025981 Bacteria 1648
607 Ga0207677_10009387 3300026023 Bacteria 5506
608 Ga0207677_10039356 3300026023 Bacteria 3108
609 Ga0207677_10043120 3300026023 Bacteria 2997
610 Ga0207703_10004814 3300026035 Bacteria 10991
611 Ga0207703_10018012 3300026035 Bacteria 5515
612 Ga0207703_10021177 3300026035 Bacteria 5089
613 Ga0207703_10054106 3300026035 Bacteria 3263
614 Ga0207639_10066021 3300026041 Bacteria 2811
615 Ga0207639_10080999 3300026041 Bacteria 2570
616 Ga0207708_10005782 3300026075 Bacteria 9141
617 Ga0207702_10000479 3300026078 Bacteria 44958
618 Ga0207702_10001512 3300026078 Bacteria 22980
619 Ga0207702_10014206 3300026078 Bacteria 6613
620 Ga0207702_10015860 3300026078 Bacteria 6239
621 Ga0207702_10021274 3300026078 Bacteria 5368
622 Ga0207702_10117725 3300026078 Bacteria 2373
623 Ga0207702_10131588 3300026078 Unclassified 2252
624 Ga0207641_10000432 3300026088 Bacteria 48190
625 Ga0207641_10004436 3300026088 Bacteria 12159
626 Ga0207641_10016632 3300026088 Bacteria 6023
627 Ga0207641_10094134 3300026088 Bacteria 2627
628 Ga0207641_10173207 3300026088 Unclassified 1972
629 Ga0207648_10001706 3300026089 Bacteria 24036
630 Ga0207648_10016467 3300026089 Bacteria 6752
631 Ga0207648_10022244 3300026089 Bacteria 5696
632 Ga0207648_10073743 3300026089 Bacteria 2974
633 Ga0207676_10000586 3300026095 Bacteria 29950
634 Ga0207676_10030079 3300026095 Bacteria 4072
635 Ga0207676_10057830 3300026095 Bacteria 3056
636 Ga0207674_10001107 3300026116 Bacteria 35021
637 Ga0207674_10002438 3300026116 Bacteria 23491
638 Ga0207675_100026225 3300026118 Bacteria 5425
639 Ga0207683_10004817 3300026121 Bacteria 11622
640 Ga0207683_10012241 3300026121 Bacteria 7323
641 Ga0207698_10041191 3300026142 Bacteria 3439
642 Ga0207698_10132012 3300026142 Bacteria 2136
643 Ga0209588_1001140 3300027671 Unclassified 6845
644 Ga0209588_1002962 3300027671 Archaea 4668
645 Ga0209588_1016358 3300027671 Unclassified 2289
646 Ga0207428_10001476 3300027907 Bacteria 24616
647 Ga0207428_10182454 3300027907 Bacteria 1585
648 Ga0265354_1001572 3300028016 Bacteria 3206
649 Ga0265356_1000078 3300028017 Bacteria 16086
650 Ga0268266_10000736 3300028379 Bacteria 43813
651 Ga0268266_10015724 3300028379 Bacteria 6480
652 Ga0268265_10006060 3300028380 Bacteria 8213
653 Ga0268264_10004389 3300028381 Bacteria 12037
654 Ga0265319_1000256 3300028563 Bacteria 40127
655 Ga0265318_10000240 3300028577 Bacteria 47828
656 Ga0265323_10000266 3300028653 Bacteria 30603
657 Ga0265338_10002910 3300028800 Bacteria 24891
658 Ga0265338_10012494 3300028800 Bacteria 9677
659 Ga0265338_10019564 3300028800 Bacteria 7174
660 Ga0265338_10034628 3300028800 Bacteria 4876
661 Ga0265338_10046890 3300028800 Bacteria 3953
662 Ga0265324_10032731 3300029957 Bacteria 1816
663 Ga0265762_1000283 3300030760 Bacteria 8455
664 Ga0265762_1001021 3300030760 Bacteria 5031
665 Ga0265770_1003384 3300030878 Unclassified 2167
666 Ga0265770_1003400 3300030878 Unclassified 2164
667 Ga0265760_10000014 3300031090 Bacteria 93274
668 Ga0265760_10000599 3300031090 Bacteria 10250
669 Ga0265760_10006515 3300031090 Bacteria 3339
670 Ga0265760_10008310 3300031090 Bacteria 2969
671 Ga0265330_10000124 3300031235 Bacteria 63181
672 Ga0265332_10000212 3300031238 Bacteria 47356
673 Ga0265332_10013007 3300031238 Bacteria 3690
674 Ga0265320_10000124 3300031240 Bacteria 67180
675 Ga0265325_10002766 3300031241 Bacteria 11713
676 Ga0265325_10007723 3300031241 Bacteria 6409
677 Ga0265325_10008141 3300031241 Bacteria 6210
678 Ga0265325_10019981 3300031241 Bacteria 3696
679 Ga0265329_10000224 3300031242 Bacteria 30023
680 Ga0265329_10001260 3300031242 Bacteria 12378
681 Ga0265329_10004592 3300031242 Bacteria 5708
682 Ga0265339_10008695 3300031249 Bacteria 6443
683 Ga0265339_10015636 3300031249 Bacteria 4544
684 Ga0265331_10000232 3300031250 Bacteria 67206
685 Ga0265331_10006150 3300031250 Bacteria 7137
686 Ga0265331_10006875 3300031250 Bacteria 6648
687 Ga0265331_10011108 3300031250 Bacteria 4940
688 Ga0265331_10021036 3300031250 Bacteria 3342
689 Ga0265316_10000007 3300031344 Bacteria 264584
690 Ga0265316_10008501 3300031344 Bacteria 9520
691 Ga0265316_10008528 3300031344 Bacteria 9503
692 Ga0265316_10009247 3300031344 Bacteria 9073
693 Ga0265316_10010940 3300031344 Bacteria 8236
694 Ga0265316_10013105 3300031344 Bacteria 7388
695 Ga0265316_10013551 3300031344 Bacteria 7235
696 Ga0265316_10029090 3300031344 Bacteria 4548
697 Ga0265316_10029993 3300031344 Bacteria 4465
698 Ga0265316_10050246 3300031344 Bacteria 3280
699 Ga0307509_10227982 3300031507 Bacteria 1669
700 Ga0307408_100017695 3300031548 Bacteria 4774
701 Ga0265313_10008047 3300031595 Bacteria 7062
702 Ga0265313_10017232 3300031595 Bacteria 4114
703 Ga0265314_10000005 3300031711 Bacteria 668532
704 Ga0265314_10005337 3300031711 Bacteria 11620
705 Ga0265314_10008097 3300031711 Bacteria 9046
706 Ga0265314_10016579 3300031711 Bacteria 5813
707 Ga0265342_10000198 3300031712 Bacteria 67185
708 Ga0265342_10003025 3300031712 Bacteria 14081
709 Ga0265342_10021252 3300031712 Bacteria 4148
710 Ga0307405_10033555 3300031731 Bacteria 3046
711 Ga0307410_10005364 3300031852 Bacteria 6780
712 Ga0307410_10015059 3300031852 Bacteria 4575
713 Ga0307410_10101587 3300031852 Bacteria 2062
714 Ga0307406_10026117 3300031901 Bacteria 3503
715 Ga0307407_10033504 3300031903 Bacteria 2804
716 Ga0307409_100001703 3300031995 Bacteria 11079
717 Ga0307409_100018582 3300031995 Bacteria 4679
718 Ga0307416_100018090 3300032002 Bacteria 4954
719 Ga0307416_100262449 3300032002 Bacteria 1689
720 Ga0307411_10035413 3300032005 Bacteria 3117
721 Ga0307415_100002586 3300032126 Bacteria 9041
722 Ga0307415_100033357 3300032126 Bacteria 3342
723 Ga0373926_0000639 3300035083 Bacteria 9547
724 Ga0373926_0003830 3300035083 Bacteria 4909
725 Ga0373934_0033772 3300035086 Unclassified 2009
726 Ga0373945_0000689 3300035116 Bacteria 9757
727 Ga0373945_0010362 3300035116 Bacteria 3069
728 Ga0373954_0000077 3300035118 Bacteria 34839
729 Ga0373954_0035045 3300035118 Bacteria 2326
730 Ga0373956_0017945 3300035119 Bacteria 2992
731 Ga0373943_0001752 3300035170 Bacteria 9835
732 Ga0373943_0022494 3300035170 Bacteria 2922
733 Ga0373943_0058038 3300035170 Bacteria 1925
734 Ga0373955_0000687 3300035172 Bacteria 14493
735 Ga0373924_0000013 3300035410 Bacteria 44442
736 Ga0373924_0003866 3300035410 Bacteria 5187
737 Ga0373931_0019390 3300035691 Unclassified 3394
738 Ga0373931_0022951 3300035691 Bacteria 3145
739 Ga0373931_0073740 3300035691 Bacteria 1868
740 Ga0373935_0003050 3300035692 Bacteria 9653
741 Ga0373935_0017559 3300035692 Bacteria 4344
742 Ga0373935_0055161 3300035692 Bacteria 2532
743 Ga0373935_0105593 3300035692 Bacteria 1863
744 Ga0373935_0159956 3300035692 Bacteria 1534
745 Ga0373927_0000229 3300035695 Bacteria 44230
746 Ga0373927_0000606 3300035695 Bacteria 27312
747 Ga0373927_0001417 3300035695 Bacteria 18085
748 Ga0373927_0002438 3300035695 Bacteria 13565
749 Ga0373927_0007985 3300035695 Bacteria 7146
750 Ga0373927_0022195 3300035695 Bacteria 4158
751 Ga0373927_0024567 3300035695 Bacteria 3940
752 Ga0373927_0043550 3300035695 Bacteria 2906
753 Ga0373927_0066982 3300035695 Bacteria 2323
754 Ga0373927_0096724 3300035695 Bacteria 1919
755 Ga0373933_0000287 3300035724 Bacteria 32577
756 Ga0373933_0006936 3300035724 Bacteria 6175
757 Ga0373933_0011398 3300035724 Unclassified 4898
758 Ga0373947_0002512 3300035725 Bacteria 11024
759 Ga0373947_0003698 3300035725 Bacteria 9029
760 Ga0373947_0008247 3300035725 Bacteria 6005
761 Ga0373947_0009478 3300035725 Bacteria 5592
762 Ga0373947_0011145 3300035725 Bacteria 5162
763 Ga0373937_0000024 3300036401 Bacteria 125736
764 Ga0373937_0000710 3300036401 Bacteria 29065
765 Ga0373937_0000745 3300036401 Bacteria 28106
766 Ga0373937_0010271 3300036401 Bacteria 8172
767 Ga0373937_0018028 3300036401 Bacteria 6297
768 Ga0373937_0025815 3300036401 Bacteria 5306
769 Ga0373937_0028291 3300036401 Bacteria 5071
770 Ga0373937_0031107 3300036401 Bacteria 4834
771 Ga0373937_0042155 3300036401 Bacteria 4164
772 Ga0373937_0066585 3300036401 Bacteria 3318
773 Ga0373937_0109622 3300036401 Bacteria 2567
774 Ga0373937_0122520 3300036401 Unclassified 2424
775 Ga0373925_0000953 3300037068 Bacteria 26333
776 Ga0373925_0003052 3300037068 Bacteria 13161
777 Ga0373925_0004519 3300037068 Bacteria 10512
778 Ga0373925_0019431 3300037068 Bacteria 4941
779 Ga0373925_0021613 3300037068 Bacteria 4690
780 Ga0373925_0026887 3300037068 Bacteria 4212
781 Ga0373925_0110317 3300037068 Bacteria 2124
782 Ga0395899_0001775 3300037312 Bacteria 17874
783 Ga0395899_0015128 3300037312 Bacteria 5882
784 Ga0395900_0016063 3300037418 Bacteria 7629
785 Ga0395900_0031919 3300037418 Bacteria 5414
786 Ga0395900_0048436 3300037418 Bacteria 4377
787 Ga0395900_0065195 3300037418 Bacteria 3741
788 Ga0395900_0086386 3300037418 Bacteria 3224
789 Ga0395898_0013397 3300037466 Bacteria 8446
790 Ga0395898_0017277 3300037466 Bacteria 7368
791 Ga0395898_0103515 3300037466 Bacteria 2731
792 Ga0395905_0005295 3300037471 Bacteria 13192
793 Ga0395905_0010943 3300037471 Bacteria 8780
794 Ga0395905_0014235 3300037471 Bacteria 7599
795 Ga0395905_0036111 3300037471 Bacteria 4642
796 Ga0395905_0060017 3300037471 Bacteria 3556
797 Ga0395905_0077115 3300037471 Bacteria 3123
798 Ga0395905_0268781 3300037471 Unclassified 1591
799 Ga0436364_0241550 3300037853 Bacteria 8281
800 Ga0436364_0276770 3300037853 Bacteria 13390
801 Ga0436364_0355922 3300037853 Bacteria 1986
802 Ga0436364_0417295 3300037853 Unclassified 3252
803 Ga0436364_0970590 3300037853 Bacteria 7180
804 Ga0436364_1507696 3300037853 Bacteria 3797
805 Ga0395901_0003206 3300038443 Bacteria 16466
806 Ga0395901_0054168 3300038443 Bacteria 4168
807 Ga0395901_0120517 3300038443 Bacteria 2757
808 Ga0436365_0018965 3300039437 Unclassified 13863
809 Ga0436365_1500819 3300039437 Bacteria 8861
810 Ga0436360_0493754 3300039438 Bacteria 5141
811 Ga0436360_0894906 3300039438 Bacteria 3613
812 Ga0436360_1147104 3300039438 Bacteria 1887
813 Ga0436361_0450174 3300039447 Unclassified 15259
814 Ga0436361_0588977 3300039447 Bacteria 11782
815 Ga0436361_1150168 3300039447 Bacteria 5007
816 Ga0436363_0128523 3300039450 Bacteria 2388
817 Ga0436363_0468839 3300039450 Unclassified 1767
818 Ga0436363_0490604 3300039450 Bacteria 3014
819 Ga0436363_1030894 3300039450 Bacteria 2302
820 Ga0436362_0157251 3300039453 Unclassified 2131
821 Ga0436362_0488805 3300039453 Bacteria 2728
822 Ga0436362_0746214 3300039453 Bacteria 4135
823 Ga0436362_0800997 3300039453 Bacteria 1653
824 Ga0451577_0020518 3300042876 Bacteria 6063
825 Ga0451577_0027032 3300042876 Bacteria 5195
826 Ga0451577_0076000 3300042876 Bacteria 2995
827 Ga0451577_0083059 3300042876 Bacteria 2858
828 Ga0451577_0162081 3300042876 Bacteria 2014
829 Ga0453683_0001369 3300044673 Bacteria 21235
830 Ga0453683_0008848 3300044673 Bacteria 6739
831 Ga0453683_0020206 3300044673 Bacteria 4256
832 Ga0453683_0035438 3300044673 Bacteria 3144
833 Ga0453683_0037800 3300044673 Bacteria 3036
834 Ga0453683_0070327 3300044673 Unclassified 2189
835 Ga0466966_0089449 3300044684 Bacteria 1913
836 Ga0466963_0005365 3300044694 Bacteria 7501
837 Ga0466963_0090797 3300044694 Unclassified 2080
838 Ga0453684_0000104 3300044712 Bacteria 365431
839 Ga0453684_0001621 3300044712 Bacteria 61550
840 Ga0453684_0035050 3300044712 Bacteria 6948
841 Ga0453684_0043015 3300044712 Bacteria 6078
842 Ga0453684_0055051 3300044712 Bacteria 5174
843 Ga0466957_0000974 3300044842 Bacteria 14704
844 Ga0466960_0000015 3300044901 Bacteria 56297
845 Ga0466959_0004808 3300045049 Bacteria 9122
846 Ga0451576_0000238 3300045051 Bacteria 134437
847 Ga0451576_0005414 3300045051 Bacteria 16026
848 Ga0451576_0019624 3300045051 Bacteria 7377
849 Ga0451576_0020838 3300045051 Bacteria 7135
850 Ga0451576_0036712 3300045051 Bacteria 5193
851 Ga0451576_0108337 3300045051 Bacteria 2891
852 Ga0451576_0185158 3300045051 Bacteria 2174
