F489924
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1093 | 321 | 1093 | 484 |
Family's Representative Sequence
| Representative Sequence | 3300025924|Ga0207694_10151121|Ga0207694_101511211 |
| Length | 560 |
| Sequence | MKQIAHWALNMANQRGASYADARIVDARSRALATKNGKLGQASDSESLGLGIRVIADGAWGFSASDDLSRDAVEETAARALEIAKASARLKLDAVRLAPEKPVTAEWTTPCQIDPFGISIEQNLELLFAIDKELCAVAGVTLAETNLNFHREEQWFLSTEGTDIHQTKYSTGAGYAAYAFAGSDIQKRSYPSSYGGQWQNKGYELVHELKLLENASRIAEEAVALHKADKCPEGRFTVILEGSQLGLQIHESIGHPIELDRVLGMEANFAGTSFLTLDKLRTLRYGSDLVNVVADARQEHGPGLGTFGFDDEGVPAQCTPIVTNGLFTGYLSSRETAHMVGANRSGGTLRAENWNRLPIIRMTNVSLLPGEKPLTLEQLISDTDNGVYMETNRSWSIDDKRYNFQFGTEIGWEIKNGKRTRMLKNCSYSGITTEFWNSLDAICSRDEWVLWGTPNCGKGQPQQVMGTGHGAAPSRFRNIKVGVIVPYIDVDQNVIRFKDRTVLRIVEVDVEHLAVTTPVSAEIDDDPLMRXXXXLQCRCKIGLCLRRIGIYVAAGRECRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 111 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 112 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 113 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 114 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 115 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 175 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 180 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 181 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 182 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 190 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 191 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 195 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 196 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 197 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 202 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 203 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 204 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 205 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 209 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 219 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 221 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 224 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 225 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 228 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 229 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 230 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 231 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 232 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 233 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 234 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 235 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 236 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 237 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 238 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 239 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 240 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 241 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 242 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 243 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 244 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 245 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 289 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 290 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 291 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 292 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 293 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 296 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 297 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 298 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 299 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 300 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 301 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 302 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.99 |
| Metatranscriptomes | 1.01 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.85 |
| Rhizosphere | 93.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10003686 | 3300001991 | Unclassified | 2445 |
| 2 | JGI24034J26672_10003488 | 3300002239 | Unclassified | 2197 |
| 3 | JGI24751J29686_10003684 | 3300002459 | Bacteria | 3085 |
| 4 | Ga0065712_10081078 | 3300005290 | Unclassified | 3041 |
| 5 | Ga0070658_10028614 | 3300005327 | Bacteria | 4475 |
| 6 | Ga0070683_100000007 | 3300005329 | Bacteria | 342155 |
| 7 | Ga0070683_100014041 | 3300005329 | Bacteria | 6995 |
| 8 | Ga0070683_100023082 | 3300005329 | Bacteria | 5563 |
| 9 | Ga0070683_100030449 | 3300005329 | Bacteria | 4899 |
| 10 | Ga0070683_100039473 | 3300005329 | Bacteria | 4334 |
| 11 | Ga0070683_100046567 | 3300005329 | Bacteria | 4007 |
| 12 | Ga0070683_100072735 | 3300005329 | Bacteria | 3210 |
| 13 | Ga0070683_100089547 | 3300005329 | Bacteria | 2888 |
| 14 | Ga0070690_100006966 | 3300005330 | Bacteria | 6438 |
| 15 | Ga0070690_100065457 | 3300005330 | Bacteria | 2350 |
| 16 | Ga0070670_100004282 | 3300005331 | Bacteria | 11942 |
| 17 | Ga0068869_100005013 | 3300005334 | Bacteria | 8292 |
| 18 | Ga0068869_100167945 | 3300005334 | Bacteria | 1712 |
| 19 | Ga0070680_100005314 | 3300005336 | Bacteria | 9745 |
| 20 | Ga0070680_100019473 | 3300005336 | Bacteria | 5377 |
| 21 | Ga0070680_100111622 | 3300005336 | Bacteria | 2276 |
| 22 | Ga0070680_100193270 | 3300005336 | Bacteria | 1715 |
| 23 | Ga0070682_100086313 | 3300005337 | Bacteria | 2043 |
| 24 | Ga0068868_100007852 | 3300005338 | Bacteria | 7616 |
| 25 | Ga0068868_100012000 | 3300005338 | Bacteria | 6323 |
| 26 | Ga0068868_100048572 | 3300005338 | Bacteria | 3329 |
| 27 | Ga0068868_100085114 | 3300005338 | Bacteria | 2540 |
| 28 | Ga0070660_100011738 | 3300005339 | Bacteria | 6237 |
| 29 | Ga0070660_100044380 | 3300005339 | Bacteria | 3400 |
| 30 | Ga0070691_10013656 | 3300005341 | Bacteria | 3723 |
| 31 | Ga0070692_10048078 | 3300005345 | Bacteria | 2209 |
| 32 | Ga0070669_100031982 | 3300005353 | Unclassified | 3800 |
| 33 | Ga0070675_100017919 | 3300005354 | Bacteria | 5633 |
| 34 | Ga0070673_100043351 | 3300005364 | Unclassified | 3476 |
| 35 | Ga0070688_100007005 | 3300005365 | Bacteria | 6060 |
| 36 | Ga0070688_100010707 | 3300005365 | Bacteria | 5067 |
| 37 | Ga0070709_10000342 | 3300005434 | Bacteria | 29015 |
| 38 | Ga0070709_10000415 | 3300005434 | Bacteria | 25969 |
| 39 | Ga0070709_10002535 | 3300005434 | Bacteria | 9880 |
| 40 | Ga0070709_10005534 | 3300005434 | Bacteria | 6839 |
| 41 | Ga0070709_10008424 | 3300005434 | Bacteria | 5666 |
| 42 | Ga0070709_10029236 | 3300005434 | Bacteria | 3295 |
| 43 | Ga0070709_10051108 | 3300005434 | Unclassified | 2593 |
| 44 | Ga0070709_10083938 | 3300005434 | Unclassified | 2085 |
| 45 | Ga0070709_10095462 | 3300005434 | Unclassified | 1969 |
| 46 | Ga0070714_100005417 | 3300005435 | Bacteria | 9735 |
| 47 | Ga0070714_100006221 | 3300005435 | Bacteria | 9188 |
| 48 | Ga0070714_100020121 | 3300005435 | Bacteria | 5446 |
| 49 | Ga0070714_100037113 | 3300005435 | Bacteria | 4093 |
| 50 | Ga0070714_100040314 | 3300005435 | Bacteria | 3936 |
| 51 | Ga0070714_100048825 | 3300005435 | Bacteria | 3601 |
| 52 | Ga0070714_100087185 | 3300005435 | Bacteria | 2729 |
| 53 | Ga0070714_100088528 | 3300005435 | Bacteria | 2709 |
| 54 | Ga0070714_100093185 | 3300005435 | Bacteria | 2641 |
| 55 | Ga0070714_100097627 | 3300005435 | Bacteria | 2583 |
| 56 | Ga0070713_100000349 | 3300005436 | Bacteria | 30061 |
| 57 | Ga0070713_100000464 | 3300005436 | Bacteria | 25883 |
| 58 | Ga0070713_100004858 | 3300005436 | Bacteria | 9111 |
| 59 | Ga0070713_100007744 | 3300005436 | Bacteria | 7563 |
| 60 | Ga0070713_100009782 | 3300005436 | Bacteria | 6892 |
| 61 | Ga0070713_100016994 | 3300005436 | Bacteria | 5486 |
| 62 | Ga0070713_100027388 | 3300005436 | Bacteria | 4487 |
| 63 | Ga0070713_100034947 | 3300005436 | Bacteria | 4043 |
| 64 | Ga0070713_100064591 | 3300005436 | Bacteria | 3072 |
| 65 | Ga0070713_100072689 | 3300005436 | Bacteria | 2909 |
| 66 | Ga0070713_100090480 | 3300005436 | Bacteria | 2630 |
| 67 | Ga0070713_100126854 | 3300005436 | Bacteria | 2246 |
| 68 | Ga0070713_100134550 | 3300005436 | Bacteria | 2183 |
| 69 | Ga0070713_100174204 | 3300005436 | Unclassified | 1929 |
| 70 | Ga0070713_100206947 | 3300005436 | Bacteria | 1775 |
| 71 | Ga0070710_10012685 | 3300005437 | Bacteria | 4193 |
| 72 | Ga0070710_10015228 | 3300005437 | Bacteria | 3889 |
| 73 | Ga0070710_10052095 | 3300005437 | Bacteria | 2301 |
| 74 | Ga0070711_100003499 | 3300005439 | Bacteria | 9155 |
| 75 | Ga0070711_100003874 | 3300005439 | Bacteria | 8785 |
| 76 | Ga0070711_100017670 | 3300005439 | Bacteria | 4544 |
| 77 | Ga0070711_100068354 | 3300005439 | Bacteria | 2496 |
| 78 | Ga0070711_100086589 | 3300005439 | Bacteria | 2247 |
| 79 | Ga0070711_100102978 | 3300005439 | Bacteria | 2080 |
| 80 | Ga0070711_100119529 | 3300005439 | Bacteria | 1947 |
| 81 | Ga0070705_100000468 | 3300005440 | Bacteria | 23258 |
| 82 | Ga0070694_100096265 | 3300005444 | Unclassified | 2086 |
| 83 | Ga0070708_100000839 | 3300005445 | Bacteria | 23134 |
| 84 | Ga0070708_100001971 | 3300005445 | Bacteria | 15827 |
| 85 | Ga0070708_100006430 | 3300005445 | Bacteria | 9356 |
| 86 | Ga0070708_100006468 | 3300005445 | Bacteria | 9325 |
| 87 | Ga0070708_100044091 | 3300005445 | Bacteria | 3921 |
| 88 | Ga0070708_100077925 | 3300005445 | Bacteria | 2995 |
| 89 | Ga0070708_100159797 | 3300005445 | Unclassified | 2099 |
| 90 | Ga0070708_100242697 | 3300005445 | Bacteria | 1691 |
| 91 | Ga0070663_100026331 | 3300005455 | Bacteria | 3939 |
| 92 | Ga0070681_10000340 | 3300005458 | Bacteria | 37661 |
| 93 | Ga0070681_10001097 | 3300005458 | Bacteria | 23133 |
| 94 | Ga0070681_10017801 | 3300005458 | Bacteria | 7099 |
| 95 | Ga0070681_10061622 | 3300005458 | Unclassified | 3725 |
| 96 | Ga0070681_10080972 | 3300005458 | Bacteria | 3203 |
| 97 | Ga0070681_10157790 | 3300005458 | Bacteria | 2193 |
| 98 | Ga0070681_10160529 | 3300005458 | Bacteria | 2172 |
| 99 | Ga0068867_100004171 | 3300005459 | Bacteria | 10169 |
| 100 | Ga0068867_100018277 | 3300005459 | Bacteria | 4982 |
| 101 | Ga0070685_10015105 | 3300005466 | Bacteria | 4098 |
| 102 | Ga0070706_100000063 | 3300005467 | Bacteria | 129205 |
| 103 | Ga0070706_100000173 | 3300005467 | Bacteria | 81500 |
| 104 | Ga0070706_100001330 | 3300005467 | Bacteria | 26281 |
| 105 | Ga0070706_100002605 | 3300005467 | Bacteria | 18061 |
| 106 | Ga0070706_100006446 | 3300005467 | Bacteria | 11078 |
| 107 | Ga0070706_100018145 | 3300005467 | Bacteria | 6491 |
| 108 | Ga0070706_100025394 | 3300005467 | Bacteria | 5451 |
| 109 | Ga0070706_100040755 | 3300005467 | Bacteria | 4287 |
| 110 | Ga0070706_100053822 | 3300005467 | Bacteria | 3715 |
| 111 | Ga0070706_100085928 | 3300005467 | Bacteria | 2915 |
| 112 | Ga0070707_100000808 | 3300005468 | Bacteria | 30955 |
| 113 | Ga0070707_100000815 | 3300005468 | Bacteria | 30849 |
| 114 | Ga0070707_100001494 | 3300005468 | Bacteria | 22796 |
| 115 | Ga0070707_100003183 | 3300005468 | Bacteria | 15523 |
| 116 | Ga0070707_100009403 | 3300005468 | Bacteria | 9072 |
| 117 | Ga0070707_100009720 | 3300005468 | Bacteria | 8938 |
| 118 | Ga0070707_100023040 | 3300005468 | Bacteria | 5890 |
| 119 | Ga0070707_100036034 | 3300005468 | Bacteria | 4720 |
| 120 | Ga0070707_100055862 | 3300005468 | Bacteria | 3785 |
| 121 | Ga0070707_100125994 | 3300005468 | Archaea | 2488 |
| 122 | Ga0070707_100238346 | 3300005468 | Bacteria | 1771 |
| 123 | Ga0070698_100000002 | 3300005471 | Bacteria | 139184 |
| 124 | Ga0070698_100002711 | 3300005471 | Bacteria | 19475 |
| 125 | Ga0070698_100004166 | 3300005471 | Bacteria | 15899 |
| 126 | Ga0070698_100009217 | 3300005471 | Bacteria | 10592 |
| 127 | Ga0070698_100009390 | 3300005471 | Bacteria | 10489 |
| 128 | Ga0070698_100023346 | 3300005471 | Bacteria | 6466 |
| 129 | Ga0070698_100099640 | 3300005471 | Bacteria | 2879 |
| 130 | Ga0070698_100101060 | 3300005471 | Bacteria | 2856 |
| 131 | Ga0070698_100161281 | 3300005471 | Bacteria | 2186 |
| 132 | Ga0070699_100001260 | 3300005518 | Bacteria | 23321 |
| 133 | Ga0070699_100004975 | 3300005518 | Bacteria | 11715 |
| 134 | Ga0070699_100005395 | 3300005518 | Archaea | 11213 |
| 135 | Ga0070699_100014668 | 3300005518 | Bacteria | 6739 |
| 136 | Ga0070699_100040937 | 3300005518 | Bacteria | 4011 |
| 137 | Ga0070679_100003222 | 3300005530 | Bacteria | 14910 |
| 138 | Ga0070679_100004339 | 3300005530 | Bacteria | 13103 |
| 139 | Ga0070679_100014582 | 3300005530 | Bacteria | 7551 |
| 140 | Ga0070679_100032884 | 3300005530 | Bacteria | 5133 |
| 141 | Ga0070679_100143669 | 3300005530 | Bacteria | 2365 |
| 142 | Ga0070684_100000021 | 3300005535 | Bacteria | 132928 |
| 143 | Ga0070684_100006489 | 3300005535 | Bacteria | 9058 |
| 144 | Ga0070684_100012044 | 3300005535 | Bacteria | 6914 |
| 145 | Ga0070684_100057565 | 3300005535 | Bacteria | 3394 |
| 146 | Ga0070684_100104855 | 3300005535 | Bacteria | 2530 |
| 147 | Ga0070684_100155719 | 3300005535 | Bacteria | 2072 |
| 148 | Ga0070697_100000015 | 3300005536 | Bacteria | 143397 |
| 149 | Ga0070697_100000389 | 3300005536 | Bacteria | 34237 |
| 150 | Ga0070697_100001978 | 3300005536 | Bacteria | 15681 |
| 151 | Ga0070697_100002164 | 3300005536 | Bacteria | 15055 |
| 152 | Ga0070697_100009479 | 3300005536 | Archaea | 7609 |
| 153 | Ga0070697_100012622 | 3300005536 | Bacteria | 6617 |
| 154 | Ga0070697_100013157 | 3300005536 | Bacteria | 6488 |
| 155 | Ga0070697_100015949 | 3300005536 | Bacteria | 5905 |
| 156 | Ga0070697_100031784 | 3300005536 | Unclassified | 4247 |
| 157 | Ga0070697_100041007 | 3300005536 | Unclassified | 3746 |
| 158 | Ga0070697_100046900 | 3300005536 | Bacteria | 3503 |
| 159 | Ga0070697_100126628 | 3300005536 | Bacteria | 2140 |
| 160 | Ga0070697_100127096 | 3300005536 | Bacteria | 2136 |
| 161 | Ga0070697_100160984 | 3300005536 | Unclassified | 1896 |
| 162 | Ga0068853_100042750 | 3300005539 | Bacteria | 3876 |
| 163 | Ga0068853_100047205 | 3300005539 | Bacteria | 3695 |
| 164 | Ga0070672_100007893 | 3300005543 | Bacteria | 7266 |
| 165 | Ga0070672_100095253 | 3300005543 | Bacteria | 2407 |
| 166 | Ga0070695_100020180 | 3300005545 | Bacteria | 4068 |
| 167 | Ga0070695_100029186 | 3300005545 | Unclassified | 3426 |
| 168 | Ga0070695_100055457 | 3300005545 | Unclassified | 2554 |
| 169 | Ga0070696_100000158 | 3300005546 | Bacteria | 37863 |
| 170 | Ga0070696_100001999 | 3300005546 | Bacteria | 13376 |
| 171 | Ga0070696_100016914 | 3300005546 | Bacteria | 4920 |
| 172 | Ga0070696_100030717 | 3300005546 | Unclassified | 3680 |
| 173 | Ga0070696_100078062 | 3300005546 | Bacteria | 2340 |
| 174 | Ga0070696_100089507 | 3300005546 | Unclassified | 2189 |
| 175 | Ga0070693_100000065 | 3300005547 | Bacteria | 42786 |
| 176 | Ga0070693_100039811 | 3300005547 | Bacteria | 2635 |
| 177 | Ga0070665_100001525 | 3300005548 | Bacteria | 26822 |
| 178 | Ga0070665_100275668 | 3300005548 | Bacteria | 1684 |
| 179 | Ga0070704_100000207 | 3300005549 | Bacteria | 24460 |
| 180 | Ga0070704_100001301 | 3300005549 | Bacteria | 13201 |
| 181 | Ga0068855_100000514 | 3300005563 | Bacteria | 47680 |
| 182 | Ga0068855_100006580 | 3300005563 | Bacteria | 14125 |
| 183 | Ga0068855_100013304 | 3300005563 | Bacteria | 9926 |
| 184 | Ga0068855_100017550 | 3300005563 | Bacteria | 8606 |
| 185 | Ga0068855_100022860 | 3300005563 | Bacteria | 7494 |
| 186 | Ga0068855_100032688 | 3300005563 | Bacteria | 6211 |
| 187 | Ga0068855_100041740 | 3300005563 | Bacteria | 5436 |
| 188 | Ga0068855_100045845 | 3300005563 | Bacteria | 5169 |
| 189 | Ga0068855_100064896 | 3300005563 | Bacteria | 4258 |
| 190 | Ga0068855_100091517 | 3300005563 | Unclassified | 3508 |
| 191 | Ga0068855_100231229 | 3300005563 | Bacteria | 2070 |
| 192 | Ga0070664_100001065 | 3300005564 | Bacteria | 21596 |
| 193 | Ga0070664_100158701 | 3300005564 | Bacteria | 2000 |
| 194 | Ga0070664_100206070 | 3300005564 | Bacteria | 1756 |
| 195 | Ga0068857_100025348 | 3300005577 | Bacteria | 5221 |
| 196 | Ga0068854_100000010 | 3300005578 | Bacteria | 173462 |
| 197 | Ga0068854_100010143 | 3300005578 | Bacteria | 6103 |
| 198 | Ga0068854_100016041 | 3300005578 | Bacteria | 4984 |
| 199 | Ga0068854_100083367 | 3300005578 | Bacteria | 2364 |
| 200 | Ga0068854_100085082 | 3300005578 | Bacteria | 2341 |
| 201 | Ga0068856_100002688 | 3300005614 | Bacteria | 18226 |
| 202 | Ga0068856_100002732 | 3300005614 | Bacteria | 18063 |
| 203 | Ga0068856_100004305 | 3300005614 | Bacteria | 14208 |
| 204 | Ga0068856_100007427 | 3300005614 | Bacteria | 10694 |
| 205 | Ga0068856_100014465 | 3300005614 | Bacteria | 7624 |
| 206 | Ga0068856_100019599 | 3300005614 | Bacteria | 6566 |
| 207 | Ga0068856_100023496 | 3300005614 | Bacteria | 5994 |
| 208 | Ga0068856_100081384 | 3300005614 | Bacteria | 3213 |
| 209 | Ga0068856_100239830 | 3300005614 | Bacteria | 1828 |
| 210 | Ga0070702_100001776 | 3300005615 | Bacteria | 8958 |
| 211 | Ga0068852_100004761 | 3300005616 | Bacteria | 9638 |
| 212 | Ga0068852_100014167 | 3300005616 | Bacteria | 6125 |
| 213 | Ga0068852_100034018 | 3300005616 | Bacteria | 4238 |
| 214 | Ga0068859_100008790 | 3300005617 | Bacteria | 10198 |
| 215 | Ga0068859_100018009 | 3300005617 | Bacteria | 7097 |
| 216 | Ga0068864_100000466 | 3300005618 | Bacteria | 35031 |
| 217 | Ga0068866_10028536 | 3300005718 | Bacteria | 2660 |
| 218 | Ga0068866_10048944 | 3300005718 | Bacteria | 2139 |
| 219 | Ga0068866_10056358 | 3300005718 | Bacteria | 2021 |
| 220 | Ga0068866_10064889 | 3300005718 | Bacteria | 1908 |
| 221 | Ga0068851_10009283 | 3300005834 | Unclassified | 4566 |
| 222 | Ga0068851_10018430 | 3300005834 | Unclassified | 3361 |
| 223 | Ga0068863_100001330 | 3300005841 | Bacteria | 24613 |
| 224 | Ga0068863_100014350 | 3300005841 | Bacteria | 7630 |
| 225 | Ga0068863_100026901 | 3300005841 | Bacteria | 5486 |
| 226 | Ga0068863_100027217 | 3300005841 | Bacteria | 5452 |
| 227 | Ga0068863_100082210 | 3300005841 | Bacteria | 3052 |
| 228 | Ga0068858_100001017 | 3300005842 | Bacteria | 28912 |
| 229 | Ga0068858_100003905 | 3300005842 | Bacteria | 14724 |
| 230 | Ga0068858_100004164 | 3300005842 | Bacteria | 14231 |
| 231 | Ga0068858_100017610 | 3300005842 | Bacteria | 6697 |
| 232 | Ga0068858_100026410 | 3300005842 | Bacteria | 5396 |
| 233 | Ga0068860_100017683 | 3300005843 | Bacteria | 6946 |
| 234 | Ga0068860_100064272 | 3300005843 | Unclassified | 3486 |
| 235 | Ga0068860_100086236 | 3300005843 | Bacteria | 2988 |
| 236 | Ga0068860_100115139 | 3300005843 | Bacteria | 2571 |
| 237 | Ga0068862_100170857 | 3300005844 | Bacteria | 1946 |
| 238 | Ga0081455_10059710 | 3300005937 | Bacteria | 3218 |
| 239 | Ga0081455_10072539 | 3300005937 | Bacteria | 2850 |
| 240 | Ga0081538_10026741 | 3300005981 | Bacteria | 4025 |
| 241 | Ga0081539_10003804 | 3300005985 | Bacteria | 17766 |
| 242 | Ga0081539_10008689 | 3300005985 | Bacteria | 8742 |
| 243 | Ga0081539_10067069 | 3300005985 | Bacteria | 1942 |
| 244 | Ga0070717_10001227 | 3300006028 | Bacteria | 17447 |
| 245 | Ga0070717_10010164 | 3300006028 | Bacteria | 7089 |
| 246 | Ga0070717_10016939 | 3300006028 | Bacteria | 5661 |
| 247 | Ga0070717_10021861 | 3300006028 | Bacteria | 5047 |
| 248 | Ga0070717_10025498 | 3300006028 | Bacteria | 4703 |
| 249 | Ga0070717_10052211 | 3300006028 | Bacteria | 3367 |
| 250 | Ga0070717_10063584 | 3300006028 | Unclassified | 3063 |
| 251 | Ga0070717_10067061 | 3300006028 | Bacteria | 2985 |
| 252 | Ga0070717_10095760 | 3300006028 | Bacteria | 2513 |
| 253 | Ga0070717_10129222 | 3300006028 | Bacteria | 2171 |
| 254 | Ga0070715_10004069 | 3300006163 | Bacteria | 4749 |
| 255 | Ga0070715_10004165 | 3300006163 | Bacteria | 4705 |
| 256 | Ga0070716_100004195 | 3300006173 | Bacteria | 6855 |
| 257 | Ga0070716_100004349 | 3300006173 | Bacteria | 6762 |
| 258 | Ga0070716_100007388 | 3300006173 | Bacteria | 5406 |
| 259 | Ga0070716_100008396 | 3300006173 | Bacteria | 5122 |
| 260 | Ga0070716_100010833 | 3300006173 | Bacteria | 4585 |
| 261 | Ga0070716_100027213 | 3300006173 | Unclassified | 3069 |
| 262 | Ga0070716_100096768 | 3300006173 | Unclassified | 1800 |
| 263 | Ga0070712_100000401 | 3300006175 | Bacteria | 24660 |
| 264 | Ga0070712_100000586 | 3300006175 | Bacteria | 21238 |
| 265 | Ga0070712_100003006 | 3300006175 | Bacteria | 10438 |
| 266 | Ga0070712_100004555 | 3300006175 | Bacteria | 8559 |
| 267 | Ga0070712_100016090 | 3300006175 | Bacteria | 4827 |
| 268 | Ga0070712_100044874 | 3300006175 | Bacteria | 3049 |
| 269 | Ga0070712_100052070 | 3300006175 | Bacteria | 2854 |
| 270 | Ga0070712_100054559 | 3300006175 | Unclassified | 2794 |
| 271 | Ga0070712_100075357 | 3300006175 | Bacteria | 2426 |
| 272 | Ga0097621_100001928 | 3300006237 | Bacteria | 14158 |
| 273 | Ga0097621_100005841 | 3300006237 | Bacteria | 8693 |
| 274 | Ga0097621_100036487 | 3300006237 | Unclassified | 3933 |
| 275 | Ga0097621_100067811 | 3300006237 | Bacteria | 2941 |
| 276 | Ga0097621_100072133 | 3300006237 | Bacteria | 2856 |
| 277 | Ga0068871_100000058 | 3300006358 | Bacteria | 59490 |
| 278 | Ga0068871_100002915 | 3300006358 | Bacteria | 11730 |
| 279 | Ga0068871_100006073 | 3300006358 | Bacteria | 8499 |
| 280 | Ga0068871_100030270 | 3300006358 | Bacteria | 4261 |
| 281 | Ga0068871_100032706 | 3300006358 | Unclassified | 4112 |
| 282 | Ga0075428_100063842 | 3300006844 | Bacteria | 4032 |
| 283 | Ga0075430_100003335 | 3300006846 | Bacteria | 13447 |
| 284 | Ga0075430_100018493 | 3300006846 | Bacteria | 5930 |
| 285 | Ga0075430_100038276 | 3300006846 | Unclassified | 4063 |
| 286 | Ga0075430_100047424 | 3300006846 | Bacteria | 3628 |
| 287 | Ga0075431_100003894 | 3300006847 | Bacteria | 14530 |
| 288 | Ga0075431_100040689 | 3300006847 | Bacteria | 4790 |
| 289 | Ga0075431_100124670 | 3300006847 | Bacteria | 2658 |
| 290 | Ga0075431_100134681 | 3300006847 | Bacteria | 2547 |
| 291 | Ga0075433_10000901 | 3300006852 | Bacteria | 20949 |
| 292 | Ga0075433_10003804 | 3300006852 | Bacteria | 11687 |
| 293 | Ga0075433_10018081 | 3300006852 | Bacteria | 5852 |
| 294 | Ga0075433_10022629 | 3300006852 | Bacteria | 5278 |
| 295 | Ga0075433_10068654 | 3300006852 | Bacteria | 3112 |
| 296 | Ga0075434_100000140 | 3300006871 | Bacteria | 44001 |
| 297 | Ga0075434_100000987 | 3300006871 | Bacteria | 23010 |
| 298 | Ga0075434_100002070 | 3300006871 | Bacteria | 17440 |
| 299 | Ga0075434_100006334 | 3300006871 | Bacteria | 10850 |
| 300 | Ga0075434_100021397 | 3300006871 | Bacteria | 6285 |
| 301 | Ga0075434_100024946 | 3300006871 | Bacteria | 5847 |
| 302 | Ga0075434_100035108 | 3300006871 | Bacteria | 4956 |
| 303 | Ga0075434_100036065 | 3300006871 | Bacteria | 4890 |
| 304 | Ga0075434_100047370 | 3300006871 | Bacteria | 4266 |
| 305 | Ga0075434_100072082 | 3300006871 | Bacteria | 3446 |
| 306 | Ga0075434_100257451 | 3300006871 | Bacteria | 1764 |
| 307 | Ga0075429_100000530 | 3300006880 | Bacteria | 28977 |
| 308 | Ga0075429_100141745 | 3300006880 | Unclassified | 2104 |
| 309 | Ga0068865_100091462 | 3300006881 | Bacteria | 2208 |
| 310 | Ga0075436_100001850 | 3300006914 | Bacteria | 14520 |
| 311 | Ga0075436_100002747 | 3300006914 | Bacteria | 12099 |
| 312 | Ga0075436_100004935 | 3300006914 | Bacteria | 9165 |
| 313 | Ga0075436_100006615 | 3300006914 | Bacteria | 7943 |
| 314 | Ga0075436_100010290 | 3300006914 | Bacteria | 6404 |
| 315 | Ga0075436_100015558 | 3300006914 | Bacteria | 5208 |
| 316 | Ga0075436_100017439 | 3300006914 | Bacteria | 4916 |
| 317 | Ga0075436_100024752 | 3300006914 | Bacteria | 4128 |
| 318 | Ga0075436_100034305 | 3300006914 | Unclassified | 3499 |
| 319 | Ga0075436_100088506 | 3300006914 | Bacteria | 2151 |
| 320 | Ga0075436_100124548 | 3300006914 | Bacteria | 1805 |
| 321 | Ga0097620_100008790 | 3300006931 | Bacteria | 10198 |
| 322 | Ga0097620_100018009 | 3300006931 | Bacteria | 7097 |
| 323 | Ga0075435_100002553 | 3300007076 | Bacteria | 12129 |
| 324 | Ga0075435_100052451 | 3300007076 | Bacteria | 3288 |
| 325 | Ga0075435_100055269 | 3300007076 | Bacteria | 3206 |
| 326 | Ga0075435_100085774 | 3300007076 | Bacteria | 2592 |
| 327 | Ga0075435_100161802 | 3300007076 | Bacteria | 1886 |
| 328 | Ga0099794_10012827 | 3300007265 | Bacteria | 3631 |
| 329 | Ga0099794_10037928 | 3300007265 | Unclassified | 2282 |
| 330 | Ga0105240_10000948 | 3300009093 | Bacteria | 51646 |
| 331 | Ga0105240_10001342 | 3300009093 | Bacteria | 42197 |
| 332 | Ga0105240_10010328 | 3300009093 | Bacteria | 13136 |
| 333 | Ga0105240_10011876 | 3300009093 | Bacteria | 12085 |
| 334 | Ga0105240_10016500 | 3300009093 | Bacteria | 9997 |
| 335 | Ga0105240_10025672 | 3300009093 | Bacteria | 7739 |
| 336 | Ga0105240_10033712 | 3300009093 | Bacteria | 6612 |
| 337 | Ga0105240_10041454 | 3300009093 | Bacteria | 5877 |
| 338 | Ga0105240_10057336 | 3300009093 | Bacteria | 4867 |
| 339 | Ga0105240_10058901 | 3300009093 | Bacteria | 4794 |
| 340 | Ga0105240_10062556 | 3300009093 | Bacteria | 4633 |
| 341 | Ga0105240_10082066 | 3300009093 | Bacteria | 3959 |
| 342 | Ga0105240_10166595 | 3300009093 | Unclassified | 2613 |
| 343 | Ga0105240_10201088 | 3300009093 | Bacteria | 2335 |
| 344 | Ga0105240_10229670 | 3300009093 | Bacteria | 2157 |
| 345 | Ga0111539_10000378 | 3300009094 | Bacteria | 55103 |
| 346 | Ga0111539_10307441 | 3300009094 | Bacteria | 1845 |
| 347 | Ga0105245_10002938 | 3300009098 | Bacteria | 15306 |
| 348 | Ga0105245_10025367 | 3300009098 | Bacteria | 5213 |
| 349 | Ga0105245_10025823 | 3300009098 | Bacteria | 5166 |
| 350 | Ga0105245_10048797 | 3300009098 | Bacteria | 3788 |
| 351 | Ga0105245_10068593 | 3300009098 | Bacteria | 3214 |
| 352 | Ga0105245_10069721 | 3300009098 | Bacteria | 3188 |
| 353 | Ga0105245_10071780 | 3300009098 | Unclassified | 3145 |
| 354 | Ga0114129_10000075 | 3300009147 | Bacteria | 91461 |
| 355 | Ga0114129_10040059 | 3300009147 | Bacteria | 6607 |
| 356 | Ga0114129_10308329 | 3300009147 | Bacteria | 2108 |
| 357 | Ga0114129_10341170 | 3300009147 | Bacteria | 1987 |
| 358 | Ga0105241_10051512 | 3300009174 | Bacteria | 3140 |
| 359 | Ga0105241_10062577 | 3300009174 | Bacteria | 2869 |
| 360 | Ga0105241_10074141 | 3300009174 | Bacteria | 2650 |
| 361 | Ga0105241_10086825 | 3300009174 | Bacteria | 2461 |
| 362 | Ga0105248_10046507 | 3300009177 | Bacteria | 4864 |
| 363 | Ga0105248_10193671 | 3300009177 | Bacteria | 2290 |
| 364 | Ga0105237_10001632 | 3300009545 | Bacteria | 29125 |
| 365 | Ga0105237_10009361 | 3300009545 | Bacteria | 10493 |
| 366 | Ga0105237_10023109 | 3300009545 | Bacteria | 6375 |
| 367 | Ga0105237_10033561 | 3300009545 | Bacteria | 5200 |
| 368 | Ga0105237_10129759 | 3300009545 | Unclassified | 2515 |
| 369 | Ga0105237_10131539 | 3300009545 | Bacteria | 2497 |
| 370 | Ga0105238_10000419 | 3300009551 | Bacteria | 44758 |
| 371 | Ga0105238_10020549 | 3300009551 | Bacteria | 6723 |
| 372 | Ga0105238_10224602 | 3300009551 | Bacteria | 1854 |
| 373 | Ga0105239_10009924 | 3300010375 | Bacteria | 10689 |
| 374 | Ga0105239_10082527 | 3300010375 | Bacteria | 3540 |
| 375 | Ga0105239_10151276 | 3300010375 | Bacteria | 2590 |
| 376 | Ga0105246_10013488 | 3300011119 | Bacteria | 5124 |
| 377 | Ga0157373_10002219 | 3300013100 | Bacteria | 14694 |
| 378 | Ga0157373_10005992 | 3300013100 | Bacteria | 9094 |
| 379 | Ga0157371_10027086 | 3300013102 | Bacteria | 4161 |
| 380 | Ga0157370_10007410 | 3300013104 | Bacteria | 11948 |
| 381 | Ga0157370_10026110 | 3300013104 | Bacteria | 5771 |
| 382 | Ga0157370_10059913 | 3300013104 | Unclassified | 3616 |
| 383 | Ga0157369_10001273 | 3300013105 | Bacteria | 31309 |
| 384 | Ga0157369_10028229 | 3300013105 | Bacteria | 6212 |
| 385 | Ga0157369_10031967 | 3300013105 | Bacteria | 5790 |
| 386 | Ga0157369_10035694 | 3300013105 | Bacteria | 5450 |
| 387 | Ga0157369_10056145 | 3300013105 | Bacteria | 4249 |
| 388 | Ga0157369_10089556 | 3300013105 | Bacteria | 3285 |
| 389 | Ga0157369_10104530 | 3300013105 | Unclassified | 3015 |
| 390 | Ga0157369_10180322 | 3300013105 | Bacteria | 2222 |
| 391 | Ga0157374_10000236 | 3300013296 | Bacteria | 51341 |
| 392 | Ga0157374_10000722 | 3300013296 | Bacteria | 28854 |
| 393 | Ga0157374_10000771 | 3300013296 | Bacteria | 28014 |
| 394 | Ga0157374_10002785 | 3300013296 | Bacteria | 14683 |
| 395 | Ga0157374_10247418 | 3300013296 | Bacteria | 1754 |
| 396 | Ga0157378_10000119 | 3300013297 | Bacteria | 75908 |
| 397 | Ga0157378_10001314 | 3300013297 | Bacteria | 22359 |
| 398 | Ga0157378_10001479 | 3300013297 | Bacteria | 21219 |
| 399 | Ga0157378_10002703 | 3300013297 | Bacteria | 15805 |
| 400 | Ga0157378_10003622 | 3300013297 | Bacteria | 13669 |
| 401 | Ga0157378_10012740 | 3300013297 | Bacteria | 7360 |
| 402 | Ga0157378_10028050 | 3300013297 | Bacteria | 4965 |
| 403 | Ga0157378_10036101 | 3300013297 | Bacteria | 4374 |
| 404 | Ga0157378_10204309 | 3300013297 | Bacteria | 1870 |
| 405 | Ga0157378_10243375 | 3300013297 | Bacteria | 1719 |
| 406 | Ga0163162_10031676 | 3300013306 | Bacteria | 5245 |
| 407 | Ga0157372_10000497 | 3300013307 | Bacteria | 43246 |
| 408 | Ga0157372_10000995 | 3300013307 | Bacteria | 30940 |
| 409 | Ga0157372_10002841 | 3300013307 | Bacteria | 18717 |
| 410 | Ga0157372_10004064 | 3300013307 | Bacteria | 15685 |
| 411 | Ga0157372_10006842 | 3300013307 | Bacteria | 12129 |
| 412 | Ga0157372_10050540 | 3300013307 | Unclassified | 4624 |
| 413 | Ga0157372_10193618 | 3300013307 | Unclassified | 2355 |
| 414 | Ga0157375_10105183 | 3300013308 | Bacteria | 2912 |
| 415 | Ga0163163_10050996 | 3300014325 | Bacteria | 4078 |
| 416 | Ga0163163_10092351 | 3300014325 | Bacteria | 3042 |
| 417 | Ga0157380_10084763 | 3300014326 | Bacteria | 2599 |
| 418 | Ga0182008_10002320 | 3300014497 | Bacteria | 11988 |
| 419 | Ga0157377_10006251 | 3300014745 | Bacteria | 5671 |
| 420 | Ga0157379_10004138 | 3300014968 | Bacteria | 12380 |
| 421 | Ga0157379_10004974 | 3300014968 | Bacteria | 11407 |
| 422 | Ga0157379_10005382 | 3300014968 | Bacteria | 10994 |
| 423 | Ga0157379_10047901 | 3300014968 | Bacteria | 3815 |
| 424 | Ga0157379_10080281 | 3300014968 | Bacteria | 2922 |
| 425 | Ga0157376_10000037 | 3300014969 | Bacteria | 138129 |
| 426 | Ga0157376_10008975 | 3300014969 | Bacteria | 7240 |
| 427 | Ga0157376_10080074 | 3300014969 | Bacteria | 2801 |
| 428 | Ga0157376_10254396 | 3300014969 | Bacteria | 1642 |
| 429 | Ga0182007_10017164 | 3300015262 | Bacteria | 2652 |
| 430 | Ga0163161_10009234 | 3300017792 | Bacteria | 6817 |
| 431 | Ga0206356_10046556 | 3300020070 | Bacteria | 16777 |
| 432 | Ga0206353_10581244 | 3300020082 | Bacteria | 3599 |
| 433 | Ga0206353_12057544 | 3300020082 | Bacteria | 2608 |
| 434 | Ga0213873_10006723 | 3300021358 | Unclassified | 2274 |
| 435 | Ga0213873_10010471 | 3300021358 | Bacteria | 1956 |
| 436 | Ga0213876_10002859 | 3300021384 | Bacteria | 10033 |
| 437 | Ga0213875_10005848 | 3300021388 | Bacteria | 6542 |
| 438 | Ga0213875_10037905 | 3300021388 | Unclassified | 2271 |
| 439 | Ga0224569_101491 | 3300022732 | Bacteria | 1959 |
| 440 | Ga0224572_1006665 | 3300024225 | Bacteria | 2093 |
| 441 | Ga0224572_1012324 | 3300024225 | Bacteria | 1624 |
| 442 | Ga0228598_1000392 | 3300024227 | Bacteria | 8806 |
| 443 | Ga0228598_1002432 | 3300024227 | Bacteria | 4066 |
| 444 | Ga0207692_10041723 | 3300025898 | Bacteria | 2274 |
| 445 | Ga0207642_10004968 | 3300025899 | Bacteria | 4310 |
| 446 | Ga0207642_10068661 | 3300025899 | Bacteria | 1678 |
| 447 | Ga0207688_10008814 | 3300025901 | Bacteria | 5489 |
| 448 | Ga0207647_10000903 | 3300025904 | Bacteria | 22977 |
| 449 | Ga0207647_10010492 | 3300025904 | Bacteria | 6542 |
| 450 | Ga0207685_10009160 | 3300025905 | Bacteria | 2862 |
| 451 | Ga0207685_10021750 | 3300025905 | Unclassified | 2155 |
| 452 | Ga0207699_10000059 | 3300025906 | Bacteria | 94698 |
| 453 | Ga0207699_10003310 | 3300025906 | Bacteria | 7682 |
| 454 | Ga0207699_10006411 | 3300025906 | Bacteria | 5695 |
| 455 | Ga0207699_10008819 | 3300025906 | Bacteria | 4994 |
| 456 | Ga0207699_10020177 | 3300025906 | Bacteria | 3567 |
| 457 | Ga0207699_10039166 | 3300025906 | Unclassified | 2722 |
| 458 | Ga0207699_10075199 | 3300025906 | Unclassified | 2077 |
| 459 | Ga0207699_10124858 | 3300025906 | Bacteria | 1670 |
| 460 | Ga0207645_10001602 | 3300025907 | Bacteria | 18439 |
| 461 | Ga0207643_10004784 | 3300025908 | Bacteria | 7253 |
| 462 | Ga0207705_10016962 | 3300025909 | Bacteria | 5216 |
| 463 | Ga0207684_10000018 | 3300025910 | Bacteria | 361536 |
| 464 | Ga0207684_10000267 | 3300025910 | Bacteria | 77172 |
| 465 | Ga0207684_10001875 | 3300025910 | Bacteria | 21872 |
| 466 | Ga0207684_10016631 | 3300025910 | Bacteria | 6315 |
| 467 | Ga0207684_10033302 | 3300025910 | Unclassified | 4381 |
| 468 | Ga0207684_10034314 | 3300025910 | Bacteria | 4312 |
| 469 | Ga0207684_10072921 | 3300025910 | Bacteria | 2916 |
| 470 | Ga0207654_10021049 | 3300025911 | Unclassified | 3464 |
| 471 | Ga0207654_10054194 | 3300025911 | Bacteria | 2317 |
| 472 | Ga0207654_10085190 | 3300025911 | Bacteria | 1912 |
| 473 | Ga0207707_10033504 | 3300025912 | Bacteria | 4495 |
| 474 | Ga0207707_10056674 | 3300025912 | Bacteria | 3410 |
| 475 | Ga0207707_10062989 | 3300025912 | Bacteria | 3228 |
| 476 | Ga0207707_10085766 | 3300025912 | Bacteria | 2751 |
| 477 | Ga0207707_10093595 | 3300025912 | Unclassified | 2625 |
| 478 | Ga0207707_10124957 | 3300025912 | Bacteria | 2250 |
| 479 | Ga0207695_10005967 | 3300025913 | Bacteria | 15931 |
| 480 | Ga0207695_10008345 | 3300025913 | Bacteria | 12975 |
| 481 | Ga0207695_10010643 | 3300025913 | Bacteria | 11237 |
| 482 | Ga0207695_10012611 | 3300025913 | Bacteria | 10128 |
| 483 | Ga0207695_10021905 | 3300025913 | Bacteria | 7274 |
| 484 | Ga0207695_10047992 | 3300025913 | Bacteria | 4512 |
| 485 | Ga0207695_10082350 | 3300025913 | Bacteria | 3254 |
| 486 | Ga0207695_10102053 | 3300025913 | Unclassified | 2862 |
| 487 | Ga0207695_10165806 | 3300025913 | Bacteria | 2137 |
| 488 | Ga0207671_10004346 | 3300025914 | Bacteria | 13598 |
| 489 | Ga0207671_10012796 | 3300025914 | Bacteria | 6725 |
| 490 | Ga0207693_10000142 | 3300025915 | Bacteria | 65780 |