853 Ga0466958_0019165 3300045836 Bacteria 3980
854 Ga0466958_0072896 3300045836 Bacteria 2103
855 Ga0466958_0104500 3300045836 Bacteria 1764
856 Ga0466958_0142049 3300045836 Unclassified 1512
857 Ga0466967_0002322 3300045976 Bacteria 11760
858 Ga0466967_0004336 3300045976 Bacteria 9540
859 Ga0466967_0005756 3300045976 Bacteria 8657
860 Ga0466967_0035956 3300045976 Unclassified 4223
861 Ga0466967_0043551 3300045976 Bacteria 3887
862 Ga0466967_0101614 3300045976 Bacteria 2629
863 Ga0495603_0031958 3300046455 Unclassified 3168
864 Ga0495629_0097478 3300046459 Unclassified 2051
865 Ga0495651_0000483 3300046462 Bacteria 30682
866 Ga0495651_0003398 3300046462 Bacteria 12207
867 Ga0495651_0007790 3300046462 Bacteria 8195
868 Ga0495651_0014639 3300046462 Bacteria 6065
869 Ga0495651_0035063 3300046462 Bacteria 3908
870 Ga0495651_0080954 3300046462 Bacteria 2452
871 Ga0495653_0017598 3300046463 Bacteria 5812
872 Ga0495653_0030123 3300046463 Bacteria 4326
873 Ga0495580_0000712 3300046472 Bacteria 28388
874 Ga0495580_0000971 3300046472 Bacteria 25127
875 Ga0495580_0001294 3300046472 Bacteria 22084
876 Ga0495580_0001612 3300046472 Bacteria 19846
877 Ga0495580_0001982 3300046472 Bacteria 18009
878 Ga0495580_0002563 3300046472 Bacteria 15832
879 Ga0495580_0003645 3300046472 Bacteria 13046
880 Ga0495580_0006797 3300046472 Bacteria 9269
881 Ga0495580_0013580 3300046472 Bacteria 6211
882 Ga0495580_0032486 3300046472 Bacteria 3767
883 Ga0495580_0036215 3300046472 Bacteria 3544
884 Ga0495580_0042789 3300046472 Unclassified 3225
885 Ga0495580_0046976 3300046472 Bacteria 3061
886 Ga0495580_0048939 3300046472 Bacteria 2991
887 Ga0495580_0075779 3300046472 Unclassified 2346
888 Ga0495580_0086663 3300046472 Bacteria 2181
889 Ga0495580_0096718 3300046472 Bacteria 2053
890 Ga0495582_0000935 3300046473 Bacteria 16295
891 Ga0495582_0010825 3300046473 Bacteria 5021
892 Ga0495582_0027354 3300046473 Bacteria 3125
893 Ga0495639_0011733 3300046475 Bacteria 3779
894 Ga0495639_0013469 3300046475 Bacteria 3532
895 Ga0495664_0030843 3300046477 Unclassified 3141
896 Ga0495664_0055732 3300046477 Bacteria 2352
897 Ga0495664_0082941 3300046477 Bacteria 1923
898 Ga0495585_0040378 3300046492 Bacteria 2620
899 Ga0495608_0012719 3300046511 Bacteria 5839
900 Ga0495608_0013095 3300046511 Bacteria 5756
901 Ga0495608_0080312 3300046511 Bacteria 2120
902 Ga0495608_0114762 3300046511 Bacteria 1729
903 Ga0495628_0066798 3300046516 Unclassified 2810
904 Ga0495628_0186761 3300046516 Bacteria 1566
905 Ga0495630_0045494 3300046517 Bacteria 3280
906 Ga0495630_0056482 3300046517 Bacteria 2942
907 Ga0495663_0023163 3300046525 Bacteria 1798
908 Ga0495652_0001580 3300046529 Bacteria 24905
909 Ga0495665_0036323 3300046531 Bacteria 2631
910 Ga0495665_0052278 3300046531 Bacteria 2163
911 Ga0495640_0014363 3300046533 Bacteria 5997
912 Ga0495640_0050243 3300046533 Bacteria 2874
913 Ga0495640_0068504 3300046533 Bacteria 2388
914 Ga0495640_0147676 3300046533 Bacteria 1512
915 Ga0495586_0002925 3300046535 Bacteria 9216
916 Ga0495586_0098921 3300046535 Bacteria 1617
917 Ga0495587_0011615 3300046536 Bacteria 5575
918 Ga0495587_0016792 3300046536 Bacteria 4550
919 Ga0495587_0057958 3300046536 Unclassified 2276
920 Ga0495645_0015193 3300046543 Bacteria 5474
921 Ga0495645_0070936 3300046543 Bacteria 2513
922 Ga0495667_0010060 3300046559 Bacteria 6404
923 Ga0495667_0016733 3300046559 Bacteria 4953
924 Ga0495667_0062077 3300046559 Bacteria 2449
925 Ga0495656_0000002 3300046615 Bacteria 353040
926 Ga0495634_0009931 3300046642 Bacteria 6995
927 Ga0495635_0006902 3300046663 Bacteria 7933
928 Ga0495635_0049476 3300046663 Bacteria 2897
929 Ga0495659_0018109 3300046664 Bacteria 2342
930 Ga0495657_0087142 3300046675 Bacteria 2009
931 Ga0495599_0021040 3300046678 Bacteria 4067
932 Ga0495623_0021469 3300046679 Bacteria 4168
933 Ga0495623_0029839 3300046679 Bacteria 3509
934 Ga0495623_0033786 3300046679 Bacteria 3282
935 Ga0495623_0035702 3300046679 Bacteria 3186
936 Ga0495623_0067663 3300046679 Bacteria 2229
937 Ga0495646_0083944 3300046680 Bacteria 1850
938 Ga0495658_0000540 3300046683 Bacteria 20594
939 Ga0495658_0020894 3300046683 Bacteria 3444
940 Ga0495658_0023244 3300046683 Bacteria 3289
941 Ga0495613_0018653 3300046689 Bacteria 5174
942 Ga0495670_0061166 3300046691 Bacteria 1893
943 Ga0495600_0012917 3300046809 Bacteria 5234
944 Ga0495600_0058742 3300046809 Unclassified 2513
945 Ga0495581_0053440 3300047315 Bacteria 2333
946 Ga0495581_0071932 3300047315 Unclassified 2001
947 Ga0495604_0000452 3300047317 Bacteria 36453
948 Ga0495604_0001339 3300047317 Bacteria 20145
949 Ga0495604_0006109 3300047317 Bacteria 9559
950 Ga0495604_0037475 3300047317 Bacteria 3818
951 Ga0495604_0048518 3300047317 Unclassified 3303
952 Ga0495604_0050084 3300047317 Bacteria 3244
953 Ga0495604_0084559 3300047317 Bacteria 2369
954 Ga0495674_0002425 3300047319 Bacteria 18234
955 Ga0495674_0019513 3300047319 Bacteria 6289
956 Ga0495674_0020084 3300047319 Bacteria 6191
957 Ga0495674_0022349 3300047319 Bacteria 5834
958 Ga0495676_0014185 3300047321 Bacteria 7134
959 Ga0495680_0000269 3300047322 Bacteria 57801
960 Ga0495680_0004322 3300047322 Bacteria 13617
961 Ga0495680_0011815 3300047322 Bacteria 7712
962 Ga0495675_0003525 3300047444 Bacteria 9435
963 Ga0495675_0006374 3300047444 Bacteria 7221
964 Ga0495675_0010654 3300047444 Bacteria 5749
965 Ga0495684_0002555 3300047471 Bacteria 14482
966 Ga0495684_0004914 3300047471 Bacteria 10432
967 Ga0495684_0014038 3300047471 Bacteria 6161
968 Ga0495684_0022713 3300047471 Bacteria 4825
969 Ga0495684_0067205 3300047471 Bacteria 2726
970 Ga0495684_0104348 3300047471 Bacteria 2142
971 Ga0495684_0118669 3300047471 Bacteria 1993
972 Ga0495593_0011035 3300047673 Bacteria 5200
973 Ga0495593_0019942 3300047673 Bacteria 3755
974 Ga0495602_0000047 3300048088 Bacteria 117038
975 Ga0495602_0004407 3300048088 Bacteria 14694
976 Ga0495602_0007044 3300048088 Bacteria 11801
977 Ga0495602_0030330 3300048088 Bacteria 5131
978 Ga0495602_0075740 3300048088 Bacteria 2855
979 Ga0496100_0140570 3300048903 Bacteria 1711
980 Ga0496101_0011571 3300048904 Bacteria 5859
981 Ga0496101_0118813 3300048904 Bacteria 1997
982 Ga0496101_0171899 3300048904 Bacteria 1666
983 Ga0496102_0021886 3300048905 Bacteria 5660
984 Ga0496102_0076778 3300048905 Bacteria 3073
985 Ga0496102_0233850 3300048905 Bacteria 1733
986 Ga0496104_0000261 3300048907 Bacteria 46523
987 Ga0496104_0002409 3300048907 Bacteria 16104
988 Ga0496104_0053724 3300048907 Bacteria 3807
989 Ga0496104_0079539 3300048907 Unclassified 3125
990 Ga0496104_0095612 3300048907 Bacteria 2842
991 Ga0496105_0000341 3300048908 Bacteria 30641
992 Ga0496105_0110999 3300048908 Bacteria 2263
993 Ga0496106_0073086 3300048909 Bacteria 2623
994 Ga0496106_0125822 3300048909 Bacteria 2007
995 Ga0496107_0051754 3300048910 Bacteria 2963
996 Ga0496108_0000228 3300048911 Bacteria 50279
997 Ga0496108_0042304 3300048911 Bacteria 3803
998 Ga0496108_0063777 3300048911 Bacteria 3103
999 Ga0496109_0000301 3300048912 Bacteria 46624
1000 Ga0496109_0000362 3300048912 Bacteria 42175
1001 Ga0496109_0050777 3300048912 Bacteria 3776
1002 Ga0496110_0000221 3300048913 Bacteria 36767
1003 Ga0496110_0001221 3300048913 Bacteria 18300
1004 Ga0496110_0020704 3300048913 Bacteria 5555
1005 Ga0496111_0000943 3300048914 Bacteria 15888
1006 Ga0496111_0002551 3300048914 Bacteria 11006
1007 Ga0496111_0005463 3300048914 Bacteria 8147
1008 Ga0496111_0017269 3300048914 Bacteria 4987
1009 Ga0496112_0000034 3300048915 Bacteria 107237
1010 Ga0496112_0002908 3300048915 Bacteria 13940
1011 Ga0496112_0003016 3300048915 Bacteria 13763
1012 Ga0496112_0005823 3300048915 Bacteria 10729
1013 Ga0496112_0025670 3300048915 Bacteria 5660
1014 Ga0496112_0037194 3300048915 Bacteria 4752
1015 Ga0496112_0046687 3300048915 Unclassified 4249
1016 Ga0496112_0078273 3300048915 Bacteria 3270
1017 Ga0496112_0084609 3300048915 Unclassified 3137
1018 Ga0496112_0086337 3300048915 Bacteria 3104
1019 Ga0496112_0279292 3300048915 Bacteria 1617
1020 Ga0496113_0007338 3300048916 Bacteria 7080
1021 Ga0496113_0018008 3300048916 Bacteria 4913
1022 Ga0496113_0096592 3300048916 Bacteria 2285
1023 Ga0496113_0108434 3300048916 Bacteria 2159
1024 Ga0496113_0151387 3300048916 Bacteria 1830
1025 Ga0496114_0000167 3300048917 Bacteria 46546
1026 Ga0496114_0002278 3300048917 Bacteria 14623
1027 Ga0496114_0024514 3300048917 Bacteria 4926
1028 Ga0496114_0178879 3300048917 Bacteria 1851
1029 Ga0496115_0004534 3300048918 Bacteria 10049
1030 Ga0496115_0042261 3300048918 Bacteria 3631
1031 Ga0496115_0042995 3300048918 Bacteria 3602
1032 Ga0496121_0002994 3300048924 Bacteria 24537
1033 Ga0501040_0054155 3300049576 Bacteria 2750
1034 Ga0501041_0079695 3300049577 Unclassified 2016
1035 Ga0501047_0095250 3300049581 Bacteria 2856
1036 Ga0501074_0002137 3300049590 Bacteria 13665
1037 Ga0501075_0086013 3300049591 Unclassified 2382
1038 Ga0501079_0118106 3300049741 Bacteria 2062
1039 Ga0501080_0011210 3300049742 Bacteria 8206
1040 Ga0501080_0079678 3300049742 Bacteria 3045
1041 nmdc:mga05p37_133052_c1 3300050507 Bacteria 3050
1042 nmdc:mga05p37_13546_c1 3300050507 Bacteria 9777
1043 nmdc:mga05p37_172422_c1 3300050507 Bacteria 2638
1044 nmdc:mga05p37_67917_c1 3300050507 Bacteria 4385
1045 nmdc:mga05p37_72479_c1 3300050507 Unclassified 4238
1046 nmdc:mga05p37_78461_c1 3300050507 Unclassified 4066
1047 nmdc:mga09592_137932_c1 3300050508 Bacteria 2101
1048 nmdc:mga09592_58368_c1 3300050508 Bacteria 3263
1049 nmdc:mga0qj67_139529_c1 3300050509 Bacteria 1965
1050 nmdc:mga0qj67_22712_c2 3300050509 Bacteria 4020
1051 nmdc:mga0qj67_4451_c1 3300050509 Bacteria 10149
1052 nmdc:mga06r32_16001_c1 3300050510 Bacteria 6826
1053 nmdc:mga06r32_32375_c1 3300050510 Bacteria 4918
1054 nmdc:mga06r32_696_c1 3300050510 Bacteria 29344
1055 nmdc:mga08y16_2037_c1 3300050511 Bacteria 20715
1056 nmdc:mga0n895_105797_c1 3300050512 Bacteria 2826
1057 nmdc:mga0n895_152933_c1 3300050512 Bacteria 2338
1058 nmdc:mga0n895_177692_c1 3300050512 Bacteria 2160
1059 nmdc:mga0n895_32644_c1 3300050512 Bacteria 4998
1060 nmdc:mga0n895_408_c1 3300050512 Bacteria 28760
1061 nmdc:mga0n895_4619_c1 3300050512 Bacteria 11353
1062 nmdc:mga0n895_47_c1 3300050512 Bacteria 73703
1063 nmdc:mga0n895_5144_c1 3300050512 Bacteria 10877
1064 nmdc:mga0n895_82072_c1 3300050512 Bacteria 3213
1065 nmdc:mga0n895_9908_c1 3300050512 Bacteria 8381
1066 nmdc:mga0rr50_111418_c1 3300050513 Bacteria 2166
1067 nmdc:mga0rr50_175833_c1 3300050513 Bacteria 1747
1068 nmdc:mga0rr50_44127_c1 3300050513 Bacteria 3268
1069 nmdc:mga0rr50_52457_c1 3300050513 Bacteria 3031
1070 nmdc:mga0rr50_56863_c1 3300050513 Bacteria 2924
1071 nmdc:mga0rr50_74925_c1 3300050513 Bacteria 2592
1072 nmdc:mga0rr50_99_c1 3300050513 Bacteria 48440
1073 nmdc:mga08x19_1089_c1 3300050514 Bacteria 16941
1074 nmdc:mga08x19_23700_c1 3300050514 Bacteria 3809
1075 nmdc:mga08x19_30070_c1 3300050514 Unclassified 3410
1076 nmdc:mga08x19_3030_c1 3300050514 Bacteria 10099
1077 nmdc:mga08x19_45121_c1 3300050514 Bacteria 2816
1078 nmdc:mga08x19_4715_c1 3300050514 Bacteria 8084
1079 nmdc:mga08x19_58316_c1 3300050514 Bacteria 2497
1080 nmdc:mga08x19_7303_c1 3300050514 Bacteria 6561
1081 nmdc:mga08x19_7696_c1 3300050514 Bacteria 6397
1082 nmdc:mga08x19_8659_c1 3300050514 Bacteria 6066
1083 nmdc:mga08x19_9158_c1 3300050514 Bacteria 5909
1084 nmdc:mga0a205_126628_c1 3300050515 Bacteria 2454
1085 nmdc:mga0a205_1652_c1 3300050515 Bacteria 19181
1086 nmdc:mga0a205_23451_c1 3300050515 Bacteria 5854
1087 nmdc:mga0a205_25783_c1 3300050515 Unclassified 2591
1088 nmdc:mga0a205_40_c1 3300050515 Bacteria 71613
1089 Ga0495601_0002873 3300053077 Bacteria 9800
1090 Ga0501084_0045664 3300054114 Bacteria 3668
1091 Ga0501082_0001747 3300060353 Bacteria 19150
1092 Ga0501082_0244714 3300060353 Bacteria 1561
1093 Ga0530510_0119800 3300061734 Unclassified 1931

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10201088 Ga0105240_102010882 409
2 3300039450 Ga0436363_0468839 Ga0436363_0468839_70_1299 409
3 3300048904 Ga0496101_0118813 Ga0496101_0118813_403_1839 443
4 3300048909 Ga0496106_0073086 Ga0496106_0073086_741_2177 443
5 3300048913 Ga0496110_0020704 Ga0496110_0020704_350_1786 443
6 3300048907 Ga0496104_0053724 Ga0496104_0053724_1505_2914 444
7 3300048911 Ga0496108_0042304 Ga0496108_0042304_1204_2613 444
8 3300048912 Ga0496109_0050777 Ga0496109_0050777_782_2191 444
9 3300005530 Ga0070679_100143669 Ga0070679_1001436692 445
10 3300028800 Ga0265338_10012494 Ga0265338_100124943 445
11 3300031344 Ga0265316_10009247 Ga0265316_100092476 445
12 3300037418 Ga0395900_0031919 Ga0395900_0031919_1897_3360 445
13 3300005985 Ga0081539_10008689 Ga0081539_1000868912 447
14 3300014968 Ga0157379_10005382 Ga0157379_100053828 447
15 3300048910 Ga0496107_0051754 Ga0496107_0051754_276_1721 448
16 3300048917 Ga0496114_0178879 Ga0496114_0178879_52_1488 448
17 3300037312 Ga0395899_0015128 Ga0395899_0015128_785_2218 449
18 3300037418 Ga0395900_0016063 Ga0395900_0016063_3219_4652 449
19 3300037466 Ga0395898_0017277 Ga0395898_0017277_3598_5031 449
20 3300037471 Ga0395905_0014235 Ga0395905_0014235_3435_4868 449
21 3300038443 Ga0395901_0054168 Ga0395901_0054168_398_1831 449
22 3300048088 Ga0495602_0075740 Ga0495602_0075740_311_1705 449
23 3300050509 nmdc:mga0qj67_139529_c1 nmdc:mga0qj67_139529_c1_428_1891 449
24 3300005445 Ga0070708_100044091 Ga0070708_1000440912 452
25 3300005467 Ga0070706_100000063 Ga0070706_10000006397 452
26 3300025910 Ga0207684_10000018 Ga0207684_10000018180 452
27 3300048904 Ga0496101_0011571 Ga0496101_0011571_1454_2899 453
28 3300048907 Ga0496104_0000261 Ga0496104_0000261_19694_21139 453
29 3300048908 Ga0496105_0000341 Ga0496105_0000341_5169_6614 453
30 3300048911 Ga0496108_0063777 Ga0496108_0063777_1463_2908 453
31 3300048912 Ga0496109_0000301 Ga0496109_0000301_21766_23211 453
32 3300048913 Ga0496110_0000221 Ga0496110_0000221_13631_15076 453
33 3300048914 Ga0496111_0000943 Ga0496111_0000943_8701_10146 453
34 3300048917 Ga0496114_0000167 Ga0496114_0000167_293_1738 453
35 3300006846 Ga0075430_100038276 Ga0075430_1000382763 454
36 3300021388 Ga0213875_10037905 Ga0213875_100379052 456
37 3300039450 Ga0436363_0128523 Ga0436363_0128523_734_2104 456
38 3300037418 Ga0395900_0048436 Ga0395900_0048436_2887_4320 457
39 3300044712 Ga0453684_0043015 Ga0453684_0043015_549_1988 458
40 3300044901 Ga0466960_0000015 Ga0466960_0000015_34018_35478 458
41 3300005365 Ga0070688_100010707 Ga0070688_1000107074 459
42 3300005466 Ga0070685_10015105 Ga0070685_100151052 459
43 3300005564 Ga0070664_100158701 Ga0070664_1001587011 459
44 3300005617 Ga0068859_100008790 Ga0068859_1000087906 459
45 3300005842 Ga0068858_100001017 Ga0068858_10000101721 459
46 3300006931 Ga0097620_100008790 Ga0097620_1000087906 459
47 3300009177 Ga0105248_10046507 Ga0105248_100465072 459
48 3300014968 Ga0157379_10004974 Ga0157379_100049744 459
49 3300026035 Ga0207703_10004814 Ga0207703_100048147 459
50 3300006871 Ga0075434_100002070 Ga0075434_1000020703 460
51 3300025915 Ga0207693_10066342 Ga0207693_100663422 460
52 3300037853 Ga0436364_0276770 Ga0436364_0276770_6774_8156 460
53 3300050512 nmdc:mga0n895_9908_c1 nmdc:mga0n895_9908_c1_4120_5568 460
54 3300005329 Ga0070683_100023082 Ga0070683_1000230825 461
55 3300005437 Ga0070710_10052095 Ga0070710_100520952 461
56 3300005535 Ga0070684_100006489 Ga0070684_1000064898 461
57 3300005543 Ga0070672_100095253 Ga0070672_1000952532 461
58 3300005614 Ga0068856_100002688 Ga0068856_10000268814 461
59 3300005616 Ga0068852_100014167 Ga0068852_1000141678 461
60 3300005985 Ga0081539_10003804 Ga0081539_1000380412 461
61 3300009098 Ga0105245_10025823 Ga0105245_100258232 461
62 3300010375 Ga0105239_10151276 Ga0105239_101512762 461
63 3300013297 Ga0157378_10243375 Ga0157378_102433751 461
64 3300013308 Ga0157375_10105183 Ga0157375_101051833 461
65 3300014745 Ga0157377_10006251 Ga0157377_100062512 461
66 3300025935 Ga0207709_10120402 Ga0207709_101204022 461
67 3300026075 Ga0207708_10005782 Ga0207708_100057822 461
68 3300026095 Ga0207676_10057830 Ga0207676_100578302 461
69 3300026121 Ga0207683_10012241 Ga0207683_100122417 461
70 3300039453 Ga0436362_0800997 Ga0436362_0800997_246_1631 461
71 3300044673 Ga0453683_0070327 Ga0453683_0070327_563_2011 461
72 3300048903 Ga0496100_0140570 Ga0496100_0140570_199_1650 461
73 3300048904 Ga0496101_0171899 Ga0496101_0171899_179_1630 461
74 3300048907 Ga0496104_0002409 Ga0496104_0002409_14051_15502 461
75 3300048909 Ga0496106_0125822 Ga0496106_0125822_110_1561 461
76 3300048914 Ga0496111_0017269 Ga0496111_0017269_3383_4834 461
77 3300048915 Ga0496112_0086337 Ga0496112_0086337_840_2291 461
78 3300005985 Ga0081539_10067069 Ga0081539_100670693 462
79 3300032002 Ga0307416_100018090 Ga0307416_1000180902 462
80 3300032126 Ga0307415_100033357 Ga0307415_1000333572 462
81 3300046455 Ga0495603_0031958 Ga0495603_0031958_1656_3044 462
82 3300046472 Ga0495580_0042789 Ga0495580_0042789_113_1501 462
83 3300046536 Ga0495587_0011615 Ga0495587_0011615_1094_2482 462
84 3300047319 Ga0495674_0020084 Ga0495674_0020084_801_2189 462
85 3300046525 Ga0495663_0023163 Ga0495663_0023163_129_1562 463
86 3300005548 Ga0070665_100001525 Ga0070665_10000152516 464
87 3300028379 Ga0268266_10000736 Ga0268266_1000073619 464
88 3300047319 Ga0495674_0022349 Ga0495674_0022349_3210_4676 464
89 3300005436 Ga0070713_100134550 Ga0070713_1001345502 465
90 3300005563 Ga0068855_100000514 Ga0068855_10000051451 465
91 3300006175 Ga0070712_100075357 Ga0070712_1000753572 465
92 3300025916 Ga0207663_10008379 Ga0207663_100083793 465
93 3300025928 Ga0207700_10111214 Ga0207700_101112142 465
94 3300025949 Ga0207667_10000103 Ga0207667_1000010331 465
95 3300038443 Ga0395901_0120517 Ga0395901_0120517_1043_2452 465
96 3300048918 Ga0496115_0042995 Ga0496115_0042995_1557_3014 465
97 3300049581 Ga0501047_0095250 Ga0501047_0095250_690_2102 466
98 3300005436 Ga0070713_100064591 Ga0070713_1000645912 467
99 3300005937 Ga0081455_10072539 Ga0081455_100725392 467
100 3300006028 Ga0070717_10067061 Ga0070717_100670613 467
101 3300025928 Ga0207700_10159460 Ga0207700_101594602 467
102 3300031090 Ga0265760_10000014 Ga0265760_1000001483 467
103 3300037418 Ga0395900_0086386 Ga0395900_0086386_1567_3021 467
104 3300037471 Ga0395905_0077115 Ga0395905_0077115_896_2350 467
105 3300048916 Ga0496113_0108434 Ga0496113_0108434_322_1779 467
106 3300005439 Ga0070711_100017670 Ga0070711_1000176702 468
107 3300025916 Ga0207663_10024515 Ga0207663_100245152 468
108 3300005468 Ga0070707_100238346 Ga0070707_1002383462 469
109 3300037471 Ga0395905_0060017 Ga0395905_0060017_672_2156 469
110 3300045976 Ga0466967_0043551 Ga0466967_0043551_2329_3768 469
111 3300048915 Ga0496112_0025670 Ga0496112_0025670_1566_2993 469
112 3300045836 Ga0466958_0072896 Ga0466958_0072896_437_1888 470
113 3300046615 Ga0495656_0000002 Ga0495656_0000002_143888_145318 470
114 3300046664 Ga0495659_0018109 Ga0495659_0018109_60_1490 470
115 3300002239 JGI24034J26672_10003488 JGI24034J26672_100034881 471
116 3300005434 Ga0070709_10005534 Ga0070709_100055345 471
117 3300005435 Ga0070714_100048825 Ga0070714_1000488254 471
118 3300005436 Ga0070713_100016994 Ga0070713_1000169947 471
119 3300005445 Ga0070708_100077925 Ga0070708_1000779252 471
120 3300005468 Ga0070707_100036034 Ga0070707_1000360342 471
121 3300005471 Ga0070698_100000002 Ga0070698_1000000022 471
122 3300005471 Ga0070698_100023346 Ga0070698_1000233464 471
123 3300005578 Ga0068854_100000010 Ga0068854_10000001042 471
124 3300005614 Ga0068856_100081384 Ga0068856_1000813842 471
125 3300006173 Ga0070716_100004195 Ga0070716_1000041955 471
126 3300020070 Ga0206356_10046556 Ga0206356_100465563 471
127 3300025906 Ga0207699_10008819 Ga0207699_100088197 471
128 3300025910 Ga0207684_10034314 Ga0207684_100343143 471
129 3300025928 Ga0207700_10000028 Ga0207700_1000002812 471
130 3300025939 Ga0207665_10005910 Ga0207665_100059107 471
131 3300025981 Ga0207640_10000004 Ga0207640_10000004308 471
132 3300035724 Ga0373933_0011398 Ga0373933_0011398_275_1741 471
133 3300048907 Ga0496104_0095612 Ga0496104_0095612_58_1488 471
134 3300050514 nmdc:mga08x19_45121_c1 nmdc:mga08x19_45121_c1_349_1815 471
135 3300005329 Ga0070683_100014041 Ga0070683_1000140418 472
136 3300005329 Ga0070683_100046567 Ga0070683_1000465672 472
137 3300005329 Ga0070683_100072735 Ga0070683_1000727352 472
138 3300005337 Ga0070682_100086313 Ga0070682_1000863132 472
139 3300005530 Ga0070679_100004339 Ga0070679_10000433914 472
140 3300005535 Ga0070684_100012044 Ga0070684_1000120448 472
141 3300005563 Ga0068855_100045845 Ga0068855_1000458454 472
142 3300005937 Ga0081455_10059710 Ga0081455_100597102 472
143 3300009098 Ga0105245_10025367 Ga0105245_100253672 472
144 3300025921 Ga0207652_10003389 Ga0207652_100033893 472
145 3300025927 Ga0207687_10002511 Ga0207687_100025117 472
146 3300025935 Ga0207709_10077835 Ga0207709_100778352 472
147 3300025944 Ga0207661_10021196 Ga0207661_100211963 472
148 3300037418 Ga0395900_0065195 Ga0395900_0065195_1904_3343 472
149 3300046492 Ga0495585_0040378 Ga0495585_0040378_145_1578 472
150 3300046691 Ga0495670_0061166 Ga0495670_0061166_312_1745 472
151 3300048917 Ga0496114_0002278 Ga0496114_0002278_9375_10820 472
152 3300053077 Ga0495601_0002873 Ga0495601_0002873_6302_7774 472
153 3300005468 Ga0070707_100000808 Ga0070707_1000008088 473
154 3300005468 Ga0070707_100125994 Ga0070707_1001259942 473
155 3300005518 Ga0070699_100005395 Ga0070699_1000053952 473
156 3300005536 Ga0070697_100009479 Ga0070697_1000094795 473
157 3300005536 Ga0070697_100041007 Ga0070697_1000410072 473
158 3300005981 Ga0081538_10026741 Ga0081538_100267415 473
159 3300025922 Ga0207646_10000001 Ga0207646_100000011028 473
160 3300025922 Ga0207646_10000006 Ga0207646_10000006451 473
161 3300025922 Ga0207646_10000017 Ga0207646_1000001734 473
162 3300025922 Ga0207646_10014287 Ga0207646_100142876 473
163 3300025922 Ga0207646_10047704 Ga0207646_100477043 473
164 3300027671 Ga0209588_1001140 Ga0209588_10011409 473
165 3300027671 Ga0209588_1002962 Ga0209588_10029622 473
166 3300035118 Ga0373954_0000077 Ga0373954_0000077_3163_4623 473
167 3300035172 Ga0373955_0000687 Ga0373955_0000687_12021_13481 473
168 3300035724 Ga0373933_0000287 Ga0373933_0000287_18532_19992 473
169 3300036401 Ga0373937_0000710 Ga0373937_0000710_24842_26302 473
170 3300042876 Ga0451577_0162081 Ga0451577_0162081_285_1724 473
171 3300045051 Ga0451576_0000238 Ga0451576_0000238_64050_65489 473
172 3300046462 Ga0495651_0007790 Ga0495651_0007790_4267_5727 473
173 3300046463 Ga0495653_0030123 Ga0495653_0030123_2806_4266 473
174 3300046511 Ga0495608_0013095 Ga0495608_0013095_1777_3237 473
175 3300046679 Ga0495623_0035702 Ga0495623_0035702_691_2151 473
176 3300047317 Ga0495604_0000452 Ga0495604_0000452_16466_17926 473
177 3300047471 Ga0495684_0004914 Ga0495684_0004914_3076_4536 473
178 3300048088 Ga0495602_0004407 Ga0495602_0004407_7762_9222 473
179 3300005345 Ga0070692_10048078 Ga0070692_100480782 474
180 3300005471 Ga0070698_100004166 Ga0070698_1000041663 474
181 3300009093 Ga0105240_10041454 Ga0105240_100414546 474
182 3300013307 Ga0157372_10000497 Ga0157372_1000049728 474
183 3300048915 Ga0496112_0279292 Ga0496112_0279292_14_1480 474
184 3300049741 Ga0501079_0118106 Ga0501079_0118106_78_1550 474
185 3300049742 Ga0501080_0079678 Ga0501080_0079678_268_1740 474
186 3300050513 nmdc:mga0rr50_175833_c1 nmdc:mga0rr50_175833_c1_219_1685 474
187 3300060353 Ga0501082_0244714 Ga0501082_0244714_27_1499 474
188 3300005435 Ga0070714_100097627 Ga0070714_1000976272 475
189 3300013307 Ga0157372_10004064 Ga0157372_1000406410 475
190 3300014969 Ga0157376_10254396 Ga0157376_102543961 475
191 3300025913 Ga0207695_10012611 Ga0207695_1001261111 475
192 3300037471 Ga0395905_0268781 Ga0395905_0268781_57_1511 475
193 3300044694 Ga0466963_0090797 Ga0466963_0090797_580_2046 475
194 3300005535 Ga0070684_100104855 Ga0070684_1001048552 476
195 3300005563 Ga0068855_100017550 Ga0068855_1000175508 476
196 3300009093 Ga0105240_10025672 Ga0105240_100256723 476
197 3300013104 Ga0157370_10007410 Ga0157370_100074103 476
198 3300020082 Ga0206353_10581244 Ga0206353_105812442 476
199 3300025909 Ga0207705_10016962 Ga0207705_100169623 476
200 3300025912 Ga0207707_10085766 Ga0207707_100857662 476
201 3300025913 Ga0207695_10102053 Ga0207695_101020532 476
202 3300025921 Ga0207652_10032119 Ga0207652_100321192 476
203 3300025944 Ga0207661_10019337 Ga0207661_100193376 476
204 3300025949 Ga0207667_10054355 Ga0207667_100543552 476
205 3300049590 Ga0501074_0002137 Ga0501074_0002137_5216_6724 476
206 3300049742 Ga0501080_0011210 Ga0501080_0011210_1576_3084 476
207 3300006844 Ga0075428_100063842 Ga0075428_1000638423 477
208 3300006846 Ga0075430_100003335 Ga0075430_1000033354 477
209 3300006846 Ga0075430_100018493 Ga0075430_1000184933 477
210 3300006847 Ga0075431_100040689 Ga0075431_1000406893 477
211 3300006847 Ga0075431_100124670 Ga0075431_1001246702 477
212 3300006847 Ga0075431_100134681 Ga0075431_1001346812 477
213 3300006852 Ga0075433_10068654 Ga0075433_100686542 477
214 3300006871 Ga0075434_100036065 Ga0075434_1000360655 477
215 3300006880 Ga0075429_100000530 Ga0075429_1000005302 477
216 3300009094 Ga0111539_10307441 Ga0111539_103074412 477
217 3300009147 Ga0114129_10308329 Ga0114129_103083292 477
218 3300025929 Ga0207664_10062443 Ga0207664_100624431 477
219 3300027907 Ga0207428_10182454 Ga0207428_101824541 477