| 491 | Ga0207693_10000215 | 3300025915 | Bacteria | 53182 |
| 492 | Ga0207693_10001652 | 3300025915 | Bacteria | 19684 |
| 493 | Ga0207693_10002184 | 3300025915 | Bacteria | 17057 |
| 494 | Ga0207693_10005175 | 3300025915 | Bacteria | 10917 |
| 495 | Ga0207693_10007280 | 3300025915 | Bacteria | 9106 |
| 496 | Ga0207693_10012264 | 3300025915 | Bacteria | 6927 |
| 497 | Ga0207693_10012627 | 3300025915 | Bacteria | 6824 |
| 498 | Ga0207693_10052764 | 3300025915 | Bacteria | 3189 |
| 499 | Ga0207693_10065088 | 3300025915 | Bacteria | 2855 |
| 500 | Ga0207693_10066342 | 3300025915 | Bacteria | 2826 |
| 501 | Ga0207663_10000512 | 3300025916 | Bacteria | 17004 |
| 502 | Ga0207663_10003671 | 3300025916 | Bacteria | 7546 |
| 503 | Ga0207663_10008379 | 3300025916 | Bacteria | 5400 |
| 504 | Ga0207663_10024515 | 3300025916 | Bacteria | 3475 |
| 505 | Ga0207663_10072603 | 3300025916 | Bacteria | 2225 |
| 506 | Ga0207663_10085250 | 3300025916 | Bacteria | 2080 |
| 507 | Ga0207663_10086469 | 3300025916 | Bacteria | 2068 |
| 508 | Ga0207660_10012171 | 3300025917 | Bacteria | 5623 |
| 509 | Ga0207660_10035700 | 3300025917 | Unclassified | 3453 |
| 510 | Ga0207662_10002927 | 3300025918 | Bacteria | 8666 |
| 511 | Ga0207657_10001367 | 3300025919 | Bacteria | 26016 |
| 512 | Ga0207657_10002030 | 3300025919 | Bacteria | 21872 |
| 513 | Ga0207657_10077912 | 3300025919 | Bacteria | 2792 |
| 514 | Ga0207649_10000149 | 3300025920 | Bacteria | 57837 |
| 515 | Ga0207652_10003389 | 3300025921 | Bacteria | 13162 |
| 516 | Ga0207652_10009107 | 3300025921 | Bacteria | 7994 |
| 517 | Ga0207652_10014985 | 3300025921 | Bacteria | 6289 |
| 518 | Ga0207652_10018977 | 3300025921 | Bacteria | 5648 |
| 519 | Ga0207652_10032119 | 3300025921 | Unclassified | 4410 |
| 520 | Ga0207652_10075593 | 3300025921 | Bacteria | 2936 |
| 521 | Ga0207646_10000001 | 3300025922 | Bacteria | 1242027 |
| 522 | Ga0207646_10000006 | 3300025922 | Bacteria | 510716 |
| 523 | Ga0207646_10000017 | 3300025922 | Bacteria | 324386 |
| 524 | Ga0207646_10000019 | 3300025922 | Bacteria | 282855 |
| 525 | Ga0207646_10001228 | 3300025922 | Bacteria | 32199 |
| 526 | Ga0207646_10002636 | 3300025922 | Bacteria | 21066 |
| 527 | Ga0207646_10004228 | 3300025922 | Bacteria | 15703 |
| 528 | Ga0207646_10008098 | 3300025922 | Bacteria | 10592 |
| 529 | Ga0207646_10009914 | 3300025922 | Bacteria | 9370 |
| 530 | Ga0207646_10014287 | 3300025922 | Unclassified | 7548 |
| 531 | Ga0207646_10047704 | 3300025922 | Unclassified | 3841 |
| 532 | Ga0207646_10061057 | 3300025922 | Bacteria | 3365 |
| 533 | Ga0207646_10141232 | 3300025922 | Bacteria | 2169 |
| 534 | Ga0207681_10084825 | 3300025923 | Bacteria | 2246 |
| 535 | Ga0207694_10063774 | 3300025924 | Bacteria | 2871 |
| 536 | Ga0207694_10151121 | 3300025924 | Unclassified | 1871 |
| 537 | Ga0207650_10000442 | 3300025925 | Bacteria | 35606 |
| 538 | Ga0207659_10028334 | 3300025926 | Unclassified | 3805 |
| 539 | Ga0207687_10002511 | 3300025927 | Bacteria | 12449 |
| 540 | Ga0207687_10032250 | 3300025927 | Bacteria | 3547 |
| 541 | Ga0207687_10037775 | 3300025927 | Bacteria | 3297 |
| 542 | Ga0207687_10171987 | 3300025927 | Bacteria | 1671 |
| 543 | Ga0207700_10000028 | 3300025928 | Bacteria | 135555 |
| 544 | Ga0207700_10000200 | 3300025928 | Bacteria | 35788 |
| 545 | Ga0207700_10004203 | 3300025928 | Bacteria | 8455 |
| 546 | Ga0207700_10005255 | 3300025928 | Bacteria | 7717 |
| 547 | Ga0207700_10005553 | 3300025928 | Bacteria | 7567 |
| 548 | Ga0207700_10009464 | 3300025928 | Bacteria | 6089 |
| 549 | Ga0207700_10014401 | 3300025928 | Bacteria | 5181 |
| 550 | Ga0207700_10014517 | 3300025928 | Bacteria | 5163 |
| 551 | Ga0207700_10111214 | 3300025928 | Bacteria | 2204 |
| 552 | Ga0207700_10159460 | 3300025928 | Bacteria | 1872 |
| 553 | Ga0207700_10183072 | 3300025928 | Bacteria | 1756 |
| 554 | Ga0207700_10200210 | 3300025928 | Bacteria | 1682 |
| 555 | Ga0207664_10000033 | 3300025929 | Bacteria | 176549 |
| 556 | Ga0207664_10014549 | 3300025929 | Bacteria | 5686 |
| 557 | Ga0207664_10021505 | 3300025929 | Bacteria | 4799 |
| 558 | Ga0207664_10035338 | 3300025929 | Bacteria | 3855 |
| 559 | Ga0207664_10045521 | 3300025929 | Bacteria | 3441 |
| 560 | Ga0207664_10047224 | 3300025929 | Unclassified | 3382 |
| 561 | Ga0207664_10062443 | 3300025929 | Bacteria | 2975 |
| 562 | Ga0207664_10065469 | 3300025929 | Bacteria | 2910 |
| 563 | Ga0207664_10072894 | 3300025929 | Bacteria | 2770 |
| 564 | Ga0207706_10000651 | 3300025933 | Bacteria | 36655 |
| 565 | Ga0207706_10013270 | 3300025933 | Bacteria | 7496 |
| 566 | Ga0207686_10053038 | 3300025934 | Unclassified | 2534 |
| 567 | Ga0207686_10071236 | 3300025934 | Unclassified | 2236 |
| 568 | Ga0207709_10077835 | 3300025935 | Bacteria | 2127 |
| 569 | Ga0207709_10120402 | 3300025935 | Bacteria | 1771 |
| 570 | Ga0207670_10041122 | 3300025936 | Unclassified | 3038 |
| 571 | Ga0207704_10100559 | 3300025938 | Unclassified | 1926 |
| 572 | Ga0207665_10000086 | 3300025939 | Bacteria | 60660 |
| 573 | Ga0207665_10000313 | 3300025939 | Bacteria | 33592 |
| 574 | Ga0207665_10005910 | 3300025939 | Bacteria | 8145 |
| 575 | Ga0207665_10007051 | 3300025939 | Bacteria | 7441 |
| 576 | Ga0207665_10007816 | 3300025939 | Bacteria | 7058 |
| 577 | Ga0207665_10012072 | 3300025939 | Bacteria | 5670 |
| 578 | Ga0207665_10012828 | 3300025939 | Bacteria | 5511 |
| 579 | Ga0207665_10015989 | 3300025939 | Bacteria | 4927 |
| 580 | Ga0207665_10016855 | 3300025939 | Bacteria | 4798 |
| 581 | Ga0207665_10049177 | 3300025939 | Bacteria | 2832 |
| 582 | Ga0207691_10005111 | 3300025940 | Bacteria | 12662 |
| 583 | Ga0207711_10047104 | 3300025941 | Bacteria | 3685 |
| 584 | Ga0207689_10000788 | 3300025942 | Bacteria | 30435 |
| 585 | Ga0207689_10008927 | 3300025942 | Bacteria | 8691 |
| 586 | Ga0207689_10098509 | 3300025942 | Bacteria | 2402 |
| 587 | Ga0207661_10000010 | 3300025944 | Bacteria | 375338 |
| 588 | Ga0207661_10000213 | 3300025944 | Bacteria | 37493 |
| 589 | Ga0207661_10019337 | 3300025944 | Bacteria | 5076 |
| 590 | Ga0207661_10021196 | 3300025944 | Bacteria | 4869 |
| 591 | Ga0207661_10022102 | 3300025944 | Bacteria | 4782 |
| 592 | Ga0207661_10044423 | 3300025944 | Bacteria | 3512 |
| 593 | Ga0207661_10089568 | 3300025944 | Bacteria | 2560 |
| 594 | Ga0207679_10000080 | 3300025945 | Bacteria | 84997 |
| 595 | Ga0207679_10103673 | 3300025945 | Bacteria | 2230 |
| 596 | Ga0207667_10000103 | 3300025949 | Bacteria | 135265 |
| 597 | Ga0207667_10000669 | 3300025949 | Bacteria | 44388 |
| 598 | Ga0207667_10018202 | 3300025949 | Bacteria | 7884 |
| 599 | Ga0207667_10025711 | 3300025949 | Bacteria | 6440 |
| 600 | Ga0207667_10030236 | 3300025949 | Bacteria | 5861 |
| 601 | Ga0207667_10054355 | 3300025949 | Bacteria | 4212 |
| 602 | Ga0207651_10071562 | 3300025960 | Bacteria | 2458 |
| 603 | Ga0207668_10011337 | 3300025972 | Bacteria | 5412 |
| 604 | Ga0207640_10000004 | 3300025981 | Bacteria | 489403 |
| 605 | Ga0207640_10038070 | 3300025981 | Bacteria | 3032 |
| 606 | Ga0207640_10163867 | 3300025981 | Bacteria | 1648 |
| 607 | Ga0207677_10009387 | 3300026023 | Bacteria | 5506 |
| 608 | Ga0207677_10039356 | 3300026023 | Bacteria | 3108 |
| 609 | Ga0207677_10043120 | 3300026023 | Bacteria | 2997 |
| 610 | Ga0207703_10004814 | 3300026035 | Bacteria | 10991 |
| 611 | Ga0207703_10018012 | 3300026035 | Bacteria | 5515 |
| 612 | Ga0207703_10021177 | 3300026035 | Bacteria | 5089 |
| 613 | Ga0207703_10054106 | 3300026035 | Bacteria | 3263 |
| 614 | Ga0207639_10066021 | 3300026041 | Bacteria | 2811 |
| 615 | Ga0207639_10080999 | 3300026041 | Bacteria | 2570 |
| 616 | Ga0207708_10005782 | 3300026075 | Bacteria | 9141 |
| 617 | Ga0207702_10000479 | 3300026078 | Bacteria | 44958 |
| 618 | Ga0207702_10001512 | 3300026078 | Bacteria | 22980 |
| 619 | Ga0207702_10014206 | 3300026078 | Bacteria | 6613 |
| 620 | Ga0207702_10015860 | 3300026078 | Bacteria | 6239 |
| 621 | Ga0207702_10021274 | 3300026078 | Bacteria | 5368 |
| 622 | Ga0207702_10117725 | 3300026078 | Bacteria | 2373 |
| 623 | Ga0207702_10131588 | 3300026078 | Unclassified | 2252 |
| 624 | Ga0207641_10000432 | 3300026088 | Bacteria | 48190 |
| 625 | Ga0207641_10004436 | 3300026088 | Bacteria | 12159 |
| 626 | Ga0207641_10016632 | 3300026088 | Bacteria | 6023 |
| 627 | Ga0207641_10094134 | 3300026088 | Bacteria | 2627 |
| 628 | Ga0207641_10173207 | 3300026088 | Unclassified | 1972 |
| 629 | Ga0207648_10001706 | 3300026089 | Bacteria | 24036 |
| 630 | Ga0207648_10016467 | 3300026089 | Bacteria | 6752 |
| 631 | Ga0207648_10022244 | 3300026089 | Bacteria | 5696 |
| 632 | Ga0207648_10073743 | 3300026089 | Bacteria | 2974 |
| 633 | Ga0207676_10000586 | 3300026095 | Bacteria | 29950 |
| 634 | Ga0207676_10030079 | 3300026095 | Bacteria | 4072 |
| 635 | Ga0207676_10057830 | 3300026095 | Bacteria | 3056 |
| 636 | Ga0207674_10001107 | 3300026116 | Bacteria | 35021 |
| 637 | Ga0207674_10002438 | 3300026116 | Bacteria | 23491 |
| 638 | Ga0207675_100026225 | 3300026118 | Bacteria | 5425 |
| 639 | Ga0207683_10004817 | 3300026121 | Bacteria | 11622 |
| 640 | Ga0207683_10012241 | 3300026121 | Bacteria | 7323 |
| 641 | Ga0207698_10041191 | 3300026142 | Bacteria | 3439 |
| 642 | Ga0207698_10132012 | 3300026142 | Bacteria | 2136 |
| 643 | Ga0209588_1001140 | 3300027671 | Unclassified | 6845 |
| 644 | Ga0209588_1002962 | 3300027671 | Archaea | 4668 |
| 645 | Ga0209588_1016358 | 3300027671 | Unclassified | 2289 |
| 646 | Ga0207428_10001476 | 3300027907 | Bacteria | 24616 |
| 647 | Ga0207428_10182454 | 3300027907 | Bacteria | 1585 |
| 648 | Ga0265354_1001572 | 3300028016 | Bacteria | 3206 |
| 649 | Ga0265356_1000078 | 3300028017 | Bacteria | 16086 |
| 650 | Ga0268266_10000736 | 3300028379 | Bacteria | 43813 |
| 651 | Ga0268266_10015724 | 3300028379 | Bacteria | 6480 |
| 652 | Ga0268265_10006060 | 3300028380 | Bacteria | 8213 |
| 653 | Ga0268264_10004389 | 3300028381 | Bacteria | 12037 |
| 654 | Ga0265319_1000256 | 3300028563 | Bacteria | 40127 |
| 655 | Ga0265318_10000240 | 3300028577 | Bacteria | 47828 |
| 656 | Ga0265323_10000266 | 3300028653 | Bacteria | 30603 |
| 657 | Ga0265338_10002910 | 3300028800 | Bacteria | 24891 |
| 658 | Ga0265338_10012494 | 3300028800 | Bacteria | 9677 |
| 659 | Ga0265338_10019564 | 3300028800 | Bacteria | 7174 |
| 660 | Ga0265338_10034628 | 3300028800 | Bacteria | 4876 |
| 661 | Ga0265338_10046890 | 3300028800 | Bacteria | 3953 |
| 662 | Ga0265324_10032731 | 3300029957 | Bacteria | 1816 |
| 663 | Ga0265762_1000283 | 3300030760 | Bacteria | 8455 |
| 664 | Ga0265762_1001021 | 3300030760 | Bacteria | 5031 |
| 665 | Ga0265770_1003384 | 3300030878 | Unclassified | 2167 |
| 666 | Ga0265770_1003400 | 3300030878 | Unclassified | 2164 |
| 667 | Ga0265760_10000014 | 3300031090 | Bacteria | 93274 |
| 668 | Ga0265760_10000599 | 3300031090 | Bacteria | 10250 |
| 669 | Ga0265760_10006515 | 3300031090 | Bacteria | 3339 |
| 670 | Ga0265760_10008310 | 3300031090 | Bacteria | 2969 |
| 671 | Ga0265330_10000124 | 3300031235 | Bacteria | 63181 |
| 672 | Ga0265332_10000212 | 3300031238 | Bacteria | 47356 |
| 673 | Ga0265332_10013007 | 3300031238 | Bacteria | 3690 |
| 674 | Ga0265320_10000124 | 3300031240 | Bacteria | 67180 |
| 675 | Ga0265325_10002766 | 3300031241 | Bacteria | 11713 |
| 676 | Ga0265325_10007723 | 3300031241 | Bacteria | 6409 |
| 677 | Ga0265325_10008141 | 3300031241 | Bacteria | 6210 |
| 678 | Ga0265325_10019981 | 3300031241 | Bacteria | 3696 |
| 679 | Ga0265329_10000224 | 3300031242 | Bacteria | 30023 |
| 680 | Ga0265329_10001260 | 3300031242 | Bacteria | 12378 |
| 681 | Ga0265329_10004592 | 3300031242 | Bacteria | 5708 |
| 682 | Ga0265339_10008695 | 3300031249 | Bacteria | 6443 |
| 683 | Ga0265339_10015636 | 3300031249 | Bacteria | 4544 |
| 684 | Ga0265331_10000232 | 3300031250 | Bacteria | 67206 |
| 685 | Ga0265331_10006150 | 3300031250 | Bacteria | 7137 |
| 686 | Ga0265331_10006875 | 3300031250 | Bacteria | 6648 |
| 687 | Ga0265331_10011108 | 3300031250 | Bacteria | 4940 |
| 688 | Ga0265331_10021036 | 3300031250 | Bacteria | 3342 |
| 689 | Ga0265316_10000007 | 3300031344 | Bacteria | 264584 |
| 690 | Ga0265316_10008501 | 3300031344 | Bacteria | 9520 |
| 691 | Ga0265316_10008528 | 3300031344 | Bacteria | 9503 |
| 692 | Ga0265316_10009247 | 3300031344 | Bacteria | 9073 |
| 693 | Ga0265316_10010940 | 3300031344 | Bacteria | 8236 |
| 694 | Ga0265316_10013105 | 3300031344 | Bacteria | 7388 |
| 695 | Ga0265316_10013551 | 3300031344 | Bacteria | 7235 |
| 696 | Ga0265316_10029090 | 3300031344 | Bacteria | 4548 |
| 697 | Ga0265316_10029993 | 3300031344 | Bacteria | 4465 |
| 698 | Ga0265316_10050246 | 3300031344 | Bacteria | 3280 |
| 699 | Ga0307509_10227982 | 3300031507 | Bacteria | 1669 |
| 700 | Ga0307408_100017695 | 3300031548 | Bacteria | 4774 |
| 701 | Ga0265313_10008047 | 3300031595 | Bacteria | 7062 |
| 702 | Ga0265313_10017232 | 3300031595 | Bacteria | 4114 |
| 703 | Ga0265314_10000005 | 3300031711 | Bacteria | 668532 |
| 704 | Ga0265314_10005337 | 3300031711 | Bacteria | 11620 |
| 705 | Ga0265314_10008097 | 3300031711 | Bacteria | 9046 |
| 706 | Ga0265314_10016579 | 3300031711 | Bacteria | 5813 |
| 707 | Ga0265342_10000198 | 3300031712 | Bacteria | 67185 |
| 708 | Ga0265342_10003025 | 3300031712 | Bacteria | 14081 |
| 709 | Ga0265342_10021252 | 3300031712 | Bacteria | 4148 |
| 710 | Ga0307405_10033555 | 3300031731 | Bacteria | 3046 |
| 711 | Ga0307410_10005364 | 3300031852 | Bacteria | 6780 |
| 712 | Ga0307410_10015059 | 3300031852 | Bacteria | 4575 |
| 713 | Ga0307410_10101587 | 3300031852 | Bacteria | 2062 |
| 714 | Ga0307406_10026117 | 3300031901 | Bacteria | 3503 |
| 715 | Ga0307407_10033504 | 3300031903 | Bacteria | 2804 |
| 716 | Ga0307409_100001703 | 3300031995 | Bacteria | 11079 |
| 717 | Ga0307409_100018582 | 3300031995 | Bacteria | 4679 |
| 718 | Ga0307416_100018090 | 3300032002 | Bacteria | 4954 |
| 719 | Ga0307416_100262449 | 3300032002 | Bacteria | 1689 |
| 720 | Ga0307411_10035413 | 3300032005 | Bacteria | 3117 |
| 721 | Ga0307415_100002586 | 3300032126 | Bacteria | 9041 |
| 722 | Ga0307415_100033357 | 3300032126 | Bacteria | 3342 |
| 723 | Ga0373926_0000639 | 3300035083 | Bacteria | 9547 |
| 724 | Ga0373926_0003830 | 3300035083 | Bacteria | 4909 |
| 725 | Ga0373934_0033772 | 3300035086 | Unclassified | 2009 |
| 726 | Ga0373945_0000689 | 3300035116 | Bacteria | 9757 |
| 727 | Ga0373945_0010362 | 3300035116 | Bacteria | 3069 |
| 728 | Ga0373954_0000077 | 3300035118 | Bacteria | 34839 |
| 729 | Ga0373954_0035045 | 3300035118 | Bacteria | 2326 |
| 730 | Ga0373956_0017945 | 3300035119 | Bacteria | 2992 |
| 731 | Ga0373943_0001752 | 3300035170 | Bacteria | 9835 |
| 732 | Ga0373943_0022494 | 3300035170 | Bacteria | 2922 |
| 733 | Ga0373943_0058038 | 3300035170 | Bacteria | 1925 |
| 734 | Ga0373955_0000687 | 3300035172 | Bacteria | 14493 |
| 735 | Ga0373924_0000013 | 3300035410 | Bacteria | 44442 |
| 736 | Ga0373924_0003866 | 3300035410 | Bacteria | 5187 |
| 737 | Ga0373931_0019390 | 3300035691 | Unclassified | 3394 |
| 738 | Ga0373931_0022951 | 3300035691 | Bacteria | 3145 |
| 739 | Ga0373931_0073740 | 3300035691 | Bacteria | 1868 |
| 740 | Ga0373935_0003050 | 3300035692 | Bacteria | 9653 |
| 741 | Ga0373935_0017559 | 3300035692 | Bacteria | 4344 |
| 742 | Ga0373935_0055161 | 3300035692 | Bacteria | 2532 |
| 743 | Ga0373935_0105593 | 3300035692 | Bacteria | 1863 |
| 744 | Ga0373935_0159956 | 3300035692 | Bacteria | 1534 |
| 745 | Ga0373927_0000229 | 3300035695 | Bacteria | 44230 |
| 746 | Ga0373927_0000606 | 3300035695 | Bacteria | 27312 |
| 747 | Ga0373927_0001417 | 3300035695 | Bacteria | 18085 |
| 748 | Ga0373927_0002438 | 3300035695 | Bacteria | 13565 |
| 749 | Ga0373927_0007985 | 3300035695 | Bacteria | 7146 |
| 750 | Ga0373927_0022195 | 3300035695 | Bacteria | 4158 |
| 751 | Ga0373927_0024567 | 3300035695 | Bacteria | 3940 |
| 752 | Ga0373927_0043550 | 3300035695 | Bacteria | 2906 |
| 753 | Ga0373927_0066982 | 3300035695 | Bacteria | 2323 |
| 754 | Ga0373927_0096724 | 3300035695 | Bacteria | 1919 |
| 755 | Ga0373933_0000287 | 3300035724 | Bacteria | 32577 |
| 756 | Ga0373933_0006936 | 3300035724 | Bacteria | 6175 |
| 757 | Ga0373933_0011398 | 3300035724 | Unclassified | 4898 |
| 758 | Ga0373947_0002512 | 3300035725 | Bacteria | 11024 |
| 759 | Ga0373947_0003698 | 3300035725 | Bacteria | 9029 |
| 760 | Ga0373947_0008247 | 3300035725 | Bacteria | 6005 |
| 761 | Ga0373947_0009478 | 3300035725 | Bacteria | 5592 |
| 762 | Ga0373947_0011145 | 3300035725 | Bacteria | 5162 |
| 763 | Ga0373937_0000024 | 3300036401 | Bacteria | 125736 |
| 764 | Ga0373937_0000710 | 3300036401 | Bacteria | 29065 |
| 765 | Ga0373937_0000745 | 3300036401 | Bacteria | 28106 |
| 766 | Ga0373937_0010271 | 3300036401 | Bacteria | 8172 |
| 767 | Ga0373937_0018028 | 3300036401 | Bacteria | 6297 |
| 768 | Ga0373937_0025815 | 3300036401 | Bacteria | 5306 |
| 769 | Ga0373937_0028291 | 3300036401 | Bacteria | 5071 |
| 770 | Ga0373937_0031107 | 3300036401 | Bacteria | 4834 |