220 3300031852 Ga0307410_10015059 Ga0307410_100150592 477
221 3300031901 Ga0307406_10026117 Ga0307406_100261172 477
222 3300031903 Ga0307407_10033504 Ga0307407_100335042 477
223 3300031995 Ga0307409_100018582 Ga0307409_1000185823 477
224 3300044684 Ga0466966_0089449 Ga0466966_0089449_111_1577 477
225 3300048915 Ga0496112_0003016 Ga0496112_0003016_11036_12481 477
226 3300048924 Ga0496121_0002994 Ga0496121_0002994_20024_21472 477
227 3300050507 nmdc:mga05p37_67917_c1 nmdc:mga05p37_67917_c1_476_1912 477
228 3300050508 nmdc:mga09592_58368_c1 nmdc:mga09592_58368_c1_1460_2896 477
229 3300050509 nmdc:mga0qj67_4451_c1 nmdc:mga0qj67_4451_c1_4592_6028 477
230 3300050510 nmdc:mga06r32_16001_c1 nmdc:mga06r32_16001_c1_4951_6387 477
231 3300050510 nmdc:mga06r32_32375_c1 nmdc:mga06r32_32375_c1_3328_4764 477
232 3300050510 nmdc:mga06r32_696_c1 nmdc:mga06r32_696_c1_2540_3976 477
233 3300050512 nmdc:mga0n895_177692_c1 nmdc:mga0n895_177692_c1_618_2054 477
234 3300050513 nmdc:mga0rr50_56863_c1 nmdc:mga0rr50_56863_c1_290_1726 477
235 3300050514 nmdc:mga08x19_23700_c1 nmdc:mga08x19_23700_c1_966_2402 477
236 3300005329 Ga0070683_100030449 Ga0070683_1000304495 478
237 3300005329 Ga0070683_100039473 Ga0070683_1000394733 478
238 3300005336 Ga0070680_100005314 Ga0070680_1000053142 478
239 3300005434 Ga0070709_10000415 Ga0070709_1000041513 478
240 3300005435 Ga0070714_100020121 Ga0070714_1000201214 478
241 3300005435 Ga0070714_100088528 Ga0070714_1000885282 478
242 3300005468 Ga0070707_100000815 Ga0070707_10000081521 478
243 3300006871 Ga0075434_100035108 Ga0075434_1000351083 478
244 3300006871 Ga0075434_100047370 Ga0075434_1000473702 478
245 3300006871 Ga0075434_100257451 Ga0075434_1002574512 478
246 3300006880 Ga0075429_100141745 Ga0075429_1001417452 478
247 3300007076 Ga0075435_100161802 Ga0075435_1001618021 478
248 3300009147 Ga0114129_10000075 Ga0114129_1000007566 478
249 3300009147 Ga0114129_10040059 Ga0114129_100400594 478
250 3300009147 Ga0114129_10341170 Ga0114129_103411702 478
251 3300015262 Ga0182007_10017164 Ga0182007_100171642 478
252 3300020082 Ga0206353_12057544 Ga0206353_120575442 478
253 3300025906 Ga0207699_10000059 Ga0207699_1000005976 478
254 3300025921 Ga0207652_10075593 Ga0207652_100755932 478
255 3300025922 Ga0207646_10008098 Ga0207646_100080984 478
256 3300028800 Ga0265338_10019564 Ga0265338_100195642 478
257 3300031241 Ga0265325_10002766 Ga0265325_100027664 478
258 3300036401 Ga0373937_0025815 Ga0373937_0025815_270_1709 478
259 3300048907 Ga0496104_0079539 Ga0496104_0079539_698_2137 478
260 3300050507 nmdc:mga05p37_13546_c1 nmdc:mga05p37_13546_c1_6596_8035 478
261 3300050507 nmdc:mga05p37_172422_c1 nmdc:mga05p37_172422_c1_29_1468 478
262 3300050507 nmdc:mga05p37_72479_c1 nmdc:mga05p37_72479_c1_1947_3386 478
263 3300050507 nmdc:mga05p37_78461_c1 nmdc:mga05p37_78461_c1_2287_3726 478
264 3300050512 nmdc:mga0n895_105797_c1 nmdc:mga0n895_105797_c1_228_1667 478
265 3300050512 nmdc:mga0n895_32644_c1 nmdc:mga0n895_32644_c1_2506_3966 478
266 3300050515 nmdc:mga0a205_25783_c1 nmdc:mga0a205_25783_c1_971_2410 478
267 3300005458 Ga0070681_10157790 Ga0070681_101577902 479
268 3300032002 Ga0307416_100262449 Ga0307416_1002624492 479
269 3300044712 Ga0453684_0001621 Ga0453684_0001621_46821_48263 479
270 3300005535 Ga0070684_100155719 Ga0070684_1001557192 480
271 3300005564 Ga0070664_100206070 Ga0070664_1002060702 480
272 3300005578 Ga0068854_100085082 Ga0068854_1000850822 480
273 3300005841 Ga0068863_100027217 Ga0068863_1000272177 480
274 3300037471 Ga0395905_0005295 Ga0395905_0005295_1805_3271 480
275 3300037471 Ga0395905_0010943 Ga0395905_0010943_2898_4370 480
276 3300046472 Ga0495580_0086663 Ga0495580_0086663_63_1523 480
277 3300049576 Ga0501040_0054155 Ga0501040_0054155_733_2232 480
278 3300049577 Ga0501041_0079695 Ga0501041_0079695_236_1735 480
279 3300049591 Ga0501075_0086013 Ga0501075_0086013_340_1839 480
280 3300061734 Ga0530510_0119800 Ga0530510_0119800_93_1592 480
281 3300005341 Ga0070691_10013656 Ga0070691_100136562 481
282 3300005435 Ga0070714_100006221 Ga0070714_1000062216 481
283 3300005435 Ga0070714_100037113 Ga0070714_1000371132 481
284 3300005455 Ga0070663_100026331 Ga0070663_1000263313 481
285 3300005563 Ga0068855_100013304 Ga0068855_1000133045 481
286 3300006175 Ga0070712_100052070 Ga0070712_1000520702 481
287 3300009093 Ga0105240_10229670 Ga0105240_102296702 481
288 3300013296 Ga0157374_10247418 Ga0157374_102474182 481
289 3300021358 Ga0213873_10006723 Ga0213873_100067232 481
290 3300021384 Ga0213876_10002859 Ga0213876_100028592 481
291 3300025906 Ga0207699_10124858 Ga0207699_101248581 481
292 3300025913 Ga0207695_10165806 Ga0207695_101658062 481
293 3300025929 Ga0207664_10014549 Ga0207664_100145494 481
294 3300025929 Ga0207664_10065469 Ga0207664_100654692 481
295 3300025949 Ga0207667_10000669 Ga0207667_1000066944 481
296 3300026142 Ga0207698_10041191 Ga0207698_100411913 481
297 3300031235 Ga0265330_10000124 Ga0265330_1000012426 481
298 3300031238 Ga0265332_10000212 Ga0265332_1000021234 481
299 3300031242 Ga0265329_10001260 Ga0265329_1000126010 481
300 3300031344 Ga0265316_10000007 Ga0265316_1000000772 481
301 3300031711 Ga0265314_10000005 Ga0265314_10000005360 481
302 3300031712 Ga0265342_10003025 Ga0265342_100030258 481
303 3300037312 Ga0395899_0001775 Ga0395899_0001775_5887_7338 481
304 3300037466 Ga0395898_0103515 Ga0395898_0103515_75_1526 481
305 3300037853 Ga0436364_0241550 Ga0436364_0241550_5815_7266 481
306 3300038443 Ga0395901_0003206 Ga0395901_0003206_9813_11264 481
307 3300039437 Ga0436365_0018965 Ga0436365_0018965_4307_5758 481
308 3300039438 Ga0436360_0493754 Ga0436360_0493754_890_2341 481
309 3300039438 Ga0436360_1147104 Ga0436360_1147104_423_1874 481
310 3300039447 Ga0436361_0450174 Ga0436361_0450174_7309_8760 481
311 3300039447 Ga0436361_0588977 Ga0436361_0588977_4463_5914 481
312 3300039447 Ga0436361_1150168 Ga0436361_1150168_2140_3591 481
313 3300039453 Ga0436362_0157251 Ga0436362_0157251_412_1863 481
314 3300045836 Ga0466958_0019165 Ga0466958_0019165_1834_3285 481
315 3300045976 Ga0466967_0002322 Ga0466967_0002322_9222_10673 481
316 3300045976 Ga0466967_0101614 Ga0466967_0101614_329_1780 481
317 3300005334 Ga0068869_100167945 Ga0068869_1001679452 482
318 3300005434 Ga0070709_10008424 Ga0070709_100084245 482
319 3300005434 Ga0070709_10083938 Ga0070709_100839382 482
320 3300005445 Ga0070708_100242697 Ga0070708_1002426971 482
321 3300005468 Ga0070707_100055862 Ga0070707_1000558623 482
322 3300005536 Ga0070697_100031784 Ga0070697_1000317842 482
323 3300005546 Ga0070696_100016914 Ga0070696_1000169143 482
324 3300005546 Ga0070696_100078062 Ga0070696_1000780621 482
325 3300005546 Ga0070696_100089507 Ga0070696_1000895072 482
326 3300006846 Ga0075430_100047424 Ga0075430_1000474242 482
327 3300006852 Ga0075433_10003804 Ga0075433_100038043 482
328 3300006852 Ga0075433_10022629 Ga0075433_100226293 482
329 3300006871 Ga0075434_100000140 Ga0075434_10000014017 482
330 3300006914 Ga0075436_100024752 Ga0075436_1000247523 482
331 3300006914 Ga0075436_100124548 Ga0075436_1001245481 482
332 3300007076 Ga0075435_100002553 Ga0075435_1000025534 482
333 3300009094 Ga0111539_10000378 Ga0111539_1000037814 482
334 3300021358 Ga0213873_10010471 Ga0213873_100104712 482
335 3300025906 Ga0207699_10006411 Ga0207699_100064115 482
336 3300025922 Ga0207646_10061057 Ga0207646_100610572 482
337 3300026089 Ga0207648_10073743 Ga0207648_100737432 482
338 3300027907 Ga0207428_10001476 Ga0207428_100014766 482
339 3300031548 Ga0307408_100017695 Ga0307408_1000176953 482
340 3300031731 Ga0307405_10033555 Ga0307405_100335553 482
341 3300031852 Ga0307410_10005364 Ga0307410_100053643 482
342 3300031852 Ga0307410_10101587 Ga0307410_101015872 482
343 3300031995 Ga0307409_100001703 Ga0307409_1000017033 482
344 3300032005 Ga0307411_10035413 Ga0307411_100354133 482
345 3300032126 Ga0307415_100002586 Ga0307415_1000025863 482
346 3300039438 Ga0436360_0894906 Ga0436360_0894906_1225_2679 482
347 3300039453 Ga0436362_0488805 Ga0436362_0488805_70_1524 482
348 3300042876 Ga0451577_0020518 Ga0451577_0020518_1657_3105 482
349 3300044673 Ga0453683_0020206 Ga0453683_0020206_348_1811 482
350 3300044712 Ga0453684_0035050 Ga0453684_0035050_4048_5496 482
351 3300045051 Ga0451576_0005414 Ga0451576_0005414_11140_12603 482
352 3300045051 Ga0451576_0020838 Ga0451576_0020838_4365_5813 482
353 3300046462 Ga0495651_0080954 Ga0495651_0080954_767_2215 482
354 3300046477 Ga0495664_0030843 Ga0495664_0030843_1576_3024 482
355 3300046516 Ga0495628_0066798 Ga0495628_0066798_341_1789 482
356 3300046543 Ga0495645_0015193 Ga0495645_0015193_455_1903 482
357 3300046809 Ga0495600_0058742 Ga0495600_0058742_878_2326 482
358 3300050508 nmdc:mga09592_137932_c1 nmdc:mga09592_137932_c1_152_1600 482
359 3300050509 nmdc:mga0qj67_22712_c2 nmdc:mga0qj67_22712_c2_810_2258 482
360 3300050511 nmdc:mga08y16_2037_c1 nmdc:mga08y16_2037_c1_6644_8092 482
361 3300050512 nmdc:mga0n895_152933_c1 nmdc:mga0n895_152933_c1_292_1740 482
362 3300050512 nmdc:mga0n895_408_c1 nmdc:mga0n895_408_c1_949_2397 482
363 3300050513 nmdc:mga0rr50_99_c1 nmdc:mga0rr50_99_c1_15107_16555 482
364 3300050514 nmdc:mga08x19_8659_c1 nmdc:mga08x19_8659_c1_3035_4483 482
365 3300050515 nmdc:mga0a205_126628_c1 nmdc:mga0a205_126628_c1_203_1651 482
366 3300050515 nmdc:mga0a205_40_c1 nmdc:mga0a205_40_c1_67664_69112 482
367 3300005329 Ga0070683_100000007 Ga0070683_1000000073 483
368 3300005440 Ga0070705_100000468 Ga0070705_1000004688 483
369 3300005444 Ga0070694_100096265 Ga0070694_1000962652 483
370 3300005467 Ga0070706_100040755 Ga0070706_1000407552 483
371 3300005518 Ga0070699_100001260 Ga0070699_10000126011 483
372 3300005535 Ga0070684_100000021 Ga0070684_100000021115 483
373 3300005545 Ga0070695_100020180 Ga0070695_1000201802 483
374 3300005546 Ga0070696_100001999 Ga0070696_1000019993 483
375 3300005549 Ga0070704_100001301 Ga0070704_1000013014 483
376 3300013105 Ga0157369_10056145 Ga0157369_100561453 483
377 3300013105 Ga0157369_10180322 Ga0157369_101803221 483
378 3300014326 Ga0157380_10084763 Ga0157380_100847632 483
379 3300025910 Ga0207684_10033302 Ga0207684_100333022 483
380 3300025944 Ga0207661_10000010 Ga0207661_100000103 483
381 3300031241 Ga0265325_10008141 Ga0265325_100081414 483
382 3300031242 Ga0265329_10004592 Ga0265329_100045923 483
383 3300031250 Ga0265331_10006150 Ga0265331_100061504 483
384 3300031344 Ga0265316_10010940 Ga0265316_100109403 483
385 3300031344 Ga0265316_10029993 Ga0265316_100299933 483
386 3300031711 Ga0265314_10016579 Ga0265314_100165793 483
387 3300045051 Ga0451576_0019624 Ga0451576_0019624_1374_2825 483
388 3300045051 Ga0451576_0108337 Ga0451576_0108337_276_1727 483
389 3300060353 Ga0501082_0001747 Ga0501082_0001747_5115_6566 483
390 3300005436 Ga0070713_100034947 Ga0070713_1000349475 484
391 3300005439 Ga0070711_100068354 Ga0070711_1000683542 484
392 3300005439 Ga0070711_100086589 Ga0070711_1000865891 484
393 3300005841 Ga0068863_100014350 Ga0068863_1000143503 484
394 3300006847 Ga0075431_100003894 Ga0075431_10000389412 484
395 3300006914 Ga0075436_100006615 Ga0075436_1000066153 484
396 3300009093 Ga0105240_10000948 Ga0105240_100009487 484
397 3300009093 Ga0105240_10166595 Ga0105240_101665952 484
398 3300021388 Ga0213875_10005848 Ga0213875_100058486 484
399 3300025913 Ga0207695_10005967 Ga0207695_100059675 484
400 3300025913 Ga0207695_10082350 Ga0207695_100823502 484
401 3300025916 Ga0207663_10072603 Ga0207663_100726031 484
402 3300026088 Ga0207641_10016632 Ga0207641_100166323 484
403 3300028653 Ga0265323_10000266 Ga0265323_1000026612 484
404 3300031250 Ga0265331_10021036 Ga0265331_100210362 484
405 3300031344 Ga0265316_10013105 Ga0265316_100131052 484
406 3300031344 Ga0265316_10029090 Ga0265316_100290902 484
407 3300031344 Ga0265316_10050246 Ga0265316_100502462 484
408 3300031711 Ga0265314_10005337 Ga0265314_100053373 484
409 3300035083 Ga0373926_0003830 Ga0373926_0003830_491_1945 484
410 3300035119 Ga0373956_0017945 Ga0373956_0017945_218_1672 484
411 3300035692 Ga0373935_0105593 Ga0373935_0105593_349_1803 484
412 3300035695 Ga0373927_0007985 Ga0373927_0007985_3910_5364 484
413 3300035695 Ga0373927_0022195 Ga0373927_0022195_895_2349 484
414 3300035725 Ga0373947_0002512 Ga0373947_0002512_1970_3424 484
415 3300036401 Ga0373937_0028291 Ga0373937_0028291_287_1741 484
416 3300036401 Ga0373937_0066585 Ga0373937_0066585_1851_3305 484
417 3300037068 Ga0373925_0000953 Ga0373925_0000953_20997_22451 484
418 3300037853 Ga0436364_0970590 Ga0436364_0970590_1139_2605 484
419 3300046472 Ga0495580_0001612 Ga0495580_0001612_17898_19352 484
420 3300046473 Ga0495582_0010825 Ga0495582_0010825_1200_2654 484
421 3300046477 Ga0495664_0055732 Ga0495664_0055732_392_1846 484
422 3300046531 Ga0495665_0036323 Ga0495665_0036323_879_2333 484
423 3300046533 Ga0495640_0147676 Ga0495640_0147676_32_1486 484
424 3300046559 Ga0495667_0062077 Ga0495667_0062077_636_2090 484
425 3300046679 Ga0495623_0067663 Ga0495623_0067663_420_1874 484
426 3300046683 Ga0495658_0000540 Ga0495658_0000540_2378_3832 484
427 3300047317 Ga0495604_0050084 Ga0495604_0050084_157_1611 484
428 3300047317 Ga0495604_0084559 Ga0495604_0084559_304_1758 484
429 3300047319 Ga0495674_0019513 Ga0495674_0019513_4693_6147 484
430 3300047471 Ga0495684_0067205 Ga0495684_0067205_691_2145 484
431 3300047471 Ga0495684_0104348 Ga0495684_0104348_487_1941 484
432 3300050507 nmdc:mga05p37_133052_c1 nmdc:mga05p37_133052_c1_1235_2689 484
433 3300050514 nmdc:mga08x19_7696_c1 nmdc:mga08x19_7696_c1_376_1830 484
434 3300005435 Ga0070714_100005417 Ga0070714_1000054175 485
435 3300005436 Ga0070713_100007744 Ga0070713_1000077444 485
436 3300005458 Ga0070681_10061622 Ga0070681_100616222 485
437 3300005467 Ga0070706_100002605 Ga0070706_1000026052 485
438 3300005468 Ga0070707_100003183 Ga0070707_1000031835 485
439 3300005546 Ga0070696_100000158 Ga0070696_10000015835 485
440 3300006028 Ga0070717_10016939 Ga0070717_100169393 485
441 3300006028 Ga0070717_10129222 Ga0070717_101292222 485
442 3300006173 Ga0070716_100007388 Ga0070716_1000073884 485
443 3300006175 Ga0070712_100016090 Ga0070712_1000160903 485
444 3300009093 Ga0105240_10001342 Ga0105240_1000134228 485
445 3300009093 Ga0105240_10010328 Ga0105240_1001032811 485
446 3300009093 Ga0105240_10057336 Ga0105240_100573363 485
447 3300009545 Ga0105237_10001632 Ga0105237_1000163212 485
448 3300025912 Ga0207707_10093595 Ga0207707_100935952 485
449 3300025913 Ga0207695_10008345 Ga0207695_100083459 485
450 3300025913 Ga0207695_10047992 Ga0207695_100479922 485
451 3300025914 Ga0207671_10004346 Ga0207671_1000434612 485
452 3300025915 Ga0207693_10012264 Ga0207693_100122643 485
453 3300025922 Ga0207646_10000019 Ga0207646_1000001913 485
454 3300025922 Ga0207646_10004228 Ga0207646_1000422811 485
455 3300025928 Ga0207700_10005553 Ga0207700_100055535 485
456 3300028563 Ga0265319_1000256 Ga0265319_100025622 485
457 3300028577 Ga0265318_10000240 Ga0265318_1000024017 485
458 3300028800 Ga0265338_10034628 Ga0265338_100346283 485
459 3300031238 Ga0265332_10013007 Ga0265332_100130071 485
460 3300031240 Ga0265320_10000124 Ga0265320_1000012429 485
461 3300031241 Ga0265325_10007723 Ga0265325_100077232 485
462 3300031241 Ga0265325_10019981 Ga0265325_100199811 485
463 3300031242 Ga0265329_10000224 Ga0265329_100002246 485
464 3300031250 Ga0265331_10000232 Ga0265331_1000023230 485
465 3300031250 Ga0265331_10006875 Ga0265331_100068753 485
466 3300031250 Ga0265331_10011108 Ga0265331_100111083 485
467 3300031344 Ga0265316_10008501 Ga0265316_100085013 485
468 3300031344 Ga0265316_10008528 Ga0265316_100085284 485
469 3300031595 Ga0265313_10008047 Ga0265313_100080473 485
470 3300031595 Ga0265313_10017232 Ga0265313_100172322 485
471 3300031711 Ga0265314_10008097 Ga0265314_100080972 485
472 3300031712 Ga0265342_10000198 Ga0265342_1000019829 485
473 3300035086 Ga0373934_0033772 Ga0373934_0033772_66_1532 485
474 3300035692 Ga0373935_0055161 Ga0373935_0055161_444_1901 485
475 3300035695 Ga0373927_0002438 Ga0373927_0002438_10420_11877 485
476 3300035695 Ga0373927_0096724 Ga0373927_0096724_177_1634 485
477 3300036401 Ga0373937_0000024 Ga0373937_0000024_17785_19251 485
478 3300036401 Ga0373937_0010271 Ga0373937_0010271_5469_6962 485
479 3300036401 Ga0373937_0018028 Ga0373937_0018028_441_1898 485
480 3300037853 Ga0436364_0355922 Ga0436364_0355922_475_1932 485
481 3300037853 Ga0436364_0417295 Ga0436364_0417295_667_2124 485
482 3300042876 Ga0451577_0076000 Ga0451577_0076000_1439_2896 485
483 3300044673 Ga0453683_0008848 Ga0453683_0008848_4977_6434 485
484 3300044673 Ga0453683_0037800 Ga0453683_0037800_1310_2767 485
485 3300044712 Ga0453684_0055051 Ga0453684_0055051_3540_4997 485
486 3300046462 Ga0495651_0014639 Ga0495651_0014639_2352_3818 485
487 3300046472 Ga0495580_0000971 Ga0495580_0000971_22139_23596 485
488 3300046472 Ga0495580_0013580 Ga0495580_0013580_4060_5517 485
489 3300046472 Ga0495580_0048939 Ga0495580_0048939_517_2019 485
490 3300046689 Ga0495613_0018653 Ga0495613_0018653_866_2323 485
491 3300047315 Ga0495581_0053440 Ga0495581_0053440_201_1658 485
492 3300047317 Ga0495604_0048518 Ga0495604_0048518_779_2245 485
493 3300047444 Ga0495675_0003525 Ga0495675_0003525_3847_5313 485
494 3300047471 Ga0495684_0022713 Ga0495684_0022713_2643_4100 485
495 3300048088 Ga0495602_0000047 Ga0495602_0000047_106507_107973 485
496 3300005329 Ga0070683_100089547 Ga0070683_1000895472 486
497 3300005330 Ga0070690_100065457 Ga0070690_1000654572 486
498 3300005331 Ga0070670_100004282 Ga0070670_1000042828 486
499 3300005336 Ga0070680_100111622 Ga0070680_1001116221 486
500 3300005336 Ga0070680_100193270 Ga0070680_1001932702 486
501 3300005338 Ga0068868_100007852 Ga0068868_1000078524 486
502 3300005339 Ga0070660_100044380 Ga0070660_1000443801 486
503 3300005434 Ga0070709_10002535 Ga0070709_100025353 486
504 3300005436 Ga0070713_100004858 Ga0070713_1000048587 486
505 3300005436 Ga0070713_100126854 Ga0070713_1001268542 486
506 3300005436 Ga0070713_100174204 Ga0070713_1001742042 486
507 3300005436 Ga0070713_100206947 Ga0070713_1002069471 486
508 3300005445 Ga0070708_100000839 Ga0070708_1000008396 486
509 3300005458 Ga0070681_10000340 Ga0070681_1000034021 486
510 3300005458 Ga0070681_10080972 Ga0070681_100809722 486
511 3300005459 Ga0068867_100018277 Ga0068867_1000182774 486
512 3300005467 Ga0070706_100025394 Ga0070706_1000253944 486
513 3300005468 Ga0070707_100001494 Ga0070707_1000014949 486
514 3300005471 Ga0070698_100009390 Ga0070698_1000093905 486
515 3300005471 Ga0070698_100161281 Ga0070698_1001612812 486
516 3300005518 Ga0070699_100040937 Ga0070699_1000409372 486
517 3300005530 Ga0070679_100003222 Ga0070679_1000032228 486
518 3300005530 Ga0070679_100032884 Ga0070679_1000328842 486
519 3300005535 Ga0070684_100057565 Ga0070684_1000575652 486
520 3300005536 Ga0070697_100002164 Ga0070697_10000216411 486
521 3300005536 Ga0070697_100012622 Ga0070697_1000126223 486
522 3300005536 Ga0070697_100046900 Ga0070697_1000469003 486
523 3300005536 Ga0070697_100126628 Ga0070697_1001266281 486
524 3300005539 Ga0068853_100042750 Ga0068853_1000427502 486
525 3300005545 Ga0070695_100029186 Ga0070695_1000291863 486
526 3300005545 Ga0070695_100055457 Ga0070695_1000554572 486
527 3300005546 Ga0070696_100030717 Ga0070696_1000307173 486
528 3300005547 Ga0070693_100000065 Ga0070693_1000000658 486
529 3300005547 Ga0070693_100039811 Ga0070693_1000398112 486
530 3300005549 Ga0070704_100000207 Ga0070704_10000020718 486
531 3300005563 Ga0068855_100006580 Ga0068855_1000065802 486
532 3300005563 Ga0068855_100022860 Ga0068855_1000228605 486
533 3300005563 Ga0068855_100032688 Ga0068855_1000326885 486
534 3300005563 Ga0068855_100231229 Ga0068855_1002312291 486
535 3300005564 Ga0070664_100001065 Ga0070664_10000106519 486
536 3300005577 Ga0068857_100025348 Ga0068857_1000253482 486
537 3300005578 Ga0068854_100010143 Ga0068854_1000101432 486
538 3300005578 Ga0068854_100083367 Ga0068854_1000833672 486
539 3300005614 Ga0068856_100002732 Ga0068856_10000273210 486
540 3300005614 Ga0068856_100007427 Ga0068856_1000074277 486
541 3300005614 Ga0068856_100014465 Ga0068856_1000144652 486
542 3300005614 Ga0068856_100019599 Ga0068856_1000195994 486
543 3300005618 Ga0068864_100000466 Ga0068864_10000046615 486
544 3300005718 Ga0068866_10064889 Ga0068866_100648892 486
545 3300005841 Ga0068863_100001330 Ga0068863_1000013307 486
546 3300005841 Ga0068863_100026901 Ga0068863_1000269013 486
547 3300005841 Ga0068863_100082210 Ga0068863_1000822102 486
548 3300005842 Ga0068858_100004164 Ga0068858_1000041642 486
549 3300005842 Ga0068858_100017610 Ga0068858_1000176103 486
550 3300005842 Ga0068858_100026410 Ga0068858_1000264104 486
551 3300005843 Ga0068860_100017683 Ga0068860_1000176832 486
552 3300006173 Ga0070716_100004349 Ga0070716_1000043494 486
553 3300006173 Ga0070716_100027213 Ga0070716_1000272131 486
554 3300006175 Ga0070712_100044874 Ga0070712_1000448744 486
555 3300006175 Ga0070712_100054559 Ga0070712_1000545592 486
556 3300006237 Ga0097621_100001928 Ga0097621_10000192810 486
557 3300006237 Ga0097621_100005841 Ga0097621_1000058415 486
558 3300006237 Ga0097621_100072133 Ga0097621_1000721332 486
559 3300006358 Ga0068871_100000058 Ga0068871_10000005827 486
560 3300006358 Ga0068871_100006073 Ga0068871_1000060733 486
561 3300006358 Ga0068871_100030270 Ga0068871_1000302702 486
562 3300006358 Ga0068871_100032706 Ga0068871_1000327062 486
563 3300006871 Ga0075434_100024946 Ga0075434_1000249463 486
564 3300006871 Ga0075434_100072082 Ga0075434_1000720822 486
565 3300006914 Ga0075436_100002747 Ga0075436_1000027476 486
566 3300006914 Ga0075436_100015558 Ga0075436_1000155583 486
567 3300006914 Ga0075436_100088506 Ga0075436_1000885062 486
568 3300007076 Ga0075435_100052451 Ga0075435_1000524512 486
569 3300007076 Ga0075435_100085774 Ga0075435_1000857742 486
570 3300007265 Ga0099794_10012827 Ga0099794_100128273 486
571 3300007265 Ga0099794_10037928 Ga0099794_100379282 486
572 3300009093 Ga0105240_10011876 Ga0105240_100118768 486
573 3300009093 Ga0105240_10062556 Ga0105240_100625562 486
574 3300009098 Ga0105245_10068593 Ga0105245_100685931 486
575 3300009174 Ga0105241_10074141 Ga0105241_100741412 486
576 3300009545 Ga0105237_10009361 Ga0105237_100093617 486
577 3300009545 Ga0105237_10023109 Ga0105237_100231095 486
578 3300009551 Ga0105238_10000419 Ga0105238_1000041911 486
579 3300009551 Ga0105238_10020549 Ga0105238_100205493 486
580 3300010375 Ga0105239_10009924 Ga0105239_100099245 486
581 3300010375 Ga0105239_10082527 Ga0105239_100825272 486
582 3300013100 Ga0157373_10002219 Ga0157373_1000221913 486
583 3300013104 Ga0157370_10059913 Ga0157370_100599135 486
584 3300013105 Ga0157369_10001273 Ga0157369_100012737 486
585 3300013105 Ga0157369_10028229 Ga0157369_100282293 486
586 3300013105 Ga0157369_10035694 Ga0157369_100356942 486
587 3300013296 Ga0157374_10000236 Ga0157374_1000023628 486
588 3300013296 Ga0157374_10000722 Ga0157374_1000072218 486
589 3300013296 Ga0157374_10000771 Ga0157374_1000077117 486
590 3300013296 Ga0157374_10002785 Ga0157374_1000278512 486
591 3300013297 Ga0157378_10000119 Ga0157378_1000011922 486
592 3300013297 Ga0157378_10001314 Ga0157378_1000131416 486
593 3300013297 Ga0157378_10001479 Ga0157378_1000147910 486
594 3300013297 Ga0157378_10002703 Ga0157378_100027034 486
595 3300013297 Ga0157378_10003622 Ga0157378_100036222 486
596 3300013297 Ga0157378_10028050 Ga0157378_100280503 486
597 3300013307 Ga0157372_10000995 Ga0157372_1000099515 486
598 3300013307 Ga0157372_10002841 Ga0157372_100028414 486
599 3300013307 Ga0157372_10006842 Ga0157372_100068422 486
600 3300014968 Ga0157379_10080281 Ga0157379_100802812 486
601 3300014969 Ga0157376_10000037 Ga0157376_10000037106 486
602 3300014969 Ga0157376_10008975 Ga0157376_100089752 486
603 3300025906 Ga0207699_10020177 Ga0207699_100201773 486
604 3300025906 Ga0207699_10075199 Ga0207699_100751992 486
605 3300025910 Ga0207684_10001875 Ga0207684_100018752 486
606 3300025911 Ga0207654_10021049 Ga0207654_100210493 486
607 3300025911 Ga0207654_10054194 Ga0207654_100541942 486
608 3300025912 Ga0207707_10062989 Ga0207707_100629892 486
609 3300025913 Ga0207695_10010643 Ga0207695_100106437 486
610 3300025914 Ga0207671_10012796 Ga0207671_100127966 486
611 3300025915 Ga0207693_10001652 Ga0207693_100016522 486
612 3300025915 Ga0207693_10012627 Ga0207693_100126274 486
613 3300025915 Ga0207693_10065088 Ga0207693_100650882 486
614 3300025917 Ga0207660_10035700 Ga0207660_100357001 486
615 3300025919 Ga0207657_10077912 Ga0207657_100779123 486
616 3300025921 Ga0207652_10009107 Ga0207652_100091076 486
617 3300025921 Ga0207652_10018977 Ga0207652_100189772 486
618 3300025922 Ga0207646_10002636 Ga0207646_100026362 486
619 3300025924 Ga0207694_10063774 Ga0207694_100637742 486
620 3300025927 Ga0207687_10171987 Ga0207687_101719871 486
621 3300025928 Ga0207700_10014401 Ga0207700_100144013 486
622 3300025928 Ga0207700_10183072 Ga0207700_101830721 486
623 3300025928 Ga0207700_10200210 Ga0207700_102002101 486
624 3300025929 Ga0207664_10035338 Ga0207664_100353382 486
625 3300025934 Ga0207686_10053038 Ga0207686_100530382 486
626 3300025939 Ga0207665_10000086 Ga0207665_1000008627 486
627 3300025939 Ga0207665_10007051 Ga0207665_100070515 486
628 3300025939 Ga0207665_10012072 Ga0207665_100120723 486
629 3300025941 Ga0207711_10047104 Ga0207711_100471042 486
630 3300025942 Ga0207689_10098509 Ga0207689_100985092 486
631 3300025944 Ga0207661_10089568 Ga0207661_100895682 486
632 3300025945 Ga0207679_10103673 Ga0207679_101036732 486
633 3300025949 Ga0207667_10018202 Ga0207667_100182022 486
634 3300025949 Ga0207667_10025711 Ga0207667_100257111 486
635 3300025949 Ga0207667_10030236 Ga0207667_100302365 486
636 3300025981 Ga0207640_10038070 Ga0207640_100380702 486
637 3300026023 Ga0207677_10039356 Ga0207677_100393562 486
638 3300026023 Ga0207677_10043120 Ga0207677_100431202 486
639 3300026035 Ga0207703_10018012 Ga0207703_100180123 486
640 3300026035 Ga0207703_10021177 Ga0207703_100211774 486
641 3300026035 Ga0207703_10054106 Ga0207703_100541062 486
642 3300026041 Ga0207639_10066021 Ga0207639_100660212 486
643 3300026078 Ga0207702_10001512 Ga0207702_100015129 486
644 3300026078 Ga0207702_10014206 Ga0207702_100142063 486
645 3300026078 Ga0207702_10015860 Ga0207702_100158602 486
646 3300026078 Ga0207702_10021274 Ga0207702_100212747 486
647 3300026078 Ga0207702_10117725 Ga0207702_101177252 486
648 3300026088 Ga0207641_10004436 Ga0207641_100044363 486
649 3300026088 Ga0207641_10094134 Ga0207641_100941342 486
650 3300026089 Ga0207648_10022244 Ga0207648_100222442 486
651 3300026095 Ga0207676_10030079 Ga0207676_100300793 486
652 3300026116 Ga0207674_10002438 Ga0207674_100024389 486
653 3300026142 Ga0207698_10132012 Ga0207698_101320122 486
654 3300027671 Ga0209588_1016358 Ga0209588_10163582 486
655 3300028016 Ga0265354_1001572 Ga0265354_10015722 486
656 3300028381 Ga0268264_10004389 Ga0268264_1000438910 486
657 3300030878 Ga0265770_1003384 Ga0265770_10033842 486
658 3300030878 Ga0265770_1003400 Ga0265770_10034001 486