| 771 | Ga0373937_0042155 | 3300036401 | Bacteria | 4164 |
| 772 | Ga0373937_0066585 | 3300036401 | Bacteria | 3318 |
| 773 | Ga0373937_0109622 | 3300036401 | Bacteria | 2567 |
| 774 | Ga0373937_0122520 | 3300036401 | Unclassified | 2424 |
| 775 | Ga0373925_0000953 | 3300037068 | Bacteria | 26333 |
| 776 | Ga0373925_0003052 | 3300037068 | Bacteria | 13161 |
| 777 | Ga0373925_0004519 | 3300037068 | Bacteria | 10512 |
| 778 | Ga0373925_0019431 | 3300037068 | Bacteria | 4941 |
| 779 | Ga0373925_0021613 | 3300037068 | Bacteria | 4690 |
| 780 | Ga0373925_0026887 | 3300037068 | Bacteria | 4212 |
| 781 | Ga0373925_0110317 | 3300037068 | Bacteria | 2124 |
| 782 | Ga0395899_0001775 | 3300037312 | Bacteria | 17874 |
| 783 | Ga0395899_0015128 | 3300037312 | Bacteria | 5882 |
| 784 | Ga0395900_0016063 | 3300037418 | Bacteria | 7629 |
| 785 | Ga0395900_0031919 | 3300037418 | Bacteria | 5414 |
| 786 | Ga0395900_0048436 | 3300037418 | Bacteria | 4377 |
| 787 | Ga0395900_0065195 | 3300037418 | Bacteria | 3741 |
| 788 | Ga0395900_0086386 | 3300037418 | Bacteria | 3224 |
| 789 | Ga0395898_0013397 | 3300037466 | Bacteria | 8446 |
| 790 | Ga0395898_0017277 | 3300037466 | Bacteria | 7368 |
| 791 | Ga0395898_0103515 | 3300037466 | Bacteria | 2731 |
| 792 | Ga0395905_0005295 | 3300037471 | Bacteria | 13192 |
| 793 | Ga0395905_0010943 | 3300037471 | Bacteria | 8780 |
| 794 | Ga0395905_0014235 | 3300037471 | Bacteria | 7599 |
| 795 | Ga0395905_0036111 | 3300037471 | Bacteria | 4642 |
| 796 | Ga0395905_0060017 | 3300037471 | Bacteria | 3556 |
| 797 | Ga0395905_0077115 | 3300037471 | Bacteria | 3123 |
| 798 | Ga0395905_0268781 | 3300037471 | Unclassified | 1591 |
| 799 | Ga0436364_0241550 | 3300037853 | Bacteria | 8281 |
| 800 | Ga0436364_0276770 | 3300037853 | Bacteria | 13390 |
| 801 | Ga0436364_0355922 | 3300037853 | Bacteria | 1986 |
| 802 | Ga0436364_0417295 | 3300037853 | Unclassified | 3252 |
| 803 | Ga0436364_0970590 | 3300037853 | Bacteria | 7180 |
| 804 | Ga0436364_1507696 | 3300037853 | Bacteria | 3797 |
| 805 | Ga0395901_0003206 | 3300038443 | Bacteria | 16466 |
| 806 | Ga0395901_0054168 | 3300038443 | Bacteria | 4168 |
| 807 | Ga0395901_0120517 | 3300038443 | Bacteria | 2757 |
| 808 | Ga0436365_0018965 | 3300039437 | Unclassified | 13863 |
| 809 | Ga0436365_1500819 | 3300039437 | Bacteria | 8861 |
| 810 | Ga0436360_0493754 | 3300039438 | Bacteria | 5141 |
| 811 | Ga0436360_0894906 | 3300039438 | Bacteria | 3613 |
| 812 | Ga0436360_1147104 | 3300039438 | Bacteria | 1887 |
| 813 | Ga0436361_0450174 | 3300039447 | Unclassified | 15259 |
| 814 | Ga0436361_0588977 | 3300039447 | Bacteria | 11782 |
| 815 | Ga0436361_1150168 | 3300039447 | Bacteria | 5007 |
| 816 | Ga0436363_0128523 | 3300039450 | Bacteria | 2388 |
| 817 | Ga0436363_0468839 | 3300039450 | Unclassified | 1767 |
| 818 | Ga0436363_0490604 | 3300039450 | Bacteria | 3014 |
| 819 | Ga0436363_1030894 | 3300039450 | Bacteria | 2302 |
| 820 | Ga0436362_0157251 | 3300039453 | Unclassified | 2131 |
| 821 | Ga0436362_0488805 | 3300039453 | Bacteria | 2728 |
| 822 | Ga0436362_0746214 | 3300039453 | Bacteria | 4135 |
| 823 | Ga0436362_0800997 | 3300039453 | Bacteria | 1653 |
| 824 | Ga0451577_0020518 | 3300042876 | Bacteria | 6063 |
| 825 | Ga0451577_0027032 | 3300042876 | Bacteria | 5195 |
| 826 | Ga0451577_0076000 | 3300042876 | Bacteria | 2995 |
| 827 | Ga0451577_0083059 | 3300042876 | Bacteria | 2858 |
| 828 | Ga0451577_0162081 | 3300042876 | Bacteria | 2014 |
| 829 | Ga0453683_0001369 | 3300044673 | Bacteria | 21235 |
| 830 | Ga0453683_0008848 | 3300044673 | Bacteria | 6739 |
| 831 | Ga0453683_0020206 | 3300044673 | Bacteria | 4256 |
| 832 | Ga0453683_0035438 | 3300044673 | Bacteria | 3144 |
| 833 | Ga0453683_0037800 | 3300044673 | Bacteria | 3036 |
| 834 | Ga0453683_0070327 | 3300044673 | Unclassified | 2189 |
| 835 | Ga0466966_0089449 | 3300044684 | Bacteria | 1913 |
| 836 | Ga0466963_0005365 | 3300044694 | Bacteria | 7501 |
| 837 | Ga0466963_0090797 | 3300044694 | Unclassified | 2080 |
| 838 | Ga0453684_0000104 | 3300044712 | Bacteria | 365431 |
| 839 | Ga0453684_0001621 | 3300044712 | Bacteria | 61550 |
| 840 | Ga0453684_0035050 | 3300044712 | Bacteria | 6948 |
| 841 | Ga0453684_0043015 | 3300044712 | Bacteria | 6078 |
| 842 | Ga0453684_0055051 | 3300044712 | Bacteria | 5174 |
| 843 | Ga0466957_0000974 | 3300044842 | Bacteria | 14704 |
| 844 | Ga0466960_0000015 | 3300044901 | Bacteria | 56297 |
| 845 | Ga0466959_0004808 | 3300045049 | Bacteria | 9122 |
| 846 | Ga0451576_0000238 | 3300045051 | Bacteria | 134437 |
| 847 | Ga0451576_0005414 | 3300045051 | Bacteria | 16026 |
| 848 | Ga0451576_0019624 | 3300045051 | Bacteria | 7377 |
| 849 | Ga0451576_0020838 | 3300045051 | Bacteria | 7135 |
| 850 | Ga0451576_0036712 | 3300045051 | Bacteria | 5193 |
| 851 | Ga0451576_0108337 | 3300045051 | Bacteria | 2891 |
| 852 | Ga0451576_0185158 | 3300045051 | Bacteria | 2174 |
| 853 | Ga0466958_0019165 | 3300045836 | Bacteria | 3980 |
| 854 | Ga0466958_0072896 | 3300045836 | Bacteria | 2103 |
| 855 | Ga0466958_0104500 | 3300045836 | Bacteria | 1764 |
| 856 | Ga0466958_0142049 | 3300045836 | Unclassified | 1512 |
| 857 | Ga0466967_0002322 | 3300045976 | Bacteria | 11760 |
| 858 | Ga0466967_0004336 | 3300045976 | Bacteria | 9540 |
| 859 | Ga0466967_0005756 | 3300045976 | Bacteria | 8657 |
| 860 | Ga0466967_0035956 | 3300045976 | Unclassified | 4223 |
| 861 | Ga0466967_0043551 | 3300045976 | Bacteria | 3887 |
| 862 | Ga0466967_0101614 | 3300045976 | Bacteria | 2629 |
| 863 | Ga0495603_0031958 | 3300046455 | Unclassified | 3168 |
| 864 | Ga0495629_0097478 | 3300046459 | Unclassified | 2051 |
| 865 | Ga0495651_0000483 | 3300046462 | Bacteria | 30682 |
| 866 | Ga0495651_0003398 | 3300046462 | Bacteria | 12207 |
| 867 | Ga0495651_0007790 | 3300046462 | Bacteria | 8195 |
| 868 | Ga0495651_0014639 | 3300046462 | Bacteria | 6065 |
| 869 | Ga0495651_0035063 | 3300046462 | Bacteria | 3908 |
| 870 | Ga0495651_0080954 | 3300046462 | Bacteria | 2452 |
| 871 | Ga0495653_0017598 | 3300046463 | Bacteria | 5812 |
| 872 | Ga0495653_0030123 | 3300046463 | Bacteria | 4326 |
| 873 | Ga0495580_0000712 | 3300046472 | Bacteria | 28388 |
| 874 | Ga0495580_0000971 | 3300046472 | Bacteria | 25127 |
| 875 | Ga0495580_0001294 | 3300046472 | Bacteria | 22084 |
| 876 | Ga0495580_0001612 | 3300046472 | Bacteria | 19846 |
| 877 | Ga0495580_0001982 | 3300046472 | Bacteria | 18009 |
| 878 | Ga0495580_0002563 | 3300046472 | Bacteria | 15832 |
| 879 | Ga0495580_0003645 | 3300046472 | Bacteria | 13046 |
| 880 | Ga0495580_0006797 | 3300046472 | Bacteria | 9269 |
| 881 | Ga0495580_0013580 | 3300046472 | Bacteria | 6211 |
| 882 | Ga0495580_0032486 | 3300046472 | Bacteria | 3767 |
| 883 | Ga0495580_0036215 | 3300046472 | Bacteria | 3544 |
| 884 | Ga0495580_0042789 | 3300046472 | Unclassified | 3225 |
| 885 | Ga0495580_0046976 | 3300046472 | Bacteria | 3061 |
| 886 | Ga0495580_0048939 | 3300046472 | Bacteria | 2991 |
| 887 | Ga0495580_0075779 | 3300046472 | Unclassified | 2346 |
| 888 | Ga0495580_0086663 | 3300046472 | Bacteria | 2181 |
| 889 | Ga0495580_0096718 | 3300046472 | Bacteria | 2053 |
| 890 | Ga0495582_0000935 | 3300046473 | Bacteria | 16295 |
| 891 | Ga0495582_0010825 | 3300046473 | Bacteria | 5021 |
| 892 | Ga0495582_0027354 | 3300046473 | Bacteria | 3125 |
| 893 | Ga0495639_0011733 | 3300046475 | Bacteria | 3779 |
| 894 | Ga0495639_0013469 | 3300046475 | Bacteria | 3532 |
| 895 | Ga0495664_0030843 | 3300046477 | Unclassified | 3141 |
| 896 | Ga0495664_0055732 | 3300046477 | Bacteria | 2352 |
| 897 | Ga0495664_0082941 | 3300046477 | Bacteria | 1923 |
| 898 | Ga0495585_0040378 | 3300046492 | Bacteria | 2620 |
| 899 | Ga0495608_0012719 | 3300046511 | Bacteria | 5839 |
| 900 | Ga0495608_0013095 | 3300046511 | Bacteria | 5756 |
| 901 | Ga0495608_0080312 | 3300046511 | Bacteria | 2120 |
| 902 | Ga0495608_0114762 | 3300046511 | Bacteria | 1729 |
| 903 | Ga0495628_0066798 | 3300046516 | Unclassified | 2810 |
| 904 | Ga0495628_0186761 | 3300046516 | Bacteria | 1566 |
| 905 | Ga0495630_0045494 | 3300046517 | Bacteria | 3280 |
| 906 | Ga0495630_0056482 | 3300046517 | Bacteria | 2942 |
| 907 | Ga0495663_0023163 | 3300046525 | Bacteria | 1798 |
| 908 | Ga0495652_0001580 | 3300046529 | Bacteria | 24905 |
| 909 | Ga0495665_0036323 | 3300046531 | Bacteria | 2631 |
| 910 | Ga0495665_0052278 | 3300046531 | Bacteria | 2163 |
| 911 | Ga0495640_0014363 | 3300046533 | Bacteria | 5997 |
| 912 | Ga0495640_0050243 | 3300046533 | Bacteria | 2874 |
| 913 | Ga0495640_0068504 | 3300046533 | Bacteria | 2388 |
| 914 | Ga0495640_0147676 | 3300046533 | Bacteria | 1512 |
| 915 | Ga0495586_0002925 | 3300046535 | Bacteria | 9216 |
| 916 | Ga0495586_0098921 | 3300046535 | Bacteria | 1617 |
| 917 | Ga0495587_0011615 | 3300046536 | Bacteria | 5575 |
| 918 | Ga0495587_0016792 | 3300046536 | Bacteria | 4550 |
| 919 | Ga0495587_0057958 | 3300046536 | Unclassified | 2276 |
| 920 | Ga0495645_0015193 | 3300046543 | Bacteria | 5474 |
| 921 | Ga0495645_0070936 | 3300046543 | Bacteria | 2513 |
| 922 | Ga0495667_0010060 | 3300046559 | Bacteria | 6404 |
| 923 | Ga0495667_0016733 | 3300046559 | Bacteria | 4953 |
| 924 | Ga0495667_0062077 | 3300046559 | Bacteria | 2449 |
| 925 | Ga0495656_0000002 | 3300046615 | Bacteria | 353040 |
| 926 | Ga0495634_0009931 | 3300046642 | Bacteria | 6995 |
| 927 | Ga0495635_0006902 | 3300046663 | Bacteria | 7933 |
| 928 | Ga0495635_0049476 | 3300046663 | Bacteria | 2897 |
| 929 | Ga0495659_0018109 | 3300046664 | Bacteria | 2342 |
| 930 | Ga0495657_0087142 | 3300046675 | Bacteria | 2009 |
| 931 | Ga0495599_0021040 | 3300046678 | Bacteria | 4067 |
| 932 | Ga0495623_0021469 | 3300046679 | Bacteria | 4168 |
| 933 | Ga0495623_0029839 | 3300046679 | Bacteria | 3509 |
| 934 | Ga0495623_0033786 | 3300046679 | Bacteria | 3282 |
| 935 | Ga0495623_0035702 | 3300046679 | Bacteria | 3186 |
| 936 | Ga0495623_0067663 | 3300046679 | Bacteria | 2229 |
| 937 | Ga0495646_0083944 | 3300046680 | Bacteria | 1850 |
| 938 | Ga0495658_0000540 | 3300046683 | Bacteria | 20594 |
| 939 | Ga0495658_0020894 | 3300046683 | Bacteria | 3444 |
| 940 | Ga0495658_0023244 | 3300046683 | Bacteria | 3289 |
| 941 | Ga0495613_0018653 | 3300046689 | Bacteria | 5174 |
| 942 | Ga0495670_0061166 | 3300046691 | Bacteria | 1893 |
| 943 | Ga0495600_0012917 | 3300046809 | Bacteria | 5234 |
| 944 | Ga0495600_0058742 | 3300046809 | Unclassified | 2513 |
| 945 | Ga0495581_0053440 | 3300047315 | Bacteria | 2333 |
| 946 | Ga0495581_0071932 | 3300047315 | Unclassified | 2001 |
| 947 | Ga0495604_0000452 | 3300047317 | Bacteria | 36453 |
| 948 | Ga0495604_0001339 | 3300047317 | Bacteria | 20145 |
| 949 | Ga0495604_0006109 | 3300047317 | Bacteria | 9559 |
| 950 | Ga0495604_0037475 | 3300047317 | Bacteria | 3818 |
| 951 | Ga0495604_0048518 | 3300047317 | Unclassified | 3303 |
| 952 | Ga0495604_0050084 | 3300047317 | Bacteria | 3244 |
| 953 | Ga0495604_0084559 | 3300047317 | Bacteria | 2369 |
| 954 | Ga0495674_0002425 | 3300047319 | Bacteria | 18234 |
| 955 | Ga0495674_0019513 | 3300047319 | Bacteria | 6289 |
| 956 | Ga0495674_0020084 | 3300047319 | Bacteria | 6191 |
| 957 | Ga0495674_0022349 | 3300047319 | Bacteria | 5834 |
| 958 | Ga0495676_0014185 | 3300047321 | Bacteria | 7134 |
| 959 | Ga0495680_0000269 | 3300047322 | Bacteria | 57801 |
| 960 | Ga0495680_0004322 | 3300047322 | Bacteria | 13617 |
| 961 | Ga0495680_0011815 | 3300047322 | Bacteria | 7712 |
| 962 | Ga0495675_0003525 | 3300047444 | Bacteria | 9435 |
| 963 | Ga0495675_0006374 | 3300047444 | Bacteria | 7221 |
| 964 | Ga0495675_0010654 | 3300047444 | Bacteria | 5749 |
| 965 | Ga0495684_0002555 | 3300047471 | Bacteria | 14482 |
| 966 | Ga0495684_0004914 | 3300047471 | Bacteria | 10432 |
| 967 | Ga0495684_0014038 | 3300047471 | Bacteria | 6161 |
| 968 | Ga0495684_0022713 | 3300047471 | Bacteria | 4825 |
| 969 | Ga0495684_0067205 | 3300047471 | Bacteria | 2726 |
| 970 | Ga0495684_0104348 | 3300047471 | Bacteria | 2142 |
| 971 | Ga0495684_0118669 | 3300047471 | Bacteria | 1993 |
| 972 | Ga0495593_0011035 | 3300047673 | Bacteria | 5200 |
| 973 | Ga0495593_0019942 | 3300047673 | Bacteria | 3755 |
| 974 | Ga0495602_0000047 | 3300048088 | Bacteria | 117038 |
| 975 | Ga0495602_0004407 | 3300048088 | Bacteria | 14694 |
| 976 | Ga0495602_0007044 | 3300048088 | Bacteria | 11801 |
| 977 | Ga0495602_0030330 | 3300048088 | Bacteria | 5131 |
| 978 | Ga0495602_0075740 | 3300048088 | Bacteria | 2855 |
| 979 | Ga0496100_0140570 | 3300048903 | Bacteria | 1711 |
| 980 | Ga0496101_0011571 | 3300048904 | Bacteria | 5859 |
| 981 | Ga0496101_0118813 | 3300048904 | Bacteria | 1997 |
| 982 | Ga0496101_0171899 | 3300048904 | Bacteria | 1666 |
| 983 | Ga0496102_0021886 | 3300048905 | Bacteria | 5660 |
| 984 | Ga0496102_0076778 | 3300048905 | Bacteria | 3073 |
| 985 | Ga0496102_0233850 | 3300048905 | Bacteria | 1733 |
| 986 | Ga0496104_0000261 | 3300048907 | Bacteria | 46523 |
| 987 | Ga0496104_0002409 | 3300048907 | Bacteria | 16104 |
| 988 | Ga0496104_0053724 | 3300048907 | Bacteria | 3807 |
| 989 | Ga0496104_0079539 | 3300048907 | Unclassified | 3125 |
| 990 | Ga0496104_0095612 | 3300048907 | Bacteria | 2842 |
| 991 | Ga0496105_0000341 | 3300048908 | Bacteria | 30641 |
| 992 | Ga0496105_0110999 | 3300048908 | Bacteria | 2263 |
| 993 | Ga0496106_0073086 | 3300048909 | Bacteria | 2623 |
| 994 | Ga0496106_0125822 | 3300048909 | Bacteria | 2007 |
| 995 | Ga0496107_0051754 | 3300048910 | Bacteria | 2963 |
| 996 | Ga0496108_0000228 | 3300048911 | Bacteria | 50279 |
| 997 | Ga0496108_0042304 | 3300048911 | Bacteria | 3803 |
| 998 | Ga0496108_0063777 | 3300048911 | Bacteria | 3103 |
| 999 | Ga0496109_0000301 | 3300048912 | Bacteria | 46624 |
| 1000 | Ga0496109_0000362 | 3300048912 | Bacteria | 42175 |
| 1001 | Ga0496109_0050777 | 3300048912 | Bacteria | 3776 |
| 1002 | Ga0496110_0000221 | 3300048913 | Bacteria | 36767 |
| 1003 | Ga0496110_0001221 | 3300048913 | Bacteria | 18300 |
| 1004 | Ga0496110_0020704 | 3300048913 | Bacteria | 5555 |
| 1005 | Ga0496111_0000943 | 3300048914 | Bacteria | 15888 |
| 1006 | Ga0496111_0002551 | 3300048914 | Bacteria | 11006 |
| 1007 | Ga0496111_0005463 | 3300048914 | Bacteria | 8147 |
| 1008 | Ga0496111_0017269 | 3300048914 | Bacteria | 4987 |
| 1009 | Ga0496112_0000034 | 3300048915 | Bacteria | 107237 |
| 1010 | Ga0496112_0002908 | 3300048915 | Bacteria | 13940 |
| 1011 | Ga0496112_0003016 | 3300048915 | Bacteria | 13763 |
| 1012 | Ga0496112_0005823 | 3300048915 | Bacteria | 10729 |
| 1013 | Ga0496112_0025670 | 3300048915 | Bacteria | 5660 |
| 1014 | Ga0496112_0037194 | 3300048915 | Bacteria | 4752 |
| 1015 | Ga0496112_0046687 | 3300048915 | Unclassified | 4249 |
| 1016 | Ga0496112_0078273 | 3300048915 | Bacteria | 3270 |
| 1017 | Ga0496112_0084609 | 3300048915 | Unclassified | 3137 |
| 1018 | Ga0496112_0086337 | 3300048915 | Bacteria | 3104 |
| 1019 | Ga0496112_0279292 | 3300048915 | Bacteria | 1617 |
| 1020 | Ga0496113_0007338 | 3300048916 | Bacteria | 7080 |
| 1021 | Ga0496113_0018008 | 3300048916 | Bacteria | 4913 |
| 1022 | Ga0496113_0096592 | 3300048916 | Bacteria | 2285 |
| 1023 | Ga0496113_0108434 | 3300048916 | Bacteria | 2159 |
| 1024 | Ga0496113_0151387 | 3300048916 | Bacteria | 1830 |
| 1025 | Ga0496114_0000167 | 3300048917 | Bacteria | 46546 |
| 1026 | Ga0496114_0002278 | 3300048917 | Bacteria | 14623 |
| 1027 | Ga0496114_0024514 | 3300048917 | Bacteria | 4926 |
| 1028 | Ga0496114_0178879 | 3300048917 | Bacteria | 1851 |
| 1029 | Ga0496115_0004534 | 3300048918 | Bacteria | 10049 |
| 1030 | Ga0496115_0042261 | 3300048918 | Bacteria | 3631 |
| 1031 | Ga0496115_0042995 | 3300048918 | Bacteria | 3602 |
| 1032 | Ga0496121_0002994 | 3300048924 | Bacteria | 24537 |
| 1033 | Ga0501040_0054155 | 3300049576 | Bacteria | 2750 |
| 1034 | Ga0501041_0079695 | 3300049577 | Unclassified | 2016 |
| 1035 | Ga0501047_0095250 | 3300049581 | Bacteria | 2856 |
| 1036 | Ga0501074_0002137 | 3300049590 | Bacteria | 13665 |
| 1037 | Ga0501075_0086013 | 3300049591 | Unclassified | 2382 |
| 1038 | Ga0501079_0118106 | 3300049741 | Bacteria | 2062 |
| 1039 | Ga0501080_0011210 | 3300049742 | Bacteria | 8206 |
| 1040 | Ga0501080_0079678 | 3300049742 | Bacteria | 3045 |
| 1041 | nmdc:mga05p37_133052_c1 | 3300050507 | Bacteria | 3050 |
| 1042 | nmdc:mga05p37_13546_c1 | 3300050507 | Bacteria | 9777 |
| 1043 | nmdc:mga05p37_172422_c1 | 3300050507 | Bacteria | 2638 |
| 1044 | nmdc:mga05p37_67917_c1 | 3300050507 | Bacteria | 4385 |
| 1045 | nmdc:mga05p37_72479_c1 | 3300050507 | Unclassified | 4238 |
| 1046 | nmdc:mga05p37_78461_c1 | 3300050507 | Unclassified | 4066 |
| 1047 | nmdc:mga09592_137932_c1 | 3300050508 | Bacteria | 2101 |
| 1048 | nmdc:mga09592_58368_c1 | 3300050508 | Bacteria | 3263 |
| 1049 | nmdc:mga0qj67_139529_c1 | 3300050509 | Bacteria | 1965 |
| 1050 | nmdc:mga0qj67_22712_c2 | 3300050509 | Bacteria | 4020 |
| 1051 | nmdc:mga0qj67_4451_c1 | 3300050509 | Bacteria | 10149 |
| 1052 | nmdc:mga06r32_16001_c1 | 3300050510 | Bacteria | 6826 |
| 1053 | nmdc:mga06r32_32375_c1 | 3300050510 | Bacteria | 4918 |