659 3300035083 Ga0373926_0000639 Ga0373926_0000639_2510_3970 486
660 3300035691 Ga0373931_0019390 Ga0373931_0019390_1515_2975 486
661 3300035691 Ga0373931_0022951 Ga0373931_0022951_1102_2562 486
662 3300035692 Ga0373935_0159956 Ga0373935_0159956_51_1514 486
663 3300035695 Ga0373927_0001417 Ga0373927_0001417_13393_14853 486
664 3300035695 Ga0373927_0066982 Ga0373927_0066982_35_1498 486
665 3300035725 Ga0373947_0008247 Ga0373947_0008247_4207_5667 486
666 3300036401 Ga0373937_0031107 Ga0373937_0031107_1731_3191 486
667 3300036401 Ga0373937_0042155 Ga0373937_0042155_2517_3980 486
668 3300037068 Ga0373925_0004519 Ga0373925_0004519_7913_9373 486
669 3300037068 Ga0373925_0026887 Ga0373925_0026887_2703_4163 486
670 3300039437 Ga0436365_1500819 Ga0436365_1500819_7151_8611 486
671 3300044673 Ga0453683_0001369 Ga0453683_0001369_10657_12117 486
672 3300045976 Ga0466967_0005756 Ga0466967_0005756_6721_8181 486
673 3300046462 Ga0495651_0000483 Ga0495651_0000483_17339_18802 486
674 3300046462 Ga0495651_0003398 Ga0495651_0003398_7564_9027 486
675 3300046462 Ga0495651_0035063 Ga0495651_0035063_73_1536 486
676 3300046463 Ga0495653_0017598 Ga0495653_0017598_1744_3207 486
677 3300046472 Ga0495580_0000712 Ga0495580_0000712_26864_28327 486
678 3300046472 Ga0495580_0002563 Ga0495580_0002563_7676_9136 486
679 3300046472 Ga0495580_0036215 Ga0495580_0036215_388_1848 486
680 3300046475 Ga0495639_0013469 Ga0495639_0013469_1899_3413 486
681 3300046511 Ga0495608_0012719 Ga0495608_0012719_1905_3368 486
682 3300046511 Ga0495608_0080312 Ga0495608_0080312_46_1509 486
683 3300046511 Ga0495608_0114762 Ga0495608_0114762_61_1524 486
684 3300046516 Ga0495628_0186761 Ga0495628_0186761_59_1522 486
685 3300046517 Ga0495630_0045494 Ga0495630_0045494_89_1552 486
686 3300046517 Ga0495630_0056482 Ga0495630_0056482_785_2248 486
687 3300046529 Ga0495652_0001580 Ga0495652_0001580_541_2004 486
688 3300046533 Ga0495640_0014363 Ga0495640_0014363_3949_5463 486
689 3300046533 Ga0495640_0068504 Ga0495640_0068504_61_1524 486
690 3300046535 Ga0495586_0002925 Ga0495586_0002925_5834_7348 486
691 3300046535 Ga0495586_0098921 Ga0495586_0098921_44_1507 486
692 3300046536 Ga0495587_0016792 Ga0495587_0016792_757_2220 486
693 3300046536 Ga0495587_0057958 Ga0495587_0057958_694_2157 486
694 3300046543 Ga0495645_0070936 Ga0495645_0070936_345_1808 486
695 3300046559 Ga0495667_0010060 Ga0495667_0010060_157_1620 486
696 3300046559 Ga0495667_0016733 Ga0495667_0016733_2283_3746 486
697 3300046642 Ga0495634_0009931 Ga0495634_0009931_535_1998 486
698 3300046663 Ga0495635_0006902 Ga0495635_0006902_185_1648 486
699 3300046663 Ga0495635_0049476 Ga0495635_0049476_568_2031 486
700 3300046675 Ga0495657_0087142 Ga0495657_0087142_73_1536 486
701 3300046678 Ga0495599_0021040 Ga0495599_0021040_198_1661 486
702 3300046679 Ga0495623_0029839 Ga0495623_0029839_246_1709 486
703 3300046679 Ga0495623_0033786 Ga0495623_0033786_581_2044 486
704 3300046680 Ga0495646_0083944 Ga0495646_0083944_230_1693 486
705 3300046809 Ga0495600_0012917 Ga0495600_0012917_3339_4802 486
706 3300047315 Ga0495581_0071932 Ga0495581_0071932_480_1940 486
707 3300047317 Ga0495604_0001339 Ga0495604_0001339_4533_5996 486
708 3300047317 Ga0495604_0006109 Ga0495604_0006109_7736_9199 486
709 3300047317 Ga0495604_0037475 Ga0495604_0037475_1367_2830 486
710 3300047319 Ga0495674_0002425 Ga0495674_0002425_14990_16453 486
711 3300047321 Ga0495676_0014185 Ga0495676_0014185_1216_2730 486
712 3300047322 Ga0495680_0000269 Ga0495680_0000269_29073_30536 486
713 3300047322 Ga0495680_0004322 Ga0495680_0004322_9561_11024 486
714 3300047322 Ga0495680_0011815 Ga0495680_0011815_906_2420 486
715 3300047444 Ga0495675_0006374 Ga0495675_0006374_2223_3686 486
716 3300047444 Ga0495675_0010654 Ga0495675_0010654_4056_5519 486
717 3300047471 Ga0495684_0002555 Ga0495684_0002555_10578_12041 486
718 3300047471 Ga0495684_0014038 Ga0495684_0014038_809_2272 486
719 3300047471 Ga0495684_0118669 Ga0495684_0118669_504_1967 486
720 3300047673 Ga0495593_0011035 Ga0495593_0011035_44_1507 486
721 3300047673 Ga0495593_0019942 Ga0495593_0019942_1288_2802 486
722 3300048088 Ga0495602_0007044 Ga0495602_0007044_10272_11735 486
723 3300048905 Ga0496102_0021886 Ga0496102_0021886_1639_3099 486
724 3300048915 Ga0496112_0002908 Ga0496112_0002908_10781_12241 486
725 3300048915 Ga0496112_0037194 Ga0496112_0037194_54_1514 486
726 3300048915 Ga0496112_0084609 Ga0496112_0084609_172_1632 486
727 3300048917 Ga0496114_0024514 Ga0496114_0024514_3264_4724 486
728 3300048918 Ga0496115_0004534 Ga0496115_0004534_4754_6292 486
729 3300048918 Ga0496115_0042261 Ga0496115_0042261_247_1707 486
730 3300050512 nmdc:mga0n895_82072_c1 nmdc:mga0n895_82072_c1_1444_2904 486
731 3300050513 nmdc:mga0rr50_111418_c1 nmdc:mga0rr50_111418_c1_328_1788 486
732 3300050513 nmdc:mga0rr50_74925_c1 nmdc:mga0rr50_74925_c1_192_1652 486
733 3300050514 nmdc:mga08x19_1089_c1 nmdc:mga08x19_1089_c1_8789_10249 486
734 3300050514 nmdc:mga08x19_4715_c1 nmdc:mga08x19_4715_c1_2206_3666 486
735 3300050514 nmdc:mga08x19_58316_c1 nmdc:mga08x19_58316_c1_218_1678 486
736 3300005434 Ga0070709_10000342 Ga0070709_1000034217 487
737 3300005435 Ga0070714_100040314 Ga0070714_1000403142 487
738 3300005436 Ga0070713_100000349 Ga0070713_10000034919 487
739 3300005436 Ga0070713_100000464 Ga0070713_10000046411 487
740 3300005437 Ga0070710_10015228 Ga0070710_100152282 487
741 3300005439 Ga0070711_100003499 Ga0070711_1000034993 487
742 3300005439 Ga0070711_100119529 Ga0070711_1001195292 487
743 3300005843 Ga0068860_100086236 Ga0068860_1000862361 487
744 3300006028 Ga0070717_10001227 Ga0070717_1000122712 487
745 3300006163 Ga0070715_10004165 Ga0070715_100041652 487
746 3300006173 Ga0070716_100008396 Ga0070716_1000083962 487
747 3300006175 Ga0070712_100000586 Ga0070712_10000058613 487
748 3300006175 Ga0070712_100003006 Ga0070712_1000030066 487
749 3300024225 Ga0224572_1012324 Ga0224572_10123241 487
750 3300024227 Ga0228598_1000392 Ga0228598_10003926 487
751 3300025906 Ga0207699_10003310 Ga0207699_100033106 487
752 3300025906 Ga0207699_10039166 Ga0207699_100391663 487
753 3300025915 Ga0207693_10000142 Ga0207693_100001426 487
754 3300025915 Ga0207693_10002184 Ga0207693_1000218422 487
755 3300025916 Ga0207663_10000512 Ga0207663_1000051210 487
756 3300025916 Ga0207663_10086469 Ga0207663_100864692 487
757 3300025928 Ga0207700_10000200 Ga0207700_100002005 487
758 3300025928 Ga0207700_10005255 Ga0207700_100052556 487
759 3300025929 Ga0207664_10047224 Ga0207664_100472242 487
760 3300025939 Ga0207665_10016855 Ga0207665_100168553 487
761 3300028017 Ga0265356_1000078 Ga0265356_100007814 487
762 3300030760 Ga0265762_1001021 Ga0265762_10010212 487
763 3300031712 Ga0265342_10021252 Ga0265342_100212522 487
764 3300035116 Ga0373945_0010362 Ga0373945_0010362_1014_2477 487
765 3300035118 Ga0373954_0035045 Ga0373954_0035045_417_1880 487
766 3300035170 Ga0373943_0001752 Ga0373943_0001752_5103_6566 487
767 3300035410 Ga0373924_0003866 Ga0373924_0003866_2666_4129 487
768 3300035695 Ga0373927_0000229 Ga0373927_0000229_29786_31249 487
769 3300035724 Ga0373933_0006936 Ga0373933_0006936_1523_2986 487
770 3300035725 Ga0373947_0009478 Ga0373947_0009478_3381_4844 487
771 3300037068 Ga0373925_0019431 Ga0373925_0019431_1361_2824 487
772 3300037068 Ga0373925_0021613 Ga0373925_0021613_1171_2634 487
773 3300046459 Ga0495629_0097478 Ga0495629_0097478_325_1788 487
774 3300046472 Ga0495580_0006797 Ga0495580_0006797_3360_4823 487
775 3300046473 Ga0495582_0027354 Ga0495582_0027354_347_1810 487
776 3300046477 Ga0495664_0082941 Ga0495664_0082941_104_1567 487
777 3300046531 Ga0495665_0052278 Ga0495665_0052278_158_1621 487
778 3300046533 Ga0495640_0050243 Ga0495640_0050243_42_1505 487
779 3300046683 Ga0495658_0020894 Ga0495658_0020894_1010_2473 487
780 3300048088 Ga0495602_0030330 Ga0495602_0030330_1336_2799 487
781 3300005334 Ga0068869_100005013 Ga0068869_1000050134 488
782 3300005336 Ga0070680_100019473 Ga0070680_1000194734 488
783 3300005338 Ga0068868_100048572 Ga0068868_1000485722 488
784 3300005338 Ga0068868_100085114 Ga0068868_1000851142 488
785 3300005434 Ga0070709_10029236 Ga0070709_100292363 488
786 3300005434 Ga0070709_10051108 Ga0070709_100511082 488
787 3300005434 Ga0070709_10095462 Ga0070709_100954621 488
788 3300005435 Ga0070714_100087185 Ga0070714_1000871851 488
789 3300005435 Ga0070714_100093185 Ga0070714_1000931853 488
790 3300005436 Ga0070713_100009782 Ga0070713_1000097824 488
791 3300005436 Ga0070713_100027388 Ga0070713_1000273884 488
792 3300005436 Ga0070713_100072689 Ga0070713_1000726891 488
793 3300005436 Ga0070713_100090480 Ga0070713_1000904802 488
794 3300005437 Ga0070710_10012685 Ga0070710_100126852 488
795 3300005439 Ga0070711_100003874 Ga0070711_1000038746 488
796 3300005439 Ga0070711_100102978 Ga0070711_1001029781 488
797 3300005445 Ga0070708_100001971 Ga0070708_10000197111 488
798 3300005445 Ga0070708_100006430 Ga0070708_1000064303 488
799 3300005445 Ga0070708_100006468 Ga0070708_1000064684 488
800 3300005445 Ga0070708_100159797 Ga0070708_1001597972 488
801 3300005458 Ga0070681_10001097 Ga0070681_1000109717 488
802 3300005458 Ga0070681_10017801 Ga0070681_100178014 488
803 3300005458 Ga0070681_10160529 Ga0070681_101605291 488
804 3300005467 Ga0070706_100000173 Ga0070706_10000017369 488
805 3300005467 Ga0070706_100001330 Ga0070706_10000133018 488
806 3300005467 Ga0070706_100006446 Ga0070706_1000064468 488
807 3300005467 Ga0070706_100018145 Ga0070706_1000181457 488
808 3300005467 Ga0070706_100053822 Ga0070706_1000538223 488
809 3300005467 Ga0070706_100085928 Ga0070706_1000859282 488
810 3300005468 Ga0070707_100009403 Ga0070707_1000094036 488
811 3300005468 Ga0070707_100009720 Ga0070707_1000097205 488
812 3300005468 Ga0070707_100023040 Ga0070707_1000230402 488
813 3300005471 Ga0070698_100002711 Ga0070698_10000271115 488
814 3300005471 Ga0070698_100009217 Ga0070698_1000092176 488
815 3300005471 Ga0070698_100099640 Ga0070698_1000996401 488
816 3300005471 Ga0070698_100101060 Ga0070698_1001010602 488
817 3300005518 Ga0070699_100004975 Ga0070699_1000049756 488
818 3300005518 Ga0070699_100014668 Ga0070699_1000146683 488
819 3300005530 Ga0070679_100014582 Ga0070679_1000145825 488
820 3300005536 Ga0070697_100000015 Ga0070697_10000001561 488
821 3300005536 Ga0070697_100000389 Ga0070697_10000038921 488
822 3300005536 Ga0070697_100001978 Ga0070697_1000019786 488
823 3300005536 Ga0070697_100013157 Ga0070697_1000131577 488
824 3300005536 Ga0070697_100015949 Ga0070697_1000159492 488
825 3300005536 Ga0070697_100127096 Ga0070697_1001270962 488
826 3300005536 Ga0070697_100160984 Ga0070697_1001609841 488
827 3300005539 Ga0068853_100047205 Ga0068853_1000472051 488
828 3300005548 Ga0070665_100275668 Ga0070665_1002756681 488
829 3300005563 Ga0068855_100041740 Ga0068855_1000417401 488
830 3300005563 Ga0068855_100064896 Ga0068855_1000648964 488
831 3300005578 Ga0068854_100016041 Ga0068854_1000160412 488
832 3300005614 Ga0068856_100004305 Ga0068856_1000043055 488
833 3300005614 Ga0068856_100239830 Ga0068856_1002398302 488
834 3300005616 Ga0068852_100034018 Ga0068852_1000340182 488
835 3300005617 Ga0068859_100018009 Ga0068859_1000180095 488
836 3300005718 Ga0068866_10048944 Ga0068866_100489442 488
837 3300005718 Ga0068866_10056358 Ga0068866_100563581 488
838 3300005834 Ga0068851_10009283 Ga0068851_100092833 488
839 3300005842 Ga0068858_100003905 Ga0068858_1000039055 488
840 3300005843 Ga0068860_100064272 Ga0068860_1000642723 488
841 3300005843 Ga0068860_100115139 Ga0068860_1001151392 488
842 3300006028 Ga0070717_10010164 Ga0070717_100101647 488
843 3300006028 Ga0070717_10021861 Ga0070717_100218614 488
844 3300006028 Ga0070717_10025498 Ga0070717_100254983 488
845 3300006028 Ga0070717_10052211 Ga0070717_100522112 488
846 3300006028 Ga0070717_10063584 Ga0070717_100635842 488
847 3300006028 Ga0070717_10095760 Ga0070717_100957602 488
848 3300006163 Ga0070715_10004069 Ga0070715_100040692 488
849 3300006173 Ga0070716_100010833 Ga0070716_1000108333 488
850 3300006173 Ga0070716_100096768 Ga0070716_1000967682 488
851 3300006175 Ga0070712_100000401 Ga0070712_1000004016 488
852 3300006175 Ga0070712_100004555 Ga0070712_1000045553 488
853 3300006237 Ga0097621_100036487 Ga0097621_1000364873 488
854 3300006237 Ga0097621_100067811 Ga0097621_1000678112 488
855 3300006358 Ga0068871_100002915 Ga0068871_10000291515 488
856 3300006852 Ga0075433_10000901 Ga0075433_1000090116 488
857 3300006852 Ga0075433_10018081 Ga0075433_100180816 488
858 3300006871 Ga0075434_100000987 Ga0075434_10000098721 488
859 3300006871 Ga0075434_100006334 Ga0075434_10000633411 488
860 3300006871 Ga0075434_100021397 Ga0075434_1000213972 488
861 3300006881 Ga0068865_100091462 Ga0068865_1000914621 488
862 3300006914 Ga0075436_100001850 Ga0075436_10000185013 488
863 3300006914 Ga0075436_100004935 Ga0075436_1000049354 488
864 3300006914 Ga0075436_100010290 Ga0075436_1000102901 488
865 3300006914 Ga0075436_100017439 Ga0075436_1000174391 488
866 3300006914 Ga0075436_100034305 Ga0075436_1000343054 488
867 3300006931 Ga0097620_100018009 Ga0097620_1000180095 488
868 3300007076 Ga0075435_100055269 Ga0075435_1000552691 488
869 3300009093 Ga0105240_10016500 Ga0105240_100165007 488
870 3300009093 Ga0105240_10033712 Ga0105240_100337124 488
871 3300009093 Ga0105240_10058901 Ga0105240_100589011 488
872 3300009093 Ga0105240_10082066 Ga0105240_100820663 488
873 3300009098 Ga0105245_10002938 Ga0105245_100029388 488
874 3300009098 Ga0105245_10048797 Ga0105245_100487972 488
875 3300009098 Ga0105245_10069721 Ga0105245_100697212 488