| 1054 | nmdc:mga06r32_696_c1 | 3300050510 | Bacteria | 29344 |
| 1055 | nmdc:mga08y16_2037_c1 | 3300050511 | Bacteria | 20715 |
| 1056 | nmdc:mga0n895_105797_c1 | 3300050512 | Bacteria | 2826 |
| 1057 | nmdc:mga0n895_152933_c1 | 3300050512 | Bacteria | 2338 |
| 1058 | nmdc:mga0n895_177692_c1 | 3300050512 | Bacteria | 2160 |
| 1059 | nmdc:mga0n895_32644_c1 | 3300050512 | Bacteria | 4998 |
| 1060 | nmdc:mga0n895_408_c1 | 3300050512 | Bacteria | 28760 |
| 1061 | nmdc:mga0n895_4619_c1 | 3300050512 | Bacteria | 11353 |
| 1062 | nmdc:mga0n895_47_c1 | 3300050512 | Bacteria | 73703 |
| 1063 | nmdc:mga0n895_5144_c1 | 3300050512 | Bacteria | 10877 |
| 1064 | nmdc:mga0n895_82072_c1 | 3300050512 | Bacteria | 3213 |
| 1065 | nmdc:mga0n895_9908_c1 | 3300050512 | Bacteria | 8381 |
| 1066 | nmdc:mga0rr50_111418_c1 | 3300050513 | Bacteria | 2166 |
| 1067 | nmdc:mga0rr50_175833_c1 | 3300050513 | Bacteria | 1747 |
| 1068 | nmdc:mga0rr50_44127_c1 | 3300050513 | Bacteria | 3268 |
| 1069 | nmdc:mga0rr50_52457_c1 | 3300050513 | Bacteria | 3031 |
| 1070 | nmdc:mga0rr50_56863_c1 | 3300050513 | Bacteria | 2924 |
| 1071 | nmdc:mga0rr50_74925_c1 | 3300050513 | Bacteria | 2592 |
| 1072 | nmdc:mga0rr50_99_c1 | 3300050513 | Bacteria | 48440 |
| 1073 | nmdc:mga08x19_1089_c1 | 3300050514 | Bacteria | 16941 |
| 1074 | nmdc:mga08x19_23700_c1 | 3300050514 | Bacteria | 3809 |
| 1075 | nmdc:mga08x19_30070_c1 | 3300050514 | Unclassified | 3410 |
| 1076 | nmdc:mga08x19_3030_c1 | 3300050514 | Bacteria | 10099 |
| 1077 | nmdc:mga08x19_45121_c1 | 3300050514 | Bacteria | 2816 |
| 1078 | nmdc:mga08x19_4715_c1 | 3300050514 | Bacteria | 8084 |
| 1079 | nmdc:mga08x19_58316_c1 | 3300050514 | Bacteria | 2497 |
| 1080 | nmdc:mga08x19_7303_c1 | 3300050514 | Bacteria | 6561 |
| 1081 | nmdc:mga08x19_7696_c1 | 3300050514 | Bacteria | 6397 |
| 1082 | nmdc:mga08x19_8659_c1 | 3300050514 | Bacteria | 6066 |
| 1083 | nmdc:mga08x19_9158_c1 | 3300050514 | Bacteria | 5909 |
| 1084 | nmdc:mga0a205_126628_c1 | 3300050515 | Bacteria | 2454 |
| 1085 | nmdc:mga0a205_1652_c1 | 3300050515 | Bacteria | 19181 |
| 1086 | nmdc:mga0a205_23451_c1 | 3300050515 | Bacteria | 5854 |
| 1087 | nmdc:mga0a205_25783_c1 | 3300050515 | Unclassified | 2591 |
| 1088 | nmdc:mga0a205_40_c1 | 3300050515 | Bacteria | 71613 |
| 1089 | Ga0495601_0002873 | 3300053077 | Bacteria | 9800 |
| 1090 | Ga0501084_0045664 | 3300054114 | Bacteria | 3668 |
| 1091 | Ga0501082_0001747 | 3300060353 | Bacteria | 19150 |
| 1092 | Ga0501082_0244714 | 3300060353 | Bacteria | 1561 |
| 1093 | Ga0530510_0119800 | 3300061734 | Unclassified | 1931 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009093 | Ga0105240_10201088 | Ga0105240_102010882 | 409 |
| 2 | 3300039450 | Ga0436363_0468839 | Ga0436363_0468839_70_1299 | 409 |
| 3 | 3300048904 | Ga0496101_0118813 | Ga0496101_0118813_403_1839 | 443 |
| 4 | 3300048909 | Ga0496106_0073086 | Ga0496106_0073086_741_2177 | 443 |
| 5 | 3300048913 | Ga0496110_0020704 | Ga0496110_0020704_350_1786 | 443 |
| 6 | 3300048907 | Ga0496104_0053724 | Ga0496104_0053724_1505_2914 | 444 |
| 7 | 3300048911 | Ga0496108_0042304 | Ga0496108_0042304_1204_2613 | 444 |
| 8 | 3300048912 | Ga0496109_0050777 | Ga0496109_0050777_782_2191 | 444 |
| 9 | 3300005530 | Ga0070679_100143669 | Ga0070679_1001436692 | 445 |
| 10 | 3300028800 | Ga0265338_10012494 | Ga0265338_100124943 | 445 |
| 11 | 3300031344 | Ga0265316_10009247 | Ga0265316_100092476 | 445 |
| 12 | 3300037418 | Ga0395900_0031919 | Ga0395900_0031919_1897_3360 | 445 |
| 13 | 3300005985 | Ga0081539_10008689 | Ga0081539_1000868912 | 447 |
| 14 | 3300014968 | Ga0157379_10005382 | Ga0157379_100053828 | 447 |
| 15 | 3300048910 | Ga0496107_0051754 | Ga0496107_0051754_276_1721 | 448 |
| 16 | 3300048917 | Ga0496114_0178879 | Ga0496114_0178879_52_1488 | 448 |
| 17 | 3300037312 | Ga0395899_0015128 | Ga0395899_0015128_785_2218 | 449 |
| 18 | 3300037418 | Ga0395900_0016063 | Ga0395900_0016063_3219_4652 | 449 |
| 19 | 3300037466 | Ga0395898_0017277 | Ga0395898_0017277_3598_5031 | 449 |
| 20 | 3300037471 | Ga0395905_0014235 | Ga0395905_0014235_3435_4868 | 449 |
| 21 | 3300038443 | Ga0395901_0054168 | Ga0395901_0054168_398_1831 | 449 |
| 22 | 3300048088 | Ga0495602_0075740 | Ga0495602_0075740_311_1705 | 449 |
| 23 | 3300050509 | nmdc:mga0qj67_139529_c1 | nmdc:mga0qj67_139529_c1_428_1891 | 449 |
| 24 | 3300005445 | Ga0070708_100044091 | Ga0070708_1000440912 | 452 |
| 25 | 3300005467 | Ga0070706_100000063 | Ga0070706_10000006397 | 452 |
| 26 | 3300025910 | Ga0207684_10000018 | Ga0207684_10000018180 | 452 |
| 27 | 3300048904 | Ga0496101_0011571 | Ga0496101_0011571_1454_2899 | 453 |
| 28 | 3300048907 | Ga0496104_0000261 | Ga0496104_0000261_19694_21139 | 453 |
| 29 | 3300048908 | Ga0496105_0000341 | Ga0496105_0000341_5169_6614 | 453 |
| 30 | 3300048911 | Ga0496108_0063777 | Ga0496108_0063777_1463_2908 | 453 |
| 31 | 3300048912 | Ga0496109_0000301 | Ga0496109_0000301_21766_23211 | 453 |
| 32 | 3300048913 | Ga0496110_0000221 | Ga0496110_0000221_13631_15076 | 453 |
| 33 | 3300048914 | Ga0496111_0000943 | Ga0496111_0000943_8701_10146 | 453 |
| 34 | 3300048917 | Ga0496114_0000167 | Ga0496114_0000167_293_1738 | 453 |
| 35 | 3300006846 | Ga0075430_100038276 | Ga0075430_1000382763 | 454 |
| 36 | 3300021388 | Ga0213875_10037905 | Ga0213875_100379052 | 456 |
| 37 | 3300039450 | Ga0436363_0128523 | Ga0436363_0128523_734_2104 | 456 |
| 38 | 3300037418 | Ga0395900_0048436 | Ga0395900_0048436_2887_4320 | 457 |
| 39 | 3300044712 | Ga0453684_0043015 | Ga0453684_0043015_549_1988 | 458 |
| 40 | 3300044901 | Ga0466960_0000015 | Ga0466960_0000015_34018_35478 | 458 |
| 41 | 3300005365 | Ga0070688_100010707 | Ga0070688_1000107074 | 459 |
| 42 | 3300005466 | Ga0070685_10015105 | Ga0070685_100151052 | 459 |
| 43 | 3300005564 | Ga0070664_100158701 | Ga0070664_1001587011 | 459 |
| 44 | 3300005617 | Ga0068859_100008790 | Ga0068859_1000087906 | 459 |
| 45 | 3300005842 | Ga0068858_100001017 | Ga0068858_10000101721 | 459 |
| 46 | 3300006931 | Ga0097620_100008790 | Ga0097620_1000087906 | 459 |
| 47 | 3300009177 | Ga0105248_10046507 | Ga0105248_100465072 | 459 |
| 48 | 3300014968 | Ga0157379_10004974 | Ga0157379_100049744 | 459 |
| 49 | 3300026035 | Ga0207703_10004814 | Ga0207703_100048147 | 459 |
| 50 | 3300006871 | Ga0075434_100002070 | Ga0075434_1000020703 | 460 |
| 51 | 3300025915 | Ga0207693_10066342 | Ga0207693_100663422 | 460 |
| 52 | 3300037853 | Ga0436364_0276770 | Ga0436364_0276770_6774_8156 | 460 |
| 53 | 3300050512 | nmdc:mga0n895_9908_c1 | nmdc:mga0n895_9908_c1_4120_5568 | 460 |
| 54 | 3300005329 | Ga0070683_100023082 | Ga0070683_1000230825 | 461 |
| 55 | 3300005437 | Ga0070710_10052095 | Ga0070710_100520952 | 461 |
| 56 | 3300005535 | Ga0070684_100006489 | Ga0070684_1000064898 | 461 |
| 57 | 3300005543 | Ga0070672_100095253 | Ga0070672_1000952532 | 461 |
| 58 | 3300005614 | Ga0068856_100002688 | Ga0068856_10000268814 | 461 |
| 59 | 3300005616 | Ga0068852_100014167 | Ga0068852_1000141678 | 461 |
| 60 | 3300005985 | Ga0081539_10003804 | Ga0081539_1000380412 | 461 |
| 61 | 3300009098 | Ga0105245_10025823 | Ga0105245_100258232 | 461 |
| 62 | 3300010375 | Ga0105239_10151276 | Ga0105239_101512762 | 461 |
| 63 | 3300013297 | Ga0157378_10243375 | Ga0157378_102433751 | 461 |
| 64 | 3300013308 | Ga0157375_10105183 | Ga0157375_101051833 | 461 |
| 65 | 3300014745 | Ga0157377_10006251 | Ga0157377_100062512 | 461 |
| 66 | 3300025935 | Ga0207709_10120402 | Ga0207709_101204022 | 461 |
| 67 | 3300026075 | Ga0207708_10005782 | Ga0207708_100057822 | 461 |
| 68 | 3300026095 | Ga0207676_10057830 | Ga0207676_100578302 | 461 |
| 69 | 3300026121 | Ga0207683_10012241 | Ga0207683_100122417 | 461 |
| 70 | 3300039453 | Ga0436362_0800997 | Ga0436362_0800997_246_1631 | 461 |
| 71 | 3300044673 | Ga0453683_0070327 | Ga0453683_0070327_563_2011 | 461 |
| 72 | 3300048903 | Ga0496100_0140570 | Ga0496100_0140570_199_1650 | 461 |
| 73 | 3300048904 | Ga0496101_0171899 | Ga0496101_0171899_179_1630 | 461 |
| 74 | 3300048907 | Ga0496104_0002409 | Ga0496104_0002409_14051_15502 | 461 |
| 75 | 3300048909 | Ga0496106_0125822 | Ga0496106_0125822_110_1561 | 461 |
| 76 | 3300048914 | Ga0496111_0017269 | Ga0496111_0017269_3383_4834 | 461 |
| 77 | 3300048915 | Ga0496112_0086337 | Ga0496112_0086337_840_2291 | 461 |
| 78 | 3300005985 | Ga0081539_10067069 | Ga0081539_100670693 | 462 |
| 79 | 3300032002 | Ga0307416_100018090 | Ga0307416_1000180902 | 462 |
| 80 | 3300032126 | Ga0307415_100033357 | Ga0307415_1000333572 | 462 |
| 81 | 3300046455 | Ga0495603_0031958 | Ga0495603_0031958_1656_3044 | 462 |
| 82 | 3300046472 | Ga0495580_0042789 | Ga0495580_0042789_113_1501 | 462 |
| 83 | 3300046536 | Ga0495587_0011615 | Ga0495587_0011615_1094_2482 | 462 |
| 84 | 3300047319 | Ga0495674_0020084 | Ga0495674_0020084_801_2189 | 462 |
| 85 | 3300046525 | Ga0495663_0023163 | Ga0495663_0023163_129_1562 | 463 |
| 86 | 3300005548 | Ga0070665_100001525 | Ga0070665_10000152516 | 464 |
| 87 | 3300028379 | Ga0268266_10000736 | Ga0268266_1000073619 | 464 |
| 88 | 3300047319 | Ga0495674_0022349 | Ga0495674_0022349_3210_4676 | 464 |
| 89 | 3300005436 | Ga0070713_100134550 | Ga0070713_1001345502 | 465 |
| 90 | 3300005563 | Ga0068855_100000514 | Ga0068855_10000051451 | 465 |
| 91 | 3300006175 | Ga0070712_100075357 | Ga0070712_1000753572 | 465 |
| 92 | 3300025916 | Ga0207663_10008379 | Ga0207663_100083793 | 465 |
| 93 | 3300025928 | Ga0207700_10111214 | Ga0207700_101112142 | 465 |
| 94 | 3300025949 | Ga0207667_10000103 | Ga0207667_1000010331 | 465 |
| 95 | 3300038443 | Ga0395901_0120517 | Ga0395901_0120517_1043_2452 | 465 |
| 96 | 3300048918 | Ga0496115_0042995 | Ga0496115_0042995_1557_3014 | 465 |
| 97 | 3300049581 | Ga0501047_0095250 | Ga0501047_0095250_690_2102 | 466 |
| 98 | 3300005436 | Ga0070713_100064591 | Ga0070713_1000645912 | 467 |
| 99 | 3300005937 | Ga0081455_10072539 | Ga0081455_100725392 | 467 |
| 100 | 3300006028 | Ga0070717_10067061 | Ga0070717_100670613 | 467 |
| 101 | 3300025928 | Ga0207700_10159460 | Ga0207700_101594602 | 467 |
| 102 | 3300031090 | Ga0265760_10000014 | Ga0265760_1000001483 | 467 |
| 103 | 3300037418 | Ga0395900_0086386 | Ga0395900_0086386_1567_3021 | 467 |
| 104 | 3300037471 | Ga0395905_0077115 | Ga0395905_0077115_896_2350 | 467 |
| 105 | 3300048916 | Ga0496113_0108434 | Ga0496113_0108434_322_1779 | 467 |
| 106 | 3300005439 | Ga0070711_100017670 | Ga0070711_1000176702 | 468 |
| 107 | 3300025916 | Ga0207663_10024515 | Ga0207663_100245152 | 468 |
| 108 | 3300005468 | Ga0070707_100238346 | Ga0070707_1002383462 | 469 |
| 109 | 3300037471 | Ga0395905_0060017 | Ga0395905_0060017_672_2156 | 469 |
| 110 | 3300045976 | Ga0466967_0043551 | Ga0466967_0043551_2329_3768 | 469 |
| 111 | 3300048915 | Ga0496112_0025670 | Ga0496112_0025670_1566_2993 | 469 |
| 112 | 3300045836 | Ga0466958_0072896 | Ga0466958_0072896_437_1888 | 470 |
| 113 | 3300046615 | Ga0495656_0000002 | Ga0495656_0000002_143888_145318 | 470 |
| 114 | 3300046664 | Ga0495659_0018109 | Ga0495659_0018109_60_1490 | 470 |
| 115 | 3300002239 | JGI24034J26672_10003488 | JGI24034J26672_100034881 | 471 |
| 116 | 3300005434 | Ga0070709_10005534 | Ga0070709_100055345 | 471 |
| 117 | 3300005435 | Ga0070714_100048825 | Ga0070714_1000488254 | 471 |
| 118 | 3300005436 | Ga0070713_100016994 | Ga0070713_1000169947 | 471 |
| 119 | 3300005445 | Ga0070708_100077925 | Ga0070708_1000779252 | 471 |
| 120 | 3300005468 | Ga0070707_100036034 | Ga0070707_1000360342 | 471 |
| 121 | 3300005471 | Ga0070698_100000002 | Ga0070698_1000000022 | 471 |
| 122 | 3300005471 | Ga0070698_100023346 | Ga0070698_1000233464 | 471 |
| 123 | 3300005578 | Ga0068854_100000010 | Ga0068854_10000001042 | 471 |
| 124 | 3300005614 | Ga0068856_100081384 | Ga0068856_1000813842 | 471 |
| 125 | 3300006173 | Ga0070716_100004195 | Ga0070716_1000041955 | 471 |
| 126 | 3300020070 | Ga0206356_10046556 | Ga0206356_100465563 | 471 |
| 127 | 3300025906 | Ga0207699_10008819 | Ga0207699_100088197 | 471 |
| 128 | 3300025910 | Ga0207684_10034314 | Ga0207684_100343143 | 471 |
| 129 | 3300025928 | Ga0207700_10000028 | Ga0207700_1000002812 | 471 |
| 130 | 3300025939 | Ga0207665_10005910 | Ga0207665_100059107 | 471 |
| 131 | 3300025981 | Ga0207640_10000004 | Ga0207640_10000004308 | 471 |
| 132 | 3300035724 | Ga0373933_0011398 | Ga0373933_0011398_275_1741 | 471 |
| 133 | 3300048907 | Ga0496104_0095612 | Ga0496104_0095612_58_1488 | 471 |
| 134 | 3300050514 | nmdc:mga08x19_45121_c1 | nmdc:mga08x19_45121_c1_349_1815 | 471 |
| 135 | 3300005329 | Ga0070683_100014041 | Ga0070683_1000140418 | 472 |
| 136 | 3300005329 | Ga0070683_100046567 | Ga0070683_1000465672 | 472 |
| 137 | 3300005329 | Ga0070683_100072735 | Ga0070683_1000727352 | 472 |
| 138 | 3300005337 | Ga0070682_100086313 | Ga0070682_1000863132 | 472 |
| 139 | 3300005530 | Ga0070679_100004339 | Ga0070679_10000433914 | 472 |
| 140 | 3300005535 | Ga0070684_100012044 | Ga0070684_1000120448 | 472 |
| 141 | 3300005563 | Ga0068855_100045845 | Ga0068855_1000458454 | 472 |
| 142 | 3300005937 | Ga0081455_10059710 | Ga0081455_100597102 | 472 |
| 143 | 3300009098 | Ga0105245_10025367 | Ga0105245_100253672 | 472 |
| 144 | 3300025921 | Ga0207652_10003389 | Ga0207652_100033893 | 472 |
| 145 | 3300025927 | Ga0207687_10002511 | Ga0207687_100025117 | 472 |
| 146 | 3300025935 | Ga0207709_10077835 | Ga0207709_100778352 | 472 |
| 147 | 3300025944 | Ga0207661_10021196 | Ga0207661_100211963 | 472 |
| 148 | 3300037418 | Ga0395900_0065195 | Ga0395900_0065195_1904_3343 | 472 |
| 149 | 3300046492 | Ga0495585_0040378 | Ga0495585_0040378_145_1578 | 472 |
| 150 | 3300046691 | Ga0495670_0061166 | Ga0495670_0061166_312_1745 | 472 |
| 151 | 3300048917 | Ga0496114_0002278 | Ga0496114_0002278_9375_10820 | 472 |
| 152 | 3300053077 | Ga0495601_0002873 | Ga0495601_0002873_6302_7774 | 472 |
| 153 | 3300005468 | Ga0070707_100000808 | Ga0070707_1000008088 | 473 |
| 154 | 3300005468 | Ga0070707_100125994 | Ga0070707_1001259942 | 473 |
| 155 | 3300005518 | Ga0070699_100005395 | Ga0070699_1000053952 | 473 |
| 156 | 3300005536 | Ga0070697_100009479 | Ga0070697_1000094795 | 473 |
| 157 | 3300005536 | Ga0070697_100041007 | Ga0070697_1000410072 | 473 |
| 158 | 3300005981 | Ga0081538_10026741 | Ga0081538_100267415 | 473 |
| 159 | 3300025922 | Ga0207646_10000001 | Ga0207646_100000011028 | 473 |
| 160 | 3300025922 | Ga0207646_10000006 | Ga0207646_10000006451 | 473 |
| 161 | 3300025922 | Ga0207646_10000017 | Ga0207646_1000001734 | 473 |
| 162 | 3300025922 | Ga0207646_10014287 | Ga0207646_100142876 | 473 |
| 163 | 3300025922 | Ga0207646_10047704 | Ga0207646_100477043 | 473 |
| 164 | 3300027671 | Ga0209588_1001140 | Ga0209588_10011409 | 473 |
| 165 | 3300027671 | Ga0209588_1002962 | Ga0209588_10029622 | 473 |
| 166 | 3300035118 | Ga0373954_0000077 | Ga0373954_0000077_3163_4623 | 473 |
| 167 | 3300035172 | Ga0373955_0000687 | Ga0373955_0000687_12021_13481 | 473 |
| 168 | 3300035724 | Ga0373933_0000287 | Ga0373933_0000287_18532_19992 | 473 |
| 169 | 3300036401 | Ga0373937_0000710 | Ga0373937_0000710_24842_26302 | 473 |
| 170 | 3300042876 | Ga0451577_0162081 | Ga0451577_0162081_285_1724 | 473 |
| 171 | 3300045051 | Ga0451576_0000238 | Ga0451576_0000238_64050_65489 | 473 |
| 172 | 3300046462 | Ga0495651_0007790 | Ga0495651_0007790_4267_5727 | 473 |
| 173 | 3300046463 | Ga0495653_0030123 | Ga0495653_0030123_2806_4266 | 473 |
| 174 | 3300046511 | Ga0495608_0013095 | Ga0495608_0013095_1777_3237 | 473 |
| 175 | 3300046679 | Ga0495623_0035702 | Ga0495623_0035702_691_2151 | 473 |
| 176 | 3300047317 | Ga0495604_0000452 | Ga0495604_0000452_16466_17926 | 473 |
| 177 | 3300047471 | Ga0495684_0004914 | Ga0495684_0004914_3076_4536 | 473 |
| 178 | 3300048088 | Ga0495602_0004407 | Ga0495602_0004407_7762_9222 | 473 |
| 179 | 3300005345 | Ga0070692_10048078 | Ga0070692_100480782 | 474 |
| 180 | 3300005471 | Ga0070698_100004166 | Ga0070698_1000041663 | 474 |
| 181 | 3300009093 | Ga0105240_10041454 | Ga0105240_100414546 | 474 |
| 182 | 3300013307 | Ga0157372_10000497 | Ga0157372_1000049728 | 474 |
| 183 | 3300048915 | Ga0496112_0279292 | Ga0496112_0279292_14_1480 | 474 |
| 184 | 3300049741 | Ga0501079_0118106 | Ga0501079_0118106_78_1550 | 474 |
| 185 | 3300049742 | Ga0501080_0079678 | Ga0501080_0079678_268_1740 | 474 |
| 186 | 3300050513 | nmdc:mga0rr50_175833_c1 | nmdc:mga0rr50_175833_c1_219_1685 | 474 |
| 187 | 3300060353 | Ga0501082_0244714 | Ga0501082_0244714_27_1499 | 474 |
| 188 | 3300005435 | Ga0070714_100097627 | Ga0070714_1000976272 | 475 |
| 189 | 3300013307 | Ga0157372_10004064 | Ga0157372_1000406410 | 475 |
| 190 | 3300014969 | Ga0157376_10254396 | Ga0157376_102543961 | 475 |
| 191 | 3300025913 | Ga0207695_10012611 | Ga0207695_1001261111 | 475 |
| 192 | 3300037471 | Ga0395905_0268781 | Ga0395905_0268781_57_1511 | 475 |
| 193 | 3300044694 | Ga0466963_0090797 | Ga0466963_0090797_580_2046 | 475 |
| 194 | 3300005535 | Ga0070684_100104855 | Ga0070684_1001048552 | 476 |
| 195 | 3300005563 | Ga0068855_100017550 | Ga0068855_1000175508 | 476 |
| 196 | 3300009093 | Ga0105240_10025672 | Ga0105240_100256723 | 476 |
| 197 | 3300013104 | Ga0157370_10007410 | Ga0157370_100074103 | 476 |
| 198 | 3300020082 | Ga0206353_10581244 | Ga0206353_105812442 | 476 |
| 199 | 3300025909 | Ga0207705_10016962 | Ga0207705_100169623 | 476 |
| 200 | 3300025912 | Ga0207707_10085766 | Ga0207707_100857662 | 476 |
| 201 | 3300025913 | Ga0207695_10102053 | Ga0207695_101020532 | 476 |
| 202 | 3300025921 | Ga0207652_10032119 | Ga0207652_100321192 | 476 |
| 203 | 3300025944 | Ga0207661_10019337 | Ga0207661_100193376 | 476 |
| 204 | 3300025949 | Ga0207667_10054355 | Ga0207667_100543552 | 476 |
| 205 | 3300049590 | Ga0501074_0002137 | Ga0501074_0002137_5216_6724 | 476 |
| 206 | 3300049742 | Ga0501080_0011210 | Ga0501080_0011210_1576_3084 | 476 |
| 207 | 3300006844 | Ga0075428_100063842 | Ga0075428_1000638423 | 477 |
| 208 | 3300006846 | Ga0075430_100003335 | Ga0075430_1000033354 | 477 |
| 209 | 3300006846 | Ga0075430_100018493 | Ga0075430_1000184933 | 477 |
| 210 | 3300006847 | Ga0075431_100040689 | Ga0075431_1000406893 | 477 |
| 211 | 3300006847 | Ga0075431_100124670 | Ga0075431_1001246702 | 477 |
| 212 | 3300006847 | Ga0075431_100134681 | Ga0075431_1001346812 | 477 |
| 213 | 3300006852 | Ga0075433_10068654 | Ga0075433_100686542 | 477 |
| 214 | 3300006871 | Ga0075434_100036065 | Ga0075434_1000360655 | 477 |
| 215 | 3300006880 | Ga0075429_100000530 | Ga0075429_1000005302 | 477 |
| 216 | 3300009094 | Ga0111539_10307441 | Ga0111539_103074412 | 477 |
| 217 | 3300009147 | Ga0114129_10308329 | Ga0114129_103083292 | 477 |
| 218 | 3300025929 | Ga0207664_10062443 | Ga0207664_100624431 | 477 |
| 219 | 3300027907 | Ga0207428_10182454 | Ga0207428_101824541 | 477 |
| 220 | 3300031852 | Ga0307410_10015059 | Ga0307410_100150592 | 477 |
| 221 | 3300031901 | Ga0307406_10026117 | Ga0307406_100261172 | 477 |
| 222 | 3300031903 | Ga0307407_10033504 | Ga0307407_100335042 | 477 |
| 223 | 3300031995 | Ga0307409_100018582 | Ga0307409_1000185823 | 477 |
| 224 | 3300044684 | Ga0466966_0089449 | Ga0466966_0089449_111_1577 | 477 |
| 225 | 3300048915 | Ga0496112_0003016 | Ga0496112_0003016_11036_12481 | 477 |
| 226 | 3300048924 | Ga0496121_0002994 | Ga0496121_0002994_20024_21472 | 477 |
| 227 | 3300050507 | nmdc:mga05p37_67917_c1 | nmdc:mga05p37_67917_c1_476_1912 | 477 |
| 228 | 3300050508 | nmdc:mga09592_58368_c1 | nmdc:mga09592_58368_c1_1460_2896 | 477 |
| 229 | 3300050509 | nmdc:mga0qj67_4451_c1 | nmdc:mga0qj67_4451_c1_4592_6028 | 477 |
| 230 | 3300050510 | nmdc:mga06r32_16001_c1 | nmdc:mga06r32_16001_c1_4951_6387 | 477 |
| 231 | 3300050510 | nmdc:mga06r32_32375_c1 | nmdc:mga06r32_32375_c1_3328_4764 | 477 |
| 232 | 3300050510 | nmdc:mga06r32_696_c1 | nmdc:mga06r32_696_c1_2540_3976 | 477 |
| 233 | 3300050512 | nmdc:mga0n895_177692_c1 | nmdc:mga0n895_177692_c1_618_2054 | 477 |
| 234 | 3300050513 | nmdc:mga0rr50_56863_c1 | nmdc:mga0rr50_56863_c1_290_1726 | 477 |
| 235 | 3300050514 | nmdc:mga08x19_23700_c1 | nmdc:mga08x19_23700_c1_966_2402 | 477 |
| 236 | 3300005329 | Ga0070683_100030449 | Ga0070683_1000304495 | 478 |
| 237 | 3300005329 | Ga0070683_100039473 | Ga0070683_1000394733 | 478 |
| 238 | 3300005336 | Ga0070680_100005314 | Ga0070680_1000053142 | 478 |
| 239 | 3300005434 | Ga0070709_10000415 | Ga0070709_1000041513 | 478 |
| 240 | 3300005435 | Ga0070714_100020121 | Ga0070714_1000201214 | 478 |
| 241 | 3300005435 | Ga0070714_100088528 | Ga0070714_1000885282 | 478 |
| 242 | 3300005468 | Ga0070707_100000815 | Ga0070707_10000081521 | 478 |
| 243 | 3300006871 | Ga0075434_100035108 | Ga0075434_1000351083 | 478 |
| 244 | 3300006871 | Ga0075434_100047370 | Ga0075434_1000473702 | 478 |
| 245 | 3300006871 | Ga0075434_100257451 | Ga0075434_1002574512 | 478 |
| 246 | 3300006880 | Ga0075429_100141745 | Ga0075429_1001417452 | 478 |
| 247 | 3300007076 | Ga0075435_100161802 | Ga0075435_1001618021 | 478 |
| 248 | 3300009147 | Ga0114129_10000075 | Ga0114129_1000007566 | 478 |
| 249 | 3300009147 | Ga0114129_10040059 | Ga0114129_100400594 | 478 |
| 250 | 3300009147 | Ga0114129_10341170 | Ga0114129_103411702 | 478 |
| 251 | 3300015262 | Ga0182007_10017164 | Ga0182007_100171642 | 478 |
| 252 | 3300020082 | Ga0206353_12057544 | Ga0206353_120575442 | 478 |
| 253 | 3300025906 | Ga0207699_10000059 | Ga0207699_1000005976 | 478 |
| 254 | 3300025921 | Ga0207652_10075593 | Ga0207652_100755932 | 478 |
| 255 | 3300025922 | Ga0207646_10008098 | Ga0207646_100080984 | 478 |
| 256 | 3300028800 | Ga0265338_10019564 | Ga0265338_100195642 | 478 |
| 257 | 3300031241 | Ga0265325_10002766 | Ga0265325_100027664 | 478 |
| 258 | 3300036401 | Ga0373937_0025815 | Ga0373937_0025815_270_1709 | 478 |
| 259 | 3300048907 | Ga0496104_0079539 | Ga0496104_0079539_698_2137 | 478 |
| 260 | 3300050507 | nmdc:mga05p37_13546_c1 | nmdc:mga05p37_13546_c1_6596_8035 | 478 |
| 261 | 3300050507 | nmdc:mga05p37_172422_c1 | nmdc:mga05p37_172422_c1_29_1468 | 478 |
| 262 | 3300050507 | nmdc:mga05p37_72479_c1 | nmdc:mga05p37_72479_c1_1947_3386 | 478 |
| 263 | 3300050507 | nmdc:mga05p37_78461_c1 | nmdc:mga05p37_78461_c1_2287_3726 | 478 |
| 264 | 3300050512 | nmdc:mga0n895_105797_c1 | nmdc:mga0n895_105797_c1_228_1667 | 478 |
| 265 | 3300050512 | nmdc:mga0n895_32644_c1 | nmdc:mga0n895_32644_c1_2506_3966 | 478 |
| 266 | 3300050515 | nmdc:mga0a205_25783_c1 | nmdc:mga0a205_25783_c1_971_2410 | 478 |
| 267 | 3300005458 | Ga0070681_10157790 | Ga0070681_101577902 | 479 |
| 268 | 3300032002 | Ga0307416_100262449 | Ga0307416_1002624492 | 479 |
| 269 | 3300044712 | Ga0453684_0001621 | Ga0453684_0001621_46821_48263 | 479 |
| 270 | 3300005535 | Ga0070684_100155719 | Ga0070684_1001557192 | 480 |
| 271 | 3300005564 | Ga0070664_100206070 | Ga0070664_1002060702 | 480 |
| 272 | 3300005578 | Ga0068854_100085082 | Ga0068854_1000850822 | 480 |
| 273 | 3300005841 | Ga0068863_100027217 | Ga0068863_1000272177 | 480 |
| 274 | 3300037471 | Ga0395905_0005295 | Ga0395905_0005295_1805_3271 | 480 |
| 275 | 3300037471 | Ga0395905_0010943 | Ga0395905_0010943_2898_4370 | 480 |
| 276 | 3300046472 | Ga0495580_0086663 | Ga0495580_0086663_63_1523 | 480 |
| 277 | 3300049576 | Ga0501040_0054155 | Ga0501040_0054155_733_2232 | 480 |
| 278 | 3300049577 | Ga0501041_0079695 | Ga0501041_0079695_236_1735 | 480 |
| 279 | 3300049591 | Ga0501075_0086013 | Ga0501075_0086013_340_1839 | 480 |
| 280 | 3300061734 | Ga0530510_0119800 | Ga0530510_0119800_93_1592 | 480 |
| 281 | 3300005341 | Ga0070691_10013656 | Ga0070691_100136562 | 481 |
| 282 | 3300005435 | Ga0070714_100006221 | Ga0070714_1000062216 | 481 |
| 283 | 3300005435 | Ga0070714_100037113 | Ga0070714_1000371132 | 481 |
| 284 | 3300005455 | Ga0070663_100026331 | Ga0070663_1000263313 | 481 |
| 285 | 3300005563 | Ga0068855_100013304 | Ga0068855_1000133045 | 481 |
| 286 | 3300006175 | Ga0070712_100052070 | Ga0070712_1000520702 | 481 |
| 287 | 3300009093 | Ga0105240_10229670 | Ga0105240_102296702 | 481 |
| 288 | 3300013296 | Ga0157374_10247418 | Ga0157374_102474182 | 481 |
| 289 | 3300021358 | Ga0213873_10006723 | Ga0213873_100067232 | 481 |
| 290 | 3300021384 | Ga0213876_10002859 | Ga0213876_100028592 | 481 |
| 291 | 3300025906 | Ga0207699_10124858 | Ga0207699_101248581 | 481 |
| 292 | 3300025913 | Ga0207695_10165806 | Ga0207695_101658062 | 481 |
| 293 | 3300025929 | Ga0207664_10014549 | Ga0207664_100145494 | 481 |
| 294 | 3300025929 | Ga0207664_10065469 | Ga0207664_100654692 | 481 |
| 295 | 3300025949 | Ga0207667_10000669 | Ga0207667_1000066944 | 481 |
| 296 | 3300026142 | Ga0207698_10041191 | Ga0207698_100411913 | 481 |
| 297 | 3300031235 | Ga0265330_10000124 | Ga0265330_1000012426 | 481 |
| 298 | 3300031238 | Ga0265332_10000212 | Ga0265332_1000021234 | 481 |
| 299 | 3300031242 | Ga0265329_10001260 | Ga0265329_1000126010 | 481 |
| 300 | 3300031344 | Ga0265316_10000007 | Ga0265316_1000000772 | 481 |
| 301 | 3300031711 | Ga0265314_10000005 | Ga0265314_10000005360 | 481 |
| 302 | 3300031712 | Ga0265342_10003025 | Ga0265342_100030258 | 481 |
| 303 | 3300037312 | Ga0395899_0001775 | Ga0395899_0001775_5887_7338 | 481 |
| 304 | 3300037466 | Ga0395898_0103515 | Ga0395898_0103515_75_1526 | 481 |
| 305 | 3300037853 | Ga0436364_0241550 | Ga0436364_0241550_5815_7266 | 481 |
| 306 | 3300038443 | Ga0395901_0003206 | Ga0395901_0003206_9813_11264 | 481 |
| 307 | 3300039437 | Ga0436365_0018965 | Ga0436365_0018965_4307_5758 | 481 |
| 308 | 3300039438 | Ga0436360_0493754 | Ga0436360_0493754_890_2341 | 481 |
| 309 | 3300039438 | Ga0436360_1147104 | Ga0436360_1147104_423_1874 | 481 |
| 310 | 3300039447 | Ga0436361_0450174 | Ga0436361_0450174_7309_8760 | 481 |
| 311 | 3300039447 | Ga0436361_0588977 | Ga0436361_0588977_4463_5914 | 481 |
| 312 | 3300039447 | Ga0436361_1150168 | Ga0436361_1150168_2140_3591 | 481 |
| 313 | 3300039453 | Ga0436362_0157251 | Ga0436362_0157251_412_1863 | 481 |
| 314 | 3300045836 | Ga0466958_0019165 | Ga0466958_0019165_1834_3285 | 481 |
| 315 | 3300045976 | Ga0466967_0002322 | Ga0466967_0002322_9222_10673 | 481 |
| 316 | 3300045976 | Ga0466967_0101614 | Ga0466967_0101614_329_1780 | 481 |
| 317 | 3300005334 | Ga0068869_100167945 | Ga0068869_1001679452 | 482 |
| 318 | 3300005434 | Ga0070709_10008424 | Ga0070709_100084245 | 482 |
| 319 | 3300005434 | Ga0070709_10083938 | Ga0070709_100839382 | 482 |
| 320 | 3300005445 | Ga0070708_100242697 | Ga0070708_1002426971 | 482 |
| 321 | 3300005468 | Ga0070707_100055862 | Ga0070707_1000558623 | 482 |
| 322 | 3300005536 | Ga0070697_100031784 | Ga0070697_1000317842 | 482 |
| 323 | 3300005546 | Ga0070696_100016914 | Ga0070696_1000169143 | 482 |
| 324 | 3300005546 | Ga0070696_100078062 | Ga0070696_1000780621 | 482 |
| 325 | 3300005546 | Ga0070696_100089507 | Ga0070696_1000895072 | 482 |
| 326 | 3300006846 | Ga0075430_100047424 | Ga0075430_1000474242 | 482 |
| 327 | 3300006852 | Ga0075433_10003804 | Ga0075433_100038043 | 482 |
| 328 | 3300006852 | Ga0075433_10022629 | Ga0075433_100226293 | 482 |
| 329 | 3300006871 | Ga0075434_100000140 | Ga0075434_10000014017 | 482 |
| 330 | 3300006914 | Ga0075436_100024752 | Ga0075436_1000247523 | 482 |
| 331 | 3300006914 | Ga0075436_100124548 | Ga0075436_1001245481 | 482 |
| 332 | 3300007076 | Ga0075435_100002553 | Ga0075435_1000025534 | 482 |
| 333 | 3300009094 | Ga0111539_10000378 | Ga0111539_1000037814 | 482 |
| 334 | 3300021358 | Ga0213873_10010471 | Ga0213873_100104712 | 482 |
| 335 | 3300025906 | Ga0207699_10006411 | Ga0207699_100064115 | 482 |
| 336 | 3300025922 | Ga0207646_10061057 | Ga0207646_100610572 | 482 |
| 337 | 3300026089 | Ga0207648_10073743 | Ga0207648_100737432 | 482 |
| 338 | 3300027907 | Ga0207428_10001476 | Ga0207428_100014766 | 482 |
| 339 | 3300031548 | Ga0307408_100017695 | Ga0307408_1000176953 | 482 |
| 340 | 3300031731 | Ga0307405_10033555 | Ga0307405_100335553 | 482 |
| 341 | 3300031852 | Ga0307410_10005364 | Ga0307410_100053643 | 482 |
| 342 | 3300031852 | Ga0307410_10101587 | Ga0307410_101015872 | 482 |
| 343 | 3300031995 | Ga0307409_100001703 | Ga0307409_1000017033 | 482 |
| 344 | 3300032005 | Ga0307411_10035413 | Ga0307411_100354133 | 482 |
| 345 | 3300032126 | Ga0307415_100002586 | Ga0307415_1000025863 | 482 |
| 346 | 3300039438 | Ga0436360_0894906 | Ga0436360_0894906_1225_2679 | 482 |
| 347 | 3300039453 | Ga0436362_0488805 | Ga0436362_0488805_70_1524 | 482 |
| 348 | 3300042876 | Ga0451577_0020518 | Ga0451577_0020518_1657_3105 | 482 |
| 349 | 3300044673 | Ga0453683_0020206 | Ga0453683_0020206_348_1811 | 482 |
| 350 | 3300044712 | Ga0453684_0035050 | Ga0453684_0035050_4048_5496 | 482 |
| 351 | 3300045051 | Ga0451576_0005414 | Ga0451576_0005414_11140_12603 | 482 |
| 352 | 3300045051 | Ga0451576_0020838 | Ga0451576_0020838_4365_5813 | 482 |
| 353 | 3300046462 | Ga0495651_0080954 | Ga0495651_0080954_767_2215 | 482 |
| 354 | 3300046477 | Ga0495664_0030843 | Ga0495664_0030843_1576_3024 | 482 |
| 355 | 3300046516 | Ga0495628_0066798 | Ga0495628_0066798_341_1789 | 482 |
| 356 | 3300046543 | Ga0495645_0015193 | Ga0495645_0015193_455_1903 | 482 |
| 357 | 3300046809 | Ga0495600_0058742 | Ga0495600_0058742_878_2326 | 482 |
| 358 | 3300050508 | nmdc:mga09592_137932_c1 | nmdc:mga09592_137932_c1_152_1600 | 482 |
| 359 | 3300050509 | nmdc:mga0qj67_22712_c2 | nmdc:mga0qj67_22712_c2_810_2258 | 482 |
| 360 | 3300050511 | nmdc:mga08y16_2037_c1 | nmdc:mga08y16_2037_c1_6644_8092 | 482 |
| 361 | 3300050512 | nmdc:mga0n895_152933_c1 | nmdc:mga0n895_152933_c1_292_1740 | 482 |
| 362 | 3300050512 | nmdc:mga0n895_408_c1 | nmdc:mga0n895_408_c1_949_2397 | 482 |
| 363 | 3300050513 | nmdc:mga0rr50_99_c1 | nmdc:mga0rr50_99_c1_15107_16555 | 482 |
| 364 | 3300050514 | nmdc:mga08x19_8659_c1 | nmdc:mga08x19_8659_c1_3035_4483 | 482 |
| 365 | 3300050515 | nmdc:mga0a205_126628_c1 | nmdc:mga0a205_126628_c1_203_1651 | 482 |
| 366 | 3300050515 | nmdc:mga0a205_40_c1 | nmdc:mga0a205_40_c1_67664_69112 | 482 |
| 367 | 3300005329 | Ga0070683_100000007 | Ga0070683_1000000073 | 483 |
| 368 | 3300005440 | Ga0070705_100000468 | Ga0070705_1000004688 | 483 |
| 369 | 3300005444 | Ga0070694_100096265 | Ga0070694_1000962652 | 483 |
| 370 | 3300005467 | Ga0070706_100040755 | Ga0070706_1000407552 | 483 |
| 371 | 3300005518 | Ga0070699_100001260 | Ga0070699_10000126011 | 483 |
| 372 | 3300005535 | Ga0070684_100000021 | Ga0070684_100000021115 | 483 |
| 373 | 3300005545 | Ga0070695_100020180 | Ga0070695_1000201802 | 483 |
| 374 | 3300005546 | Ga0070696_100001999 | Ga0070696_1000019993 | 483 |
| 375 | 3300005549 | Ga0070704_100001301 | Ga0070704_1000013014 | 483 |
| 376 | 3300013105 | Ga0157369_10056145 | Ga0157369_100561453 | 483 |
| 377 | 3300013105 | Ga0157369_10180322 | Ga0157369_101803221 | 483 |
| 378 | 3300014326 | Ga0157380_10084763 | Ga0157380_100847632 | 483 |
| 379 | 3300025910 | Ga0207684_10033302 | Ga0207684_100333022 | 483 |
| 380 | 3300025944 | Ga0207661_10000010 | Ga0207661_100000103 | 483 |
| 381 | 3300031241 | Ga0265325_10008141 | Ga0265325_100081414 | 483 |
| 382 | 3300031242 | Ga0265329_10004592 | Ga0265329_100045923 | 483 |
| 383 | 3300031250 | Ga0265331_10006150 | Ga0265331_100061504 | 483 |
| 384 | 3300031344 | Ga0265316_10010940 | Ga0265316_100109403 | 483 |
| 385 | 3300031344 | Ga0265316_10029993 | Ga0265316_100299933 | 483 |
| 386 | 3300031711 | Ga0265314_10016579 | Ga0265314_100165793 | 483 |
| 387 | 3300045051 | Ga0451576_0019624 | Ga0451576_0019624_1374_2825 | 483 |
| 388 | 3300045051 | Ga0451576_0108337 | Ga0451576_0108337_276_1727 | 483 |
| 389 | 3300060353 | Ga0501082_0001747 | Ga0501082_0001747_5115_6566 | 483 |
| 390 | 3300005436 | Ga0070713_100034947 | Ga0070713_1000349475 | 484 |
| 391 | 3300005439 | Ga0070711_100068354 | Ga0070711_1000683542 | 484 |
| 392 | 3300005439 | Ga0070711_100086589 | Ga0070711_1000865891 | 484 |
| 393 | 3300005841 | Ga0068863_100014350 | Ga0068863_1000143503 | 484 |
| 394 | 3300006847 | Ga0075431_100003894 | Ga0075431_10000389412 | 484 |
| 395 | 3300006914 | Ga0075436_100006615 | Ga0075436_1000066153 | 484 |
| 396 | 3300009093 | Ga0105240_10000948 | Ga0105240_100009487 | 484 |
| 397 | 3300009093 | Ga0105240_10166595 | Ga0105240_101665952 | 484 |
| 398 | 3300021388 | Ga0213875_10005848 | Ga0213875_100058486 | 484 |
| 399 | 3300025913 | Ga0207695_10005967 | Ga0207695_100059675 | 484 |
| 400 | 3300025913 | Ga0207695_10082350 | Ga0207695_100823502 | 484 |
| 401 | 3300025916 | Ga0207663_10072603 | Ga0207663_100726031 | 484 |
| 402 | 3300026088 | Ga0207641_10016632 | Ga0207641_100166323 | 484 |
| 403 | 3300028653 | Ga0265323_10000266 | Ga0265323_1000026612 | 484 |
| 404 | 3300031250 | Ga0265331_10021036 | Ga0265331_100210362 | 484 |
| 405 | 3300031344 | Ga0265316_10013105 | Ga0265316_100131052 | 484 |
| 406 | 3300031344 | Ga0265316_10029090 | Ga0265316_100290902 | 484 |
| 407 | 3300031344 | Ga0265316_10050246 | Ga0265316_100502462 | 484 |
| 408 | 3300031711 | Ga0265314_10005337 | Ga0265314_100053373 | 484 |
| 409 | 3300035083 | Ga0373926_0003830 | Ga0373926_0003830_491_1945 | 484 |
| 410 | 3300035119 | Ga0373956_0017945 | Ga0373956_0017945_218_1672 | 484 |
| 411 | 3300035692 | Ga0373935_0105593 | Ga0373935_0105593_349_1803 | 484 |
| 412 | 3300035695 | Ga0373927_0007985 | Ga0373927_0007985_3910_5364 | 484 |
| 413 | 3300035695 | Ga0373927_0022195 | Ga0373927_0022195_895_2349 | 484 |
| 414 | 3300035725 | Ga0373947_0002512 | Ga0373947_0002512_1970_3424 | 484 |
| 415 | 3300036401 | Ga0373937_0028291 | Ga0373937_0028291_287_1741 | 484 |
| 416 | 3300036401 | Ga0373937_0066585 | Ga0373937_0066585_1851_3305 | 484 |
| 417 | 3300037068 | Ga0373925_0000953 | Ga0373925_0000953_20997_22451 | 484 |
| 418 | 3300037853 | Ga0436364_0970590 | Ga0436364_0970590_1139_2605 | 484 |
| 419 | 3300046472 | Ga0495580_0001612 | Ga0495580_0001612_17898_19352 | 484 |
| 420 | 3300046473 | Ga0495582_0010825 | Ga0495582_0010825_1200_2654 | 484 |
| 421 | 3300046477 | Ga0495664_0055732 | Ga0495664_0055732_392_1846 | 484 |
| 422 | 3300046531 | Ga0495665_0036323 | Ga0495665_0036323_879_2333 | 484 |
| 423 | 3300046533 | Ga0495640_0147676 | Ga0495640_0147676_32_1486 | 484 |
| 424 | 3300046559 | Ga0495667_0062077 | Ga0495667_0062077_636_2090 | 484 |
| 425 | 3300046679 | Ga0495623_0067663 | Ga0495623_0067663_420_1874 | 484 |