876 3300009174 Ga0105241_10051512 Ga0105241_100515123 488
877 3300009174 Ga0105241_10086825 Ga0105241_100868252 488
878 3300009177 Ga0105248_10193671 Ga0105248_101936712 488
879 3300009545 Ga0105237_10129759 Ga0105237_101297592 488
880 3300009545 Ga0105237_10131539 Ga0105237_101315392 488
881 3300009551 Ga0105238_10224602 Ga0105238_102246021 488
882 3300013102 Ga0157371_10027086 Ga0157371_100270862 488
883 3300013104 Ga0157370_10026110 Ga0157370_100261103 488
884 3300013105 Ga0157369_10089556 Ga0157369_100895562 488
885 3300013105 Ga0157369_10104530 Ga0157369_101045302 488
886 3300013297 Ga0157378_10012740 Ga0157378_1001274011 488
887 3300013297 Ga0157378_10036101 Ga0157378_100361011 488
888 3300013306 Ga0163162_10031676 Ga0163162_100316762 488
889 3300013307 Ga0157372_10050540 Ga0157372_100505404 488
890 3300014325 Ga0163163_10092351 Ga0163163_100923512 488
891 3300014497 Ga0182008_10002320 Ga0182008_1000232011 488
892 3300014968 Ga0157379_10004138 Ga0157379_100041388 488
893 3300014969 Ga0157376_10080074 Ga0157376_100800742 488
894 3300022732 Ga0224569_101491 Ga0224569_1014912 488
895 3300024225 Ga0224572_1006665 Ga0224572_10066652 488
896 3300024227 Ga0228598_1002432 Ga0228598_10024322 488
897 3300025898 Ga0207692_10041723 Ga0207692_100417233 488
898 3300025899 Ga0207642_10068661 Ga0207642_100686611 488
899 3300025904 Ga0207647_10000903 Ga0207647_1000090317 488
900 3300025905 Ga0207685_10009160 Ga0207685_100091603 488
901 3300025905 Ga0207685_10021750 Ga0207685_100217501 488
902 3300025910 Ga0207684_10000267 Ga0207684_1000026761 488
903 3300025910 Ga0207684_10016631 Ga0207684_100166317 488
904 3300025910 Ga0207684_10072921 Ga0207684_100729212 488
905 3300025911 Ga0207654_10085190 Ga0207654_100851902 488
906 3300025912 Ga0207707_10033504 Ga0207707_100335044 488
907 3300025912 Ga0207707_10056674 Ga0207707_100566741 488
908 3300025912 Ga0207707_10124957 Ga0207707_101249572 488
909 3300025913 Ga0207695_10021905 Ga0207695_100219056 488
910 3300025915 Ga0207693_10000215 Ga0207693_1000021542 488
911 3300025915 Ga0207693_10005175 Ga0207693_100051758 488
912 3300025915 Ga0207693_10007280 Ga0207693_100072806 488
913 3300025915 Ga0207693_10052764 Ga0207693_100527642 488
914 3300025916 Ga0207663_10003671 Ga0207663_100036714 488
915 3300025916 Ga0207663_10085250 Ga0207663_100852501 488
916 3300025917 Ga0207660_10012171 Ga0207660_100121715 488
917 3300025919 Ga0207657_10001367 Ga0207657_1000136710 488
918 3300025921 Ga0207652_10014985 Ga0207652_100149854 488
919 3300025922 Ga0207646_10001228 Ga0207646_1000122811 488
920 3300025922 Ga0207646_10009914 Ga0207646_100099144 488
921 3300025922 Ga0207646_10141232 Ga0207646_101412321 488
922 3300025927 Ga0207687_10032250 Ga0207687_100322502 488
923 3300025927 Ga0207687_10037775 Ga0207687_100377752 488
924 3300025928 Ga0207700_10004203 Ga0207700_100042037 488
925 3300025928 Ga0207700_10009464 Ga0207700_100094642 488
926 3300025928 Ga0207700_10014517 Ga0207700_100145176 488
927 3300025929 Ga0207664_10000033 Ga0207664_10000033128 488
928 3300025929 Ga0207664_10021505 Ga0207664_100215054 488
929 3300025929 Ga0207664_10045521 Ga0207664_100455212 488
930 3300025929 Ga0207664_10072894 Ga0207664_100728942 488
931 3300025933 Ga0207706_10013270 Ga0207706_100132703 488
932 3300025934 Ga0207686_10071236 Ga0207686_100712362 488
933 3300025938 Ga0207704_10100559 Ga0207704_101005592 488
934 3300025939 Ga0207665_10000313 Ga0207665_1000031319 488
935 3300025939 Ga0207665_10007816 Ga0207665_100078168 488
936 3300025939 Ga0207665_10012828 Ga0207665_100128283 488
937 3300025939 Ga0207665_10015989 Ga0207665_100159894 488
938 3300025939 Ga0207665_10049177 Ga0207665_100491772 488
939 3300025942 Ga0207689_10000788 Ga0207689_1000078814 488
940 3300025944 Ga0207661_10022102 Ga0207661_100221024 488
941 3300025944 Ga0207661_10044423 Ga0207661_100444233 488
942 3300025981 Ga0207640_10163867 Ga0207640_101638671 488
943 3300026023 Ga0207677_10009387 Ga0207677_100093876 488
944 3300026041 Ga0207639_10080999 Ga0207639_100809993 488
945 3300026078 Ga0207702_10000479 Ga0207702_100004792 488
946 3300026078 Ga0207702_10131588 Ga0207702_101315882 488
947 3300026089 Ga0207648_10016467 Ga0207648_100164674 488
948 3300028800 Ga0265338_10002910 Ga0265338_100029106 488
949 3300028800 Ga0265338_10046890 Ga0265338_100468902 488
950 3300029957 Ga0265324_10032731 Ga0265324_100327311 488
951 3300030760 Ga0265762_1000283 Ga0265762_10002837 488
952 3300031090 Ga0265760_10000599 Ga0265760_100005999 488
953 3300031090 Ga0265760_10006515 Ga0265760_100065152 488
954 3300031090 Ga0265760_10008310 Ga0265760_100083102 488
955 3300031249 Ga0265339_10008695 Ga0265339_100086954 488
956 3300031249 Ga0265339_10015636 Ga0265339_100156363 488
957 3300031344 Ga0265316_10013551 Ga0265316_100135512 488
958 3300031507 Ga0307509_10227982 Ga0307509_102279821 488
959 3300035116 Ga0373945_0000689 Ga0373945_0000689_7031_8503 488
960 3300035170 Ga0373943_0022494 Ga0373943_0022494_922_2415 488
961 3300035170 Ga0373943_0058038 Ga0373943_0058038_181_1647 488
962 3300035410 Ga0373924_0000013 Ga0373924_0000013_38508_39980 488
963 3300035691 Ga0373931_0073740 Ga0373931_0073740_162_1628 488
964 3300035692 Ga0373935_0003050 Ga0373935_0003050_5841_7334 488
965 3300035692 Ga0373935_0017559 Ga0373935_0017559_17_1510 488
966 3300035695 Ga0373927_0000606 Ga0373927_0000606_20757_22250 488
967 3300035695 Ga0373927_0024567 Ga0373927_0024567_351_1844 488
968 3300035695 Ga0373927_0043550 Ga0373927_0043550_74_1540 488
969 3300035725 Ga0373947_0003698 Ga0373947_0003698_5073_6566 488
970 3300035725 Ga0373947_0011145 Ga0373947_0011145_257_1750 488
971 3300036401 Ga0373937_0000745 Ga0373937_0000745_9975_11447 488
972 3300036401 Ga0373937_0109622 Ga0373937_0109622_968_2440 488
973 3300036401 Ga0373937_0122520 Ga0373937_0122520_539_2011 488
974 3300037068 Ga0373925_0003052 Ga0373925_0003052_4761_6227 488
975 3300037068 Ga0373925_0110317 Ga0373925_0110317_612_2105 488
976 3300037466 Ga0395898_0013397 Ga0395898_0013397_6911_8383 488
977 3300037471 Ga0395905_0036111 Ga0395905_0036111_647_2131 488
978 3300037853 Ga0436364_1507696 Ga0436364_1507696_1955_3421 488
979 3300039450 Ga0436363_0490604 Ga0436363_0490604_1100_2566 488
980 3300039450 Ga0436363_1030894 Ga0436363_1030894_304_1770 488
981 3300039453 Ga0436362_0746214 Ga0436362_0746214_1581_3047 488
982 3300042876 Ga0451577_0027032 Ga0451577_0027032_1004_2479 488
983 3300042876 Ga0451577_0083059 Ga0451577_0083059_162_1637 488
984 3300044673 Ga0453683_0035438 Ga0453683_0035438_1326_2798 488
985 3300044694 Ga0466963_0005365 Ga0466963_0005365_4096_5568 488
986 3300044712 Ga0453684_0000104 Ga0453684_0000104_74837_76309 488
987 3300044842 Ga0466957_0000974 Ga0466957_0000974_3975_5447 488
988 3300045049 Ga0466959_0004808 Ga0466959_0004808_414_1880 488
989 3300045051 Ga0451576_0036712 Ga0451576_0036712_2759_4231 488
990 3300045051 Ga0451576_0185158 Ga0451576_0185158_556_2031 488
991 3300045836 Ga0466958_0104500 Ga0466958_0104500_124_1593 488
992 3300045836 Ga0466958_0142049 Ga0466958_0142049_18_1484 488
993 3300045976 Ga0466967_0004336 Ga0466967_0004336_4301_5773 488
994 3300045976 Ga0466967_0035956 Ga0466967_0035956_2150_3616 488
995 3300046472 Ga0495580_0001294 Ga0495580_0001294_15538_17004 488
996 3300046472 Ga0495580_0001982 Ga0495580_0001982_8085_9572 488
997 3300046472 Ga0495580_0003645 Ga0495580_0003645_6937_8403 488
998 3300046472 Ga0495580_0032486 Ga0495580_0032486_1261_2727 488
999 3300046472 Ga0495580_0046976 Ga0495580_0046976_1114_2580 488
1000 3300046472 Ga0495580_0075779 Ga0495580_0075779_267_1733 488
1001 3300046472 Ga0495580_0096718 Ga0495580_0096718_425_1891 488
1002 3300046473 Ga0495582_0000935 Ga0495582_0000935_5802_7268 488
1003 3300046475 Ga0495639_0011733 Ga0495639_0011733_449_1921 488
1004 3300046679 Ga0495623_0021469 Ga0495623_0021469_515_1987 488
1005 3300046683 Ga0495658_0023244 Ga0495658_0023244_715_2181 488
1006 3300048905 Ga0496102_0076778 Ga0496102_0076778_175_1641 488
1007 3300048905 Ga0496102_0233850 Ga0496102_0233850_36_1577 488
1008 3300048908 Ga0496105_0110999 Ga0496105_0110999_259_1731 488
1009 3300048914 Ga0496111_0005463 Ga0496111_0005463_2499_3971 488
1010 3300048915 Ga0496112_0005823 Ga0496112_0005823_5129_6601 488
1011 3300048915 Ga0496112_0046687 Ga0496112_0046687_308_1774 488
1012 3300048915 Ga0496112_0078273 Ga0496112_0078273_156_1622 488
1013 3300048916 Ga0496113_0007338 Ga0496113_0007338_546_2018 488
1014 3300048916 Ga0496113_0096592 Ga0496113_0096592_596_2068 488
1015 3300048916 Ga0496113_0151387 Ga0496113_0151387_19_1485 488
1016 3300050512 nmdc:mga0n895_4619_c1 nmdc:mga0n895_4619_c1_7291_8757 488
1017 3300050512 nmdc:mga0n895_47_c1 nmdc:mga0n895_47_c1_26933_28399 488
1018 3300050512 nmdc:mga0n895_5144_c1 nmdc:mga0n895_5144_c1_8334_9800 488
1019 3300050513 nmdc:mga0rr50_44127_c1 nmdc:mga0rr50_44127_c1_1469_2935 488
1020 3300050513 nmdc:mga0rr50_52457_c1 nmdc:mga0rr50_52457_c1_1280_2752 488
1021 3300050514 nmdc:mga08x19_30070_c1 nmdc:mga08x19_30070_c1_1563_3029 488
1022 3300050514 nmdc:mga08x19_3030_c1 nmdc:mga08x19_3030_c1_881_2353 488
1023 3300050514 nmdc:mga08x19_7303_c1 nmdc:mga08x19_7303_c1_3689_5155 488
1024 3300050514 nmdc:mga08x19_9158_c1 nmdc:mga08x19_9158_c1_3010_4476 488
1025 3300050515 nmdc:mga0a205_1652_c1 nmdc:mga0a205_1652_c1_6644_8110 488
1026 3300050515 nmdc:mga0a205_23451_c1 nmdc:mga0a205_23451_c1_289_1755 488
1027 3300054114 Ga0501084_0045664 Ga0501084_0045664_1180_2646 488
1028 3300001991 JGI24743J22301_10003686 JGI24743J22301_100036862 489
1029 3300002459 JGI24751J29686_10003684 JGI24751J29686_100036842 489
1030 3300005290 Ga0065712_10081078 Ga0065712_100810781 489
1031 3300005327 Ga0070658_10028614 Ga0070658_100286143 489
1032 3300005330 Ga0070690_100006966 Ga0070690_1000069662 489
1033 3300005338 Ga0068868_100012000 Ga0068868_1000120004 489
1034 3300005339 Ga0070660_100011738 Ga0070660_1000117384 489
1035 3300005353 Ga0070669_100031982 Ga0070669_1000319822 489
1036 3300005354 Ga0070675_100017919 Ga0070675_1000179196 489
1037 3300005364 Ga0070673_100043351 Ga0070673_1000433513 489
1038 3300005365 Ga0070688_100007005 Ga0070688_1000070053 489
1039 3300005459 Ga0068867_100004171 Ga0068867_1000041714 489
1040 3300005543 Ga0070672_100007893 Ga0070672_1000078938 489
1041 3300005563 Ga0068855_100091517 Ga0068855_1000915172 489
1042 3300005614 Ga0068856_100023496 Ga0068856_1000234962 489
1043 3300005615 Ga0070702_100001776 Ga0070702_1000017765 489
1044 3300005616 Ga0068852_100004761 Ga0068852_1000047617 489
1045 3300005718 Ga0068866_10028536 Ga0068866_100285363 489
1046 3300005834 Ga0068851_10018430 Ga0068851_100184302 489
1047 3300005844 Ga0068862_100170857 Ga0068862_1001708571 489
1048 3300009098 Ga0105245_10071780 Ga0105245_100717802 489
1049 3300009174 Ga0105241_10062577 Ga0105241_100625772 489
1050 3300009545 Ga0105237_10033561 Ga0105237_100335613 489
1051 3300011119 Ga0105246_10013488 Ga0105246_100134883 489
1052 3300013100 Ga0157373_10005992 Ga0157373_100059924 489
1053 3300013105 Ga0157369_10031967 Ga0157369_100319677 489
1054 3300013297 Ga0157378_10204309 Ga0157378_102043092 489
1055 3300013307 Ga0157372_10193618 Ga0157372_101936182 489
1056 3300014325 Ga0163163_10050996 Ga0163163_100509963 489
1057 3300014968 Ga0157379_10047901 Ga0157379_100479012 489
1058 3300017792 Ga0163161_10009234 Ga0163161_100092342 489
1059 3300025899 Ga0207642_10004968 Ga0207642_100049684 489
1060 3300025901 Ga0207688_10008814 Ga0207688_100088142 489
1061 3300025904 Ga0207647_10010492 Ga0207647_100104927 489
1062 3300025907 Ga0207645_10001602 Ga0207645_100016022 489
1063 3300025908 Ga0207643_10004784 Ga0207643_100047848 489
1064 3300025918 Ga0207662_10002927 Ga0207662_100029278 489
1065 3300025919 Ga0207657_10002030 Ga0207657_100020302 489
1066 3300025920 Ga0207649_10000149 Ga0207649_1000014946 489
1067 3300025923 Ga0207681_10084825 Ga0207681_100848252 489
1068 3300025924 Ga0207694_10151121 Ga0207694_101511211 489
1069 3300025925 Ga0207650_10000442 Ga0207650_1000044215 489
1070 3300025926 Ga0207659_10028334 Ga0207659_100283342 489
1071 3300025933 Ga0207706_10000651 Ga0207706_1000065117 489
1072 3300025936 Ga0207670_10041122 Ga0207670_100411222 489
1073 3300025940 Ga0207691_10005111 Ga0207691_100051117 489
1074 3300025942 Ga0207689_10008927 Ga0207689_100089274 489
1075 3300025944 Ga0207661_10000213 Ga0207661_1000021324 489
1076 3300025945 Ga0207679_10000080 Ga0207679_1000008066 489
1077 3300025960 Ga0207651_10071562 Ga0207651_100715621 489
1078 3300025972 Ga0207668_10011337 Ga0207668_100113372 489
1079 3300026088 Ga0207641_10000432 Ga0207641_1000043215 489
1080 3300026088 Ga0207641_10173207 Ga0207641_101732072 489
1081 3300026089 Ga0207648_10001706 Ga0207648_100017068 489
1082 3300026095 Ga0207676_10000586 Ga0207676_100005869 489
1083 3300026116 Ga0207674_10001107 Ga0207674_1000110718 489
1084 3300026118 Ga0207675_100026225 Ga0207675_1000262252 489
1085 3300026121 Ga0207683_10004817 Ga0207683_100048177 489
1086 3300028379 Ga0268266_10015724 Ga0268266_100157244 489
1087 3300028380 Ga0268265_10006060 Ga0268265_100060604 489
1088 3300048911 Ga0496108_0000228 Ga0496108_0000228_4114_5583 489
1089 3300048912 Ga0496109_0000362 Ga0496109_0000362_4997_6466 489
1090 3300048913 Ga0496110_0001221 Ga0496110_0001221_5972_7441 489
1091 3300048914 Ga0496111_0002551 Ga0496111_0002551_602_2071 489
1092 3300048915 Ga0496112_0000034 Ga0496112_0000034_98083_99552 489
1093 3300048916 Ga0496113_0018008 Ga0496113_0018008_2382_3851 489