| 426 | 3300046683 | Ga0495658_0000540 | Ga0495658_0000540_2378_3832 | 484 |
| 427 | 3300047317 | Ga0495604_0050084 | Ga0495604_0050084_157_1611 | 484 |
| 428 | 3300047317 | Ga0495604_0084559 | Ga0495604_0084559_304_1758 | 484 |
| 429 | 3300047319 | Ga0495674_0019513 | Ga0495674_0019513_4693_6147 | 484 |
| 430 | 3300047471 | Ga0495684_0067205 | Ga0495684_0067205_691_2145 | 484 |
| 431 | 3300047471 | Ga0495684_0104348 | Ga0495684_0104348_487_1941 | 484 |
| 432 | 3300050507 | nmdc:mga05p37_133052_c1 | nmdc:mga05p37_133052_c1_1235_2689 | 484 |
| 433 | 3300050514 | nmdc:mga08x19_7696_c1 | nmdc:mga08x19_7696_c1_376_1830 | 484 |
| 434 | 3300005435 | Ga0070714_100005417 | Ga0070714_1000054175 | 485 |
| 435 | 3300005436 | Ga0070713_100007744 | Ga0070713_1000077444 | 485 |
| 436 | 3300005458 | Ga0070681_10061622 | Ga0070681_100616222 | 485 |
| 437 | 3300005467 | Ga0070706_100002605 | Ga0070706_1000026052 | 485 |
| 438 | 3300005468 | Ga0070707_100003183 | Ga0070707_1000031835 | 485 |
| 439 | 3300005546 | Ga0070696_100000158 | Ga0070696_10000015835 | 485 |
| 440 | 3300006028 | Ga0070717_10016939 | Ga0070717_100169393 | 485 |
| 441 | 3300006028 | Ga0070717_10129222 | Ga0070717_101292222 | 485 |
| 442 | 3300006173 | Ga0070716_100007388 | Ga0070716_1000073884 | 485 |
| 443 | 3300006175 | Ga0070712_100016090 | Ga0070712_1000160903 | 485 |
| 444 | 3300009093 | Ga0105240_10001342 | Ga0105240_1000134228 | 485 |
| 445 | 3300009093 | Ga0105240_10010328 | Ga0105240_1001032811 | 485 |
| 446 | 3300009093 | Ga0105240_10057336 | Ga0105240_100573363 | 485 |
| 447 | 3300009545 | Ga0105237_10001632 | Ga0105237_1000163212 | 485 |
| 448 | 3300025912 | Ga0207707_10093595 | Ga0207707_100935952 | 485 |
| 449 | 3300025913 | Ga0207695_10008345 | Ga0207695_100083459 | 485 |
| 450 | 3300025913 | Ga0207695_10047992 | Ga0207695_100479922 | 485 |
| 451 | 3300025914 | Ga0207671_10004346 | Ga0207671_1000434612 | 485 |
| 452 | 3300025915 | Ga0207693_10012264 | Ga0207693_100122643 | 485 |
| 453 | 3300025922 | Ga0207646_10000019 | Ga0207646_1000001913 | 485 |
| 454 | 3300025922 | Ga0207646_10004228 | Ga0207646_1000422811 | 485 |
| 455 | 3300025928 | Ga0207700_10005553 | Ga0207700_100055535 | 485 |
| 456 | 3300028563 | Ga0265319_1000256 | Ga0265319_100025622 | 485 |
| 457 | 3300028577 | Ga0265318_10000240 | Ga0265318_1000024017 | 485 |
| 458 | 3300028800 | Ga0265338_10034628 | Ga0265338_100346283 | 485 |
| 459 | 3300031238 | Ga0265332_10013007 | Ga0265332_100130071 | 485 |
| 460 | 3300031240 | Ga0265320_10000124 | Ga0265320_1000012429 | 485 |
| 461 | 3300031241 | Ga0265325_10007723 | Ga0265325_100077232 | 485 |
| 462 | 3300031241 | Ga0265325_10019981 | Ga0265325_100199811 | 485 |
| 463 | 3300031242 | Ga0265329_10000224 | Ga0265329_100002246 | 485 |
| 464 | 3300031250 | Ga0265331_10000232 | Ga0265331_1000023230 | 485 |
| 465 | 3300031250 | Ga0265331_10006875 | Ga0265331_100068753 | 485 |
| 466 | 3300031250 | Ga0265331_10011108 | Ga0265331_100111083 | 485 |
| 467 | 3300031344 | Ga0265316_10008501 | Ga0265316_100085013 | 485 |
| 468 | 3300031344 | Ga0265316_10008528 | Ga0265316_100085284 | 485 |
| 469 | 3300031595 | Ga0265313_10008047 | Ga0265313_100080473 | 485 |
| 470 | 3300031595 | Ga0265313_10017232 | Ga0265313_100172322 | 485 |
| 471 | 3300031711 | Ga0265314_10008097 | Ga0265314_100080972 | 485 |
| 472 | 3300031712 | Ga0265342_10000198 | Ga0265342_1000019829 | 485 |
| 473 | 3300035086 | Ga0373934_0033772 | Ga0373934_0033772_66_1532 | 485 |
| 474 | 3300035692 | Ga0373935_0055161 | Ga0373935_0055161_444_1901 | 485 |
| 475 | 3300035695 | Ga0373927_0002438 | Ga0373927_0002438_10420_11877 | 485 |
| 476 | 3300035695 | Ga0373927_0096724 | Ga0373927_0096724_177_1634 | 485 |
| 477 | 3300036401 | Ga0373937_0000024 | Ga0373937_0000024_17785_19251 | 485 |
| 478 | 3300036401 | Ga0373937_0010271 | Ga0373937_0010271_5469_6962 | 485 |
| 479 | 3300036401 | Ga0373937_0018028 | Ga0373937_0018028_441_1898 | 485 |
| 480 | 3300037853 | Ga0436364_0355922 | Ga0436364_0355922_475_1932 | 485 |
| 481 | 3300037853 | Ga0436364_0417295 | Ga0436364_0417295_667_2124 | 485 |
| 482 | 3300042876 | Ga0451577_0076000 | Ga0451577_0076000_1439_2896 | 485 |
| 483 | 3300044673 | Ga0453683_0008848 | Ga0453683_0008848_4977_6434 | 485 |
| 484 | 3300044673 | Ga0453683_0037800 | Ga0453683_0037800_1310_2767 | 485 |
| 485 | 3300044712 | Ga0453684_0055051 | Ga0453684_0055051_3540_4997 | 485 |
| 486 | 3300046462 | Ga0495651_0014639 | Ga0495651_0014639_2352_3818 | 485 |
| 487 | 3300046472 | Ga0495580_0000971 | Ga0495580_0000971_22139_23596 | 485 |
| 488 | 3300046472 | Ga0495580_0013580 | Ga0495580_0013580_4060_5517 | 485 |
| 489 | 3300046472 | Ga0495580_0048939 | Ga0495580_0048939_517_2019 | 485 |
| 490 | 3300046689 | Ga0495613_0018653 | Ga0495613_0018653_866_2323 | 485 |
| 491 | 3300047315 | Ga0495581_0053440 | Ga0495581_0053440_201_1658 | 485 |
| 492 | 3300047317 | Ga0495604_0048518 | Ga0495604_0048518_779_2245 | 485 |
| 493 | 3300047444 | Ga0495675_0003525 | Ga0495675_0003525_3847_5313 | 485 |
| 494 | 3300047471 | Ga0495684_0022713 | Ga0495684_0022713_2643_4100 | 485 |
| 495 | 3300048088 | Ga0495602_0000047 | Ga0495602_0000047_106507_107973 | 485 |
| 496 | 3300005329 | Ga0070683_100089547 | Ga0070683_1000895472 | 486 |
| 497 | 3300005330 | Ga0070690_100065457 | Ga0070690_1000654572 | 486 |
| 498 | 3300005331 | Ga0070670_100004282 | Ga0070670_1000042828 | 486 |
| 499 | 3300005336 | Ga0070680_100111622 | Ga0070680_1001116221 | 486 |
| 500 | 3300005336 | Ga0070680_100193270 | Ga0070680_1001932702 | 486 |
| 501 | 3300005338 | Ga0068868_100007852 | Ga0068868_1000078524 | 486 |
| 502 | 3300005339 | Ga0070660_100044380 | Ga0070660_1000443801 | 486 |
| 503 | 3300005434 | Ga0070709_10002535 | Ga0070709_100025353 | 486 |
| 504 | 3300005436 | Ga0070713_100004858 | Ga0070713_1000048587 | 486 |
| 505 | 3300005436 | Ga0070713_100126854 | Ga0070713_1001268542 | 486 |
| 506 | 3300005436 | Ga0070713_100174204 | Ga0070713_1001742042 | 486 |
| 507 | 3300005436 | Ga0070713_100206947 | Ga0070713_1002069471 | 486 |
| 508 | 3300005445 | Ga0070708_100000839 | Ga0070708_1000008396 | 486 |
| 509 | 3300005458 | Ga0070681_10000340 | Ga0070681_1000034021 | 486 |
| 510 | 3300005458 | Ga0070681_10080972 | Ga0070681_100809722 | 486 |
| 511 | 3300005459 | Ga0068867_100018277 | Ga0068867_1000182774 | 486 |
| 512 | 3300005467 | Ga0070706_100025394 | Ga0070706_1000253944 | 486 |
| 513 | 3300005468 | Ga0070707_100001494 | Ga0070707_1000014949 | 486 |
| 514 | 3300005471 | Ga0070698_100009390 | Ga0070698_1000093905 | 486 |
| 515 | 3300005471 | Ga0070698_100161281 | Ga0070698_1001612812 | 486 |
| 516 | 3300005518 | Ga0070699_100040937 | Ga0070699_1000409372 | 486 |
| 517 | 3300005530 | Ga0070679_100003222 | Ga0070679_1000032228 | 486 |
| 518 | 3300005530 | Ga0070679_100032884 | Ga0070679_1000328842 | 486 |
| 519 | 3300005535 | Ga0070684_100057565 | Ga0070684_1000575652 | 486 |
| 520 | 3300005536 | Ga0070697_100002164 | Ga0070697_10000216411 | 486 |
| 521 | 3300005536 | Ga0070697_100012622 | Ga0070697_1000126223 | 486 |
| 522 | 3300005536 | Ga0070697_100046900 | Ga0070697_1000469003 | 486 |
| 523 | 3300005536 | Ga0070697_100126628 | Ga0070697_1001266281 | 486 |
| 524 | 3300005539 | Ga0068853_100042750 | Ga0068853_1000427502 | 486 |
| 525 | 3300005545 | Ga0070695_100029186 | Ga0070695_1000291863 | 486 |
| 526 | 3300005545 | Ga0070695_100055457 | Ga0070695_1000554572 | 486 |
| 527 | 3300005546 | Ga0070696_100030717 | Ga0070696_1000307173 | 486 |
| 528 | 3300005547 | Ga0070693_100000065 | Ga0070693_1000000658 | 486 |
| 529 | 3300005547 | Ga0070693_100039811 | Ga0070693_1000398112 | 486 |
| 530 | 3300005549 | Ga0070704_100000207 | Ga0070704_10000020718 | 486 |
| 531 | 3300005563 | Ga0068855_100006580 | Ga0068855_1000065802 | 486 |
| 532 | 3300005563 | Ga0068855_100022860 | Ga0068855_1000228605 | 486 |
| 533 | 3300005563 | Ga0068855_100032688 | Ga0068855_1000326885 | 486 |
| 534 | 3300005563 | Ga0068855_100231229 | Ga0068855_1002312291 | 486 |
| 535 | 3300005564 | Ga0070664_100001065 | Ga0070664_10000106519 | 486 |
| 536 | 3300005577 | Ga0068857_100025348 | Ga0068857_1000253482 | 486 |
| 537 | 3300005578 | Ga0068854_100010143 | Ga0068854_1000101432 | 486 |
| 538 | 3300005578 | Ga0068854_100083367 | Ga0068854_1000833672 | 486 |
| 539 | 3300005614 | Ga0068856_100002732 | Ga0068856_10000273210 | 486 |
| 540 | 3300005614 | Ga0068856_100007427 | Ga0068856_1000074277 | 486 |
| 541 | 3300005614 | Ga0068856_100014465 | Ga0068856_1000144652 | 486 |
| 542 | 3300005614 | Ga0068856_100019599 | Ga0068856_1000195994 | 486 |
| 543 | 3300005618 | Ga0068864_100000466 | Ga0068864_10000046615 | 486 |
| 544 | 3300005718 | Ga0068866_10064889 | Ga0068866_100648892 | 486 |
| 545 | 3300005841 | Ga0068863_100001330 | Ga0068863_1000013307 | 486 |
| 546 | 3300005841 | Ga0068863_100026901 | Ga0068863_1000269013 | 486 |
| 547 | 3300005841 | Ga0068863_100082210 | Ga0068863_1000822102 | 486 |
| 548 | 3300005842 | Ga0068858_100004164 | Ga0068858_1000041642 | 486 |
| 549 | 3300005842 | Ga0068858_100017610 | Ga0068858_1000176103 | 486 |
| 550 | 3300005842 | Ga0068858_100026410 | Ga0068858_1000264104 | 486 |
| 551 | 3300005843 | Ga0068860_100017683 | Ga0068860_1000176832 | 486 |
| 552 | 3300006173 | Ga0070716_100004349 | Ga0070716_1000043494 | 486 |
| 553 | 3300006173 | Ga0070716_100027213 | Ga0070716_1000272131 | 486 |
| 554 | 3300006175 | Ga0070712_100044874 | Ga0070712_1000448744 | 486 |
| 555 | 3300006175 | Ga0070712_100054559 | Ga0070712_1000545592 | 486 |
| 556 | 3300006237 | Ga0097621_100001928 | Ga0097621_10000192810 | 486 |
| 557 | 3300006237 | Ga0097621_100005841 | Ga0097621_1000058415 | 486 |
| 558 | 3300006237 | Ga0097621_100072133 | Ga0097621_1000721332 | 486 |
| 559 | 3300006358 | Ga0068871_100000058 | Ga0068871_10000005827 | 486 |
| 560 | 3300006358 | Ga0068871_100006073 | Ga0068871_1000060733 | 486 |
| 561 | 3300006358 | Ga0068871_100030270 | Ga0068871_1000302702 | 486 |
| 562 | 3300006358 | Ga0068871_100032706 | Ga0068871_1000327062 | 486 |
| 563 | 3300006871 | Ga0075434_100024946 | Ga0075434_1000249463 | 486 |
| 564 | 3300006871 | Ga0075434_100072082 | Ga0075434_1000720822 | 486 |
| 565 | 3300006914 | Ga0075436_100002747 | Ga0075436_1000027476 | 486 |
| 566 | 3300006914 | Ga0075436_100015558 | Ga0075436_1000155583 | 486 |
| 567 | 3300006914 | Ga0075436_100088506 | Ga0075436_1000885062 | 486 |
| 568 | 3300007076 | Ga0075435_100052451 | Ga0075435_1000524512 | 486 |
| 569 | 3300007076 | Ga0075435_100085774 | Ga0075435_1000857742 | 486 |
| 570 | 3300007265 | Ga0099794_10012827 | Ga0099794_100128273 | 486 |
| 571 | 3300007265 | Ga0099794_10037928 | Ga0099794_100379282 | 486 |
| 572 | 3300009093 | Ga0105240_10011876 | Ga0105240_100118768 | 486 |
| 573 | 3300009093 | Ga0105240_10062556 | Ga0105240_100625562 | 486 |
| 574 | 3300009098 | Ga0105245_10068593 | Ga0105245_100685931 | 486 |
| 575 | 3300009174 | Ga0105241_10074141 | Ga0105241_100741412 | 486 |
| 576 | 3300009545 | Ga0105237_10009361 | Ga0105237_100093617 | 486 |
| 577 | 3300009545 | Ga0105237_10023109 | Ga0105237_100231095 | 486 |
| 578 | 3300009551 | Ga0105238_10000419 | Ga0105238_1000041911 | 486 |
| 579 | 3300009551 | Ga0105238_10020549 | Ga0105238_100205493 | 486 |
| 580 | 3300010375 | Ga0105239_10009924 | Ga0105239_100099245 | 486 |
| 581 | 3300010375 | Ga0105239_10082527 | Ga0105239_100825272 | 486 |
| 582 | 3300013100 | Ga0157373_10002219 | Ga0157373_1000221913 | 486 |
| 583 | 3300013104 | Ga0157370_10059913 | Ga0157370_100599135 | 486 |
| 584 | 3300013105 | Ga0157369_10001273 | Ga0157369_100012737 | 486 |
| 585 | 3300013105 | Ga0157369_10028229 | Ga0157369_100282293 | 486 |
| 586 | 3300013105 | Ga0157369_10035694 | Ga0157369_100356942 | 486 |
| 587 | 3300013296 | Ga0157374_10000236 | Ga0157374_1000023628 | 486 |
| 588 | 3300013296 | Ga0157374_10000722 | Ga0157374_1000072218 | 486 |
| 589 | 3300013296 | Ga0157374_10000771 | Ga0157374_1000077117 | 486 |
| 590 | 3300013296 | Ga0157374_10002785 | Ga0157374_1000278512 | 486 |
| 591 | 3300013297 | Ga0157378_10000119 | Ga0157378_1000011922 | 486 |
| 592 | 3300013297 | Ga0157378_10001314 | Ga0157378_1000131416 | 486 |
| 593 | 3300013297 | Ga0157378_10001479 | Ga0157378_1000147910 | 486 |
| 594 | 3300013297 | Ga0157378_10002703 | Ga0157378_100027034 | 486 |
| 595 | 3300013297 | Ga0157378_10003622 | Ga0157378_100036222 | 486 |
| 596 | 3300013297 | Ga0157378_10028050 | Ga0157378_100280503 | 486 |
| 597 | 3300013307 | Ga0157372_10000995 | Ga0157372_1000099515 | 486 |
| 598 | 3300013307 | Ga0157372_10002841 | Ga0157372_100028414 | 486 |
| 599 | 3300013307 | Ga0157372_10006842 | Ga0157372_100068422 | 486 |
| 600 | 3300014968 | Ga0157379_10080281 | Ga0157379_100802812 | 486 |
| 601 | 3300014969 | Ga0157376_10000037 | Ga0157376_10000037106 | 486 |
| 602 | 3300014969 | Ga0157376_10008975 | Ga0157376_100089752 | 486 |
| 603 | 3300025906 | Ga0207699_10020177 | Ga0207699_100201773 | 486 |
| 604 | 3300025906 | Ga0207699_10075199 | Ga0207699_100751992 | 486 |
| 605 | 3300025910 | Ga0207684_10001875 | Ga0207684_100018752 | 486 |
| 606 | 3300025911 | Ga0207654_10021049 | Ga0207654_100210493 | 486 |
| 607 | 3300025911 | Ga0207654_10054194 | Ga0207654_100541942 | 486 |
| 608 | 3300025912 | Ga0207707_10062989 | Ga0207707_100629892 | 486 |
| 609 | 3300025913 | Ga0207695_10010643 | Ga0207695_100106437 | 486 |
| 610 | 3300025914 | Ga0207671_10012796 | Ga0207671_100127966 | 486 |
| 611 | 3300025915 | Ga0207693_10001652 | Ga0207693_100016522 | 486 |
| 612 | 3300025915 | Ga0207693_10012627 | Ga0207693_100126274 | 486 |
| 613 | 3300025915 | Ga0207693_10065088 | Ga0207693_100650882 | 486 |
| 614 | 3300025917 | Ga0207660_10035700 | Ga0207660_100357001 | 486 |
| 615 | 3300025919 | Ga0207657_10077912 | Ga0207657_100779123 | 486 |
| 616 | 3300025921 | Ga0207652_10009107 | Ga0207652_100091076 | 486 |
| 617 | 3300025921 | Ga0207652_10018977 | Ga0207652_100189772 | 486 |
| 618 | 3300025922 | Ga0207646_10002636 | Ga0207646_100026362 | 486 |
| 619 | 3300025924 | Ga0207694_10063774 | Ga0207694_100637742 | 486 |
| 620 | 3300025927 | Ga0207687_10171987 | Ga0207687_101719871 | 486 |
| 621 | 3300025928 | Ga0207700_10014401 | Ga0207700_100144013 | 486 |
| 622 | 3300025928 | Ga0207700_10183072 | Ga0207700_101830721 | 486 |
| 623 | 3300025928 | Ga0207700_10200210 | Ga0207700_102002101 | 486 |
| 624 | 3300025929 | Ga0207664_10035338 | Ga0207664_100353382 | 486 |
| 625 | 3300025934 | Ga0207686_10053038 | Ga0207686_100530382 | 486 |
| 626 | 3300025939 | Ga0207665_10000086 | Ga0207665_1000008627 | 486 |
| 627 | 3300025939 | Ga0207665_10007051 | Ga0207665_100070515 | 486 |
| 628 | 3300025939 | Ga0207665_10012072 | Ga0207665_100120723 | 486 |
| 629 | 3300025941 | Ga0207711_10047104 | Ga0207711_100471042 | 486 |
| 630 | 3300025942 | Ga0207689_10098509 | Ga0207689_100985092 | 486 |
| 631 | 3300025944 | Ga0207661_10089568 | Ga0207661_100895682 | 486 |
| 632 | 3300025945 | Ga0207679_10103673 | Ga0207679_101036732 | 486 |
| 633 | 3300025949 | Ga0207667_10018202 | Ga0207667_100182022 | 486 |
| 634 | 3300025949 | Ga0207667_10025711 | Ga0207667_100257111 | 486 |
| 635 | 3300025949 | Ga0207667_10030236 | Ga0207667_100302365 | 486 |
| 636 | 3300025981 | Ga0207640_10038070 | Ga0207640_100380702 | 486 |
| 637 | 3300026023 | Ga0207677_10039356 | Ga0207677_100393562 | 486 |
| 638 | 3300026023 | Ga0207677_10043120 | Ga0207677_100431202 | 486 |
| 639 | 3300026035 | Ga0207703_10018012 | Ga0207703_100180123 | 486 |
| 640 | 3300026035 | Ga0207703_10021177 | Ga0207703_100211774 | 486 |
| 641 | 3300026035 | Ga0207703_10054106 | Ga0207703_100541062 | 486 |
| 642 | 3300026041 | Ga0207639_10066021 | Ga0207639_100660212 | 486 |
| 643 | 3300026078 | Ga0207702_10001512 | Ga0207702_100015129 | 486 |
| 644 | 3300026078 | Ga0207702_10014206 | Ga0207702_100142063 | 486 |
| 645 | 3300026078 | Ga0207702_10015860 | Ga0207702_100158602 | 486 |
| 646 | 3300026078 | Ga0207702_10021274 | Ga0207702_100212747 | 486 |
| 647 | 3300026078 | Ga0207702_10117725 | Ga0207702_101177252 | 486 |
| 648 | 3300026088 | Ga0207641_10004436 | Ga0207641_100044363 | 486 |
| 649 | 3300026088 | Ga0207641_10094134 | Ga0207641_100941342 | 486 |
| 650 | 3300026089 | Ga0207648_10022244 | Ga0207648_100222442 | 486 |
| 651 | 3300026095 | Ga0207676_10030079 | Ga0207676_100300793 | 486 |
| 652 | 3300026116 | Ga0207674_10002438 | Ga0207674_100024389 | 486 |
| 653 | 3300026142 | Ga0207698_10132012 | Ga0207698_101320122 | 486 |
| 654 | 3300027671 | Ga0209588_1016358 | Ga0209588_10163582 | 486 |
| 655 | 3300028016 | Ga0265354_1001572 | Ga0265354_10015722 | 486 |
| 656 | 3300028381 | Ga0268264_10004389 | Ga0268264_1000438910 | 486 |
| 657 | 3300030878 | Ga0265770_1003384 | Ga0265770_10033842 | 486 |
| 658 | 3300030878 | Ga0265770_1003400 | Ga0265770_10034001 | 486 |
| 659 | 3300035083 | Ga0373926_0000639 | Ga0373926_0000639_2510_3970 | 486 |
| 660 | 3300035691 | Ga0373931_0019390 | Ga0373931_0019390_1515_2975 | 486 |
| 661 | 3300035691 | Ga0373931_0022951 | Ga0373931_0022951_1102_2562 | 486 |