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01523

PmbA_TldD_1st

PmbA/TldA metallopeptidase domain 1

20

84

0.99

PF19289

PmbA_TldD_3rd

PmbA/TldA metallopeptidase C-terminal domain

233

495

0.9

PF19290

PmbA_TldD_2nd

PmbA/TldA metallopeptidase central domain

113

228

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vl4-assembly1.cif.gz_B crystal structure of a putative modulator of a dna gyrase (tm0727) from thermotoga maritima msb8 at 1.95 a resolution 0.8499 2 482
1vl4-assembly1.cif.gz_B crystal structure of a putative modulator of a dna gyrase (tm0727) from thermotoga maritima msb8 at 1.95 a resolution 0.8445 2 482
3qtd-assembly2.cif.gz_B crystal structure of putative modulator of gyrase (pmba) from pseudomonas aeruginosa pao1 0.8308 3 481
5njc-assembly2.cif.gz_D e. coli microcin-processing metalloprotease tldd/e (tldd e263a mutant) with hexapeptide bound 0.8231 3 481
5njf-assembly2.cif.gz_C e. coli microcin-processing metalloprotease tldd/e (tldd h262a mutant) with pentapeptide bound 0.8201 1 482
ID Description Score Start End Superfamily
af_P71897_11_222_3.30.2290.10 Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily 0.9395 2 206 3.30.2290.10
af_P71897_11_222_3.30.2290.10 Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily 0.901 2 206 3.30.2290.10
af_Q58403_4_217_3.30.2290.10 Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily 0.901 6 221 3.30.2290.10
af_Q58403_4_217_3.30.2290.10 Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily 0.8772 6 221 3.30.2290.10
1vl4B01 Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily 0.7744 1 223 3.30.2290.10
ID Description Score Start End GO Terms
AF-A0A2V9V9N3-F1-model_v4 Peptidase C69 0.9929 1 488 GO:0005829
GO:0006508
GO:0008237
AF-A0A7C3MA12-F1-model_v4 TldD/PmbA family protein 0.9909 1 481 GO:0005829
GO:0006508
GO:0008237
AF-A0A2V9V9N3-F1-model_v4 Peptidase C69 0.9908 1 488 GO:0005829
GO:0006508
GO:0008237
AF-A0A2V9CAU8-F1-model_v4 Peptidase C69 0.9886 1 249 GO:0005829
GO:0006508
GO:0008237
AF-A0A1H3SFQ0-F1-model_v4 TldD protein 0.9872 1 483 GO:0005829
GO:0006508
GO:0008237

Feature Viewer

pLDDT pTM Quality
95.88 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map