| 662 | 3300035692 | Ga0373935_0159956 | Ga0373935_0159956_51_1514 | 486 |
| 663 | 3300035695 | Ga0373927_0001417 | Ga0373927_0001417_13393_14853 | 486 |
| 664 | 3300035695 | Ga0373927_0066982 | Ga0373927_0066982_35_1498 | 486 |
| 665 | 3300035725 | Ga0373947_0008247 | Ga0373947_0008247_4207_5667 | 486 |
| 666 | 3300036401 | Ga0373937_0031107 | Ga0373937_0031107_1731_3191 | 486 |
| 667 | 3300036401 | Ga0373937_0042155 | Ga0373937_0042155_2517_3980 | 486 |
| 668 | 3300037068 | Ga0373925_0004519 | Ga0373925_0004519_7913_9373 | 486 |
| 669 | 3300037068 | Ga0373925_0026887 | Ga0373925_0026887_2703_4163 | 486 |
| 670 | 3300039437 | Ga0436365_1500819 | Ga0436365_1500819_7151_8611 | 486 |
| 671 | 3300044673 | Ga0453683_0001369 | Ga0453683_0001369_10657_12117 | 486 |
| 672 | 3300045976 | Ga0466967_0005756 | Ga0466967_0005756_6721_8181 | 486 |
| 673 | 3300046462 | Ga0495651_0000483 | Ga0495651_0000483_17339_18802 | 486 |
| 674 | 3300046462 | Ga0495651_0003398 | Ga0495651_0003398_7564_9027 | 486 |
| 675 | 3300046462 | Ga0495651_0035063 | Ga0495651_0035063_73_1536 | 486 |
| 676 | 3300046463 | Ga0495653_0017598 | Ga0495653_0017598_1744_3207 | 486 |
| 677 | 3300046472 | Ga0495580_0000712 | Ga0495580_0000712_26864_28327 | 486 |
| 678 | 3300046472 | Ga0495580_0002563 | Ga0495580_0002563_7676_9136 | 486 |
| 679 | 3300046472 | Ga0495580_0036215 | Ga0495580_0036215_388_1848 | 486 |
| 680 | 3300046475 | Ga0495639_0013469 | Ga0495639_0013469_1899_3413 | 486 |
| 681 | 3300046511 | Ga0495608_0012719 | Ga0495608_0012719_1905_3368 | 486 |
| 682 | 3300046511 | Ga0495608_0080312 | Ga0495608_0080312_46_1509 | 486 |
| 683 | 3300046511 | Ga0495608_0114762 | Ga0495608_0114762_61_1524 | 486 |
| 684 | 3300046516 | Ga0495628_0186761 | Ga0495628_0186761_59_1522 | 486 |
| 685 | 3300046517 | Ga0495630_0045494 | Ga0495630_0045494_89_1552 | 486 |
| 686 | 3300046517 | Ga0495630_0056482 | Ga0495630_0056482_785_2248 | 486 |
| 687 | 3300046529 | Ga0495652_0001580 | Ga0495652_0001580_541_2004 | 486 |
| 688 | 3300046533 | Ga0495640_0014363 | Ga0495640_0014363_3949_5463 | 486 |
| 689 | 3300046533 | Ga0495640_0068504 | Ga0495640_0068504_61_1524 | 486 |
| 690 | 3300046535 | Ga0495586_0002925 | Ga0495586_0002925_5834_7348 | 486 |
| 691 | 3300046535 | Ga0495586_0098921 | Ga0495586_0098921_44_1507 | 486 |
| 692 | 3300046536 | Ga0495587_0016792 | Ga0495587_0016792_757_2220 | 486 |
| 693 | 3300046536 | Ga0495587_0057958 | Ga0495587_0057958_694_2157 | 486 |
| 694 | 3300046543 | Ga0495645_0070936 | Ga0495645_0070936_345_1808 | 486 |
| 695 | 3300046559 | Ga0495667_0010060 | Ga0495667_0010060_157_1620 | 486 |
| 696 | 3300046559 | Ga0495667_0016733 | Ga0495667_0016733_2283_3746 | 486 |
| 697 | 3300046642 | Ga0495634_0009931 | Ga0495634_0009931_535_1998 | 486 |
| 698 | 3300046663 | Ga0495635_0006902 | Ga0495635_0006902_185_1648 | 486 |
| 699 | 3300046663 | Ga0495635_0049476 | Ga0495635_0049476_568_2031 | 486 |
| 700 | 3300046675 | Ga0495657_0087142 | Ga0495657_0087142_73_1536 | 486 |
| 701 | 3300046678 | Ga0495599_0021040 | Ga0495599_0021040_198_1661 | 486 |
| 702 | 3300046679 | Ga0495623_0029839 | Ga0495623_0029839_246_1709 | 486 |
| 703 | 3300046679 | Ga0495623_0033786 | Ga0495623_0033786_581_2044 | 486 |
| 704 | 3300046680 | Ga0495646_0083944 | Ga0495646_0083944_230_1693 | 486 |
| 705 | 3300046809 | Ga0495600_0012917 | Ga0495600_0012917_3339_4802 | 486 |
| 706 | 3300047315 | Ga0495581_0071932 | Ga0495581_0071932_480_1940 | 486 |
| 707 | 3300047317 | Ga0495604_0001339 | Ga0495604_0001339_4533_5996 | 486 |
| 708 | 3300047317 | Ga0495604_0006109 | Ga0495604_0006109_7736_9199 | 486 |
| 709 | 3300047317 | Ga0495604_0037475 | Ga0495604_0037475_1367_2830 | 486 |
| 710 | 3300047319 | Ga0495674_0002425 | Ga0495674_0002425_14990_16453 | 486 |
| 711 | 3300047321 | Ga0495676_0014185 | Ga0495676_0014185_1216_2730 | 486 |
| 712 | 3300047322 | Ga0495680_0000269 | Ga0495680_0000269_29073_30536 | 486 |
| 713 | 3300047322 | Ga0495680_0004322 | Ga0495680_0004322_9561_11024 | 486 |
| 714 | 3300047322 | Ga0495680_0011815 | Ga0495680_0011815_906_2420 | 486 |
| 715 | 3300047444 | Ga0495675_0006374 | Ga0495675_0006374_2223_3686 | 486 |
| 716 | 3300047444 | Ga0495675_0010654 | Ga0495675_0010654_4056_5519 | 486 |
| 717 | 3300047471 | Ga0495684_0002555 | Ga0495684_0002555_10578_12041 | 486 |
| 718 | 3300047471 | Ga0495684_0014038 | Ga0495684_0014038_809_2272 | 486 |
| 719 | 3300047471 | Ga0495684_0118669 | Ga0495684_0118669_504_1967 | 486 |
| 720 | 3300047673 | Ga0495593_0011035 | Ga0495593_0011035_44_1507 | 486 |
| 721 | 3300047673 | Ga0495593_0019942 | Ga0495593_0019942_1288_2802 | 486 |
| 722 | 3300048088 | Ga0495602_0007044 | Ga0495602_0007044_10272_11735 | 486 |
| 723 | 3300048905 | Ga0496102_0021886 | Ga0496102_0021886_1639_3099 | 486 |
| 724 | 3300048915 | Ga0496112_0002908 | Ga0496112_0002908_10781_12241 | 486 |
| 725 | 3300048915 | Ga0496112_0037194 | Ga0496112_0037194_54_1514 | 486 |
| 726 | 3300048915 | Ga0496112_0084609 | Ga0496112_0084609_172_1632 | 486 |
| 727 | 3300048917 | Ga0496114_0024514 | Ga0496114_0024514_3264_4724 | 486 |
| 728 | 3300048918 | Ga0496115_0004534 | Ga0496115_0004534_4754_6292 | 486 |
| 729 | 3300048918 | Ga0496115_0042261 | Ga0496115_0042261_247_1707 | 486 |
| 730 | 3300050512 | nmdc:mga0n895_82072_c1 | nmdc:mga0n895_82072_c1_1444_2904 | 486 |
| 731 | 3300050513 | nmdc:mga0rr50_111418_c1 | nmdc:mga0rr50_111418_c1_328_1788 | 486 |
| 732 | 3300050513 | nmdc:mga0rr50_74925_c1 | nmdc:mga0rr50_74925_c1_192_1652 | 486 |
| 733 | 3300050514 | nmdc:mga08x19_1089_c1 | nmdc:mga08x19_1089_c1_8789_10249 | 486 |
| 734 | 3300050514 | nmdc:mga08x19_4715_c1 | nmdc:mga08x19_4715_c1_2206_3666 | 486 |
| 735 | 3300050514 | nmdc:mga08x19_58316_c1 | nmdc:mga08x19_58316_c1_218_1678 | 486 |
| 736 | 3300005434 | Ga0070709_10000342 | Ga0070709_1000034217 | 487 |
| 737 | 3300005435 | Ga0070714_100040314 | Ga0070714_1000403142 | 487 |
| 738 | 3300005436 | Ga0070713_100000349 | Ga0070713_10000034919 | 487 |
| 739 | 3300005436 | Ga0070713_100000464 | Ga0070713_10000046411 | 487 |
| 740 | 3300005437 | Ga0070710_10015228 | Ga0070710_100152282 | 487 |
| 741 | 3300005439 | Ga0070711_100003499 | Ga0070711_1000034993 | 487 |
| 742 | 3300005439 | Ga0070711_100119529 | Ga0070711_1001195292 | 487 |
| 743 | 3300005843 | Ga0068860_100086236 | Ga0068860_1000862361 | 487 |
| 744 | 3300006028 | Ga0070717_10001227 | Ga0070717_1000122712 | 487 |
| 745 | 3300006163 | Ga0070715_10004165 | Ga0070715_100041652 | 487 |
| 746 | 3300006173 | Ga0070716_100008396 | Ga0070716_1000083962 | 487 |
| 747 | 3300006175 | Ga0070712_100000586 | Ga0070712_10000058613 | 487 |
| 748 | 3300006175 | Ga0070712_100003006 | Ga0070712_1000030066 | 487 |
| 749 | 3300024225 | Ga0224572_1012324 | Ga0224572_10123241 | 487 |
| 750 | 3300024227 | Ga0228598_1000392 | Ga0228598_10003926 | 487 |
| 751 | 3300025906 | Ga0207699_10003310 | Ga0207699_100033106 | 487 |
| 752 | 3300025906 | Ga0207699_10039166 | Ga0207699_100391663 | 487 |
| 753 | 3300025915 | Ga0207693_10000142 | Ga0207693_100001426 | 487 |
| 754 | 3300025915 | Ga0207693_10002184 | Ga0207693_1000218422 | 487 |
| 755 | 3300025916 | Ga0207663_10000512 | Ga0207663_1000051210 | 487 |
| 756 | 3300025916 | Ga0207663_10086469 | Ga0207663_100864692 | 487 |
| 757 | 3300025928 | Ga0207700_10000200 | Ga0207700_100002005 | 487 |
| 758 | 3300025928 | Ga0207700_10005255 | Ga0207700_100052556 | 487 |
| 759 | 3300025929 | Ga0207664_10047224 | Ga0207664_100472242 | 487 |
| 760 | 3300025939 | Ga0207665_10016855 | Ga0207665_100168553 | 487 |
| 761 | 3300028017 | Ga0265356_1000078 | Ga0265356_100007814 | 487 |
| 762 | 3300030760 | Ga0265762_1001021 | Ga0265762_10010212 | 487 |
| 763 | 3300031712 | Ga0265342_10021252 | Ga0265342_100212522 | 487 |
| 764 | 3300035116 | Ga0373945_0010362 | Ga0373945_0010362_1014_2477 | 487 |
| 765 | 3300035118 | Ga0373954_0035045 | Ga0373954_0035045_417_1880 | 487 |
| 766 | 3300035170 | Ga0373943_0001752 | Ga0373943_0001752_5103_6566 | 487 |
| 767 | 3300035410 | Ga0373924_0003866 | Ga0373924_0003866_2666_4129 | 487 |
| 768 | 3300035695 | Ga0373927_0000229 | Ga0373927_0000229_29786_31249 | 487 |
| 769 | 3300035724 | Ga0373933_0006936 | Ga0373933_0006936_1523_2986 | 487 |
| 770 | 3300035725 | Ga0373947_0009478 | Ga0373947_0009478_3381_4844 | 487 |
| 771 | 3300037068 | Ga0373925_0019431 | Ga0373925_0019431_1361_2824 | 487 |
| 772 | 3300037068 | Ga0373925_0021613 | Ga0373925_0021613_1171_2634 | 487 |
| 773 | 3300046459 | Ga0495629_0097478 | Ga0495629_0097478_325_1788 | 487 |
| 774 | 3300046472 | Ga0495580_0006797 | Ga0495580_0006797_3360_4823 | 487 |
| 775 | 3300046473 | Ga0495582_0027354 | Ga0495582_0027354_347_1810 | 487 |
| 776 | 3300046477 | Ga0495664_0082941 | Ga0495664_0082941_104_1567 | 487 |
| 777 | 3300046531 | Ga0495665_0052278 | Ga0495665_0052278_158_1621 | 487 |
| 778 | 3300046533 | Ga0495640_0050243 | Ga0495640_0050243_42_1505 | 487 |
| 779 | 3300046683 | Ga0495658_0020894 | Ga0495658_0020894_1010_2473 | 487 |
| 780 | 3300048088 | Ga0495602_0030330 | Ga0495602_0030330_1336_2799 | 487 |
| 781 | 3300005334 | Ga0068869_100005013 | Ga0068869_1000050134 | 488 |
| 782 | 3300005336 | Ga0070680_100019473 | Ga0070680_1000194734 | 488 |
| 783 | 3300005338 | Ga0068868_100048572 | Ga0068868_1000485722 | 488 |
| 784 | 3300005338 | Ga0068868_100085114 | Ga0068868_1000851142 | 488 |
| 785 | 3300005434 | Ga0070709_10029236 | Ga0070709_100292363 | 488 |
| 786 | 3300005434 | Ga0070709_10051108 | Ga0070709_100511082 | 488 |
| 787 | 3300005434 | Ga0070709_10095462 | Ga0070709_100954621 | 488 |
| 788 | 3300005435 | Ga0070714_100087185 | Ga0070714_1000871851 | 488 |
| 789 | 3300005435 | Ga0070714_100093185 | Ga0070714_1000931853 | 488 |
| 790 | 3300005436 | Ga0070713_100009782 | Ga0070713_1000097824 | 488 |
| 791 | 3300005436 | Ga0070713_100027388 | Ga0070713_1000273884 | 488 |
| 792 | 3300005436 | Ga0070713_100072689 | Ga0070713_1000726891 | 488 |
| 793 | 3300005436 | Ga0070713_100090480 | Ga0070713_1000904802 | 488 |
| 794 | 3300005437 | Ga0070710_10012685 | Ga0070710_100126852 | 488 |
| 795 | 3300005439 | Ga0070711_100003874 | Ga0070711_1000038746 | 488 |
| 796 | 3300005439 | Ga0070711_100102978 | Ga0070711_1001029781 | 488 |
| 797 | 3300005445 | Ga0070708_100001971 | Ga0070708_10000197111 | 488 |
| 798 | 3300005445 | Ga0070708_100006430 | Ga0070708_1000064303 | 488 |
| 799 | 3300005445 | Ga0070708_100006468 | Ga0070708_1000064684 | 488 |
| 800 | 3300005445 | Ga0070708_100159797 | Ga0070708_1001597972 | 488 |
| 801 | 3300005458 | Ga0070681_10001097 | Ga0070681_1000109717 | 488 |
| 802 | 3300005458 | Ga0070681_10017801 | Ga0070681_100178014 | 488 |
| 803 | 3300005458 | Ga0070681_10160529 | Ga0070681_101605291 | 488 |
| 804 | 3300005467 | Ga0070706_100000173 | Ga0070706_10000017369 | 488 |
| 805 | 3300005467 | Ga0070706_100001330 | Ga0070706_10000133018 | 488 |
| 806 | 3300005467 | Ga0070706_100006446 | Ga0070706_1000064468 | 488 |
| 807 | 3300005467 | Ga0070706_100018145 | Ga0070706_1000181457 | 488 |
| 808 | 3300005467 | Ga0070706_100053822 | Ga0070706_1000538223 | 488 |
| 809 | 3300005467 | Ga0070706_100085928 | Ga0070706_1000859282 | 488 |
| 810 | 3300005468 | Ga0070707_100009403 | Ga0070707_1000094036 | 488 |
| 811 | 3300005468 | Ga0070707_100009720 | Ga0070707_1000097205 | 488 |
| 812 | 3300005468 | Ga0070707_100023040 | Ga0070707_1000230402 | 488 |
| 813 | 3300005471 | Ga0070698_100002711 | Ga0070698_10000271115 | 488 |
| 814 | 3300005471 | Ga0070698_100009217 | Ga0070698_1000092176 | 488 |
| 815 | 3300005471 | Ga0070698_100099640 | Ga0070698_1000996401 | 488 |
| 816 | 3300005471 | Ga0070698_100101060 | Ga0070698_1001010602 | 488 |
| 817 | 3300005518 | Ga0070699_100004975 | Ga0070699_1000049756 | 488 |
| 818 | 3300005518 | Ga0070699_100014668 | Ga0070699_1000146683 | 488 |
| 819 | 3300005530 | Ga0070679_100014582 | Ga0070679_1000145825 | 488 |
| 820 | 3300005536 | Ga0070697_100000015 | Ga0070697_10000001561 | 488 |
| 821 | 3300005536 | Ga0070697_100000389 | Ga0070697_10000038921 | 488 |
| 822 | 3300005536 | Ga0070697_100001978 | Ga0070697_1000019786 | 488 |
| 823 | 3300005536 | Ga0070697_100013157 | Ga0070697_1000131577 | 488 |
| 824 | 3300005536 | Ga0070697_100015949 | Ga0070697_1000159492 | 488 |
| 825 | 3300005536 | Ga0070697_100127096 | Ga0070697_1001270962 | 488 |
| 826 | 3300005536 | Ga0070697_100160984 | Ga0070697_1001609841 | 488 |
| 827 | 3300005539 | Ga0068853_100047205 | Ga0068853_1000472051 | 488 |
| 828 | 3300005548 | Ga0070665_100275668 | Ga0070665_1002756681 | 488 |
| 829 | 3300005563 | Ga0068855_100041740 | Ga0068855_1000417401 | 488 |
| 830 | 3300005563 | Ga0068855_100064896 | Ga0068855_1000648964 | 488 |
| 831 | 3300005578 | Ga0068854_100016041 | Ga0068854_1000160412 | 488 |
| 832 | 3300005614 | Ga0068856_100004305 | Ga0068856_1000043055 | 488 |
| 833 | 3300005614 | Ga0068856_100239830 | Ga0068856_1002398302 | 488 |
| 834 | 3300005616 | Ga0068852_100034018 | Ga0068852_1000340182 | 488 |
| 835 | 3300005617 | Ga0068859_100018009 | Ga0068859_1000180095 | 488 |
| 836 | 3300005718 | Ga0068866_10048944 | Ga0068866_100489442 | 488 |
| 837 | 3300005718 | Ga0068866_10056358 | Ga0068866_100563581 | 488 |
| 838 | 3300005834 | Ga0068851_10009283 | Ga0068851_100092833 | 488 |
| 839 | 3300005842 | Ga0068858_100003905 | Ga0068858_1000039055 | 488 |
| 840 | 3300005843 | Ga0068860_100064272 | Ga0068860_1000642723 | 488 |
| 841 | 3300005843 | Ga0068860_100115139 | Ga0068860_1001151392 | 488 |
| 842 | 3300006028 | Ga0070717_10010164 | Ga0070717_100101647 | 488 |
| 843 | 3300006028 | Ga0070717_10021861 | Ga0070717_100218614 | 488 |
| 844 | 3300006028 | Ga0070717_10025498 | Ga0070717_100254983 | 488 |
| 845 | 3300006028 | Ga0070717_10052211 | Ga0070717_100522112 | 488 |
| 846 | 3300006028 | Ga0070717_10063584 | Ga0070717_100635842 | 488 |
| 847 | 3300006028 | Ga0070717_10095760 | Ga0070717_100957602 | 488 |
| 848 | 3300006163 | Ga0070715_10004069 | Ga0070715_100040692 | 488 |
| 849 | 3300006173 | Ga0070716_100010833 | Ga0070716_1000108333 | 488 |
| 850 | 3300006173 | Ga0070716_100096768 | Ga0070716_1000967682 | 488 |
| 851 | 3300006175 | Ga0070712_100000401 | Ga0070712_1000004016 | 488 |
| 852 | 3300006175 | Ga0070712_100004555 | Ga0070712_1000045553 | 488 |
| 853 | 3300006237 | Ga0097621_100036487 | Ga0097621_1000364873 | 488 |
| 854 | 3300006237 | Ga0097621_100067811 | Ga0097621_1000678112 | 488 |
| 855 | 3300006358 | Ga0068871_100002915 | Ga0068871_10000291515 | 488 |
| 856 | 3300006852 | Ga0075433_10000901 | Ga0075433_1000090116 | 488 |
| 857 | 3300006852 | Ga0075433_10018081 | Ga0075433_100180816 | 488 |
| 858 | 3300006871 | Ga0075434_100000987 | Ga0075434_10000098721 | 488 |
| 859 | 3300006871 | Ga0075434_100006334 | Ga0075434_10000633411 | 488 |
| 860 | 3300006871 | Ga0075434_100021397 | Ga0075434_1000213972 | 488 |
| 861 | 3300006881 | Ga0068865_100091462 | Ga0068865_1000914621 | 488 |
| 862 | 3300006914 | Ga0075436_100001850 | Ga0075436_10000185013 | 488 |
| 863 | 3300006914 | Ga0075436_100004935 | Ga0075436_1000049354 | 488 |
| 864 | 3300006914 | Ga0075436_100010290 | Ga0075436_1000102901 | 488 |
| 865 | 3300006914 | Ga0075436_100017439 | Ga0075436_1000174391 | 488 |
| 866 | 3300006914 | Ga0075436_100034305 | Ga0075436_1000343054 | 488 |
| 867 | 3300006931 | Ga0097620_100018009 | Ga0097620_1000180095 | 488 |
| 868 | 3300007076 | Ga0075435_100055269 | Ga0075435_1000552691 | 488 |
| 869 | 3300009093 | Ga0105240_10016500 | Ga0105240_100165007 | 488 |
| 870 | 3300009093 | Ga0105240_10033712 | Ga0105240_100337124 | 488 |
| 871 | 3300009093 | Ga0105240_10058901 | Ga0105240_100589011 | 488 |
| 872 | 3300009093 | Ga0105240_10082066 | Ga0105240_100820663 | 488 |
| 873 | 3300009098 | Ga0105245_10002938 | Ga0105245_100029388 | 488 |
| 874 | 3300009098 | Ga0105245_10048797 | Ga0105245_100487972 | 488 |
| 875 | 3300009098 | Ga0105245_10069721 | Ga0105245_100697212 | 488 |
| 876 | 3300009174 | Ga0105241_10051512 | Ga0105241_100515123 | 488 |
| 877 | 3300009174 | Ga0105241_10086825 | Ga0105241_100868252 | 488 |
| 878 | 3300009177 | Ga0105248_10193671 | Ga0105248_101936712 | 488 |
| 879 | 3300009545 | Ga0105237_10129759 | Ga0105237_101297592 | 488 |
| 880 | 3300009545 | Ga0105237_10131539 | Ga0105237_101315392 | 488 |
| 881 | 3300009551 | Ga0105238_10224602 | Ga0105238_102246021 | 488 |
| 882 | 3300013102 | Ga0157371_10027086 | Ga0157371_100270862 | 488 |
| 883 | 3300013104 | Ga0157370_10026110 | Ga0157370_100261103 | 488 |
| 884 | 3300013105 | Ga0157369_10089556 | Ga0157369_100895562 | 488 |
| 885 | 3300013105 | Ga0157369_10104530 | Ga0157369_101045302 | 488 |
| 886 | 3300013297 | Ga0157378_10012740 | Ga0157378_1001274011 | 488 |
| 887 | 3300013297 | Ga0157378_10036101 | Ga0157378_100361011 | 488 |
| 888 | 3300013306 | Ga0163162_10031676 | Ga0163162_100316762 | 488 |
| 889 | 3300013307 | Ga0157372_10050540 | Ga0157372_100505404 | 488 |
| 890 | 3300014325 | Ga0163163_10092351 | Ga0163163_100923512 | 488 |
| 891 | 3300014497 | Ga0182008_10002320 | Ga0182008_1000232011 | 488 |
| 892 | 3300014968 | Ga0157379_10004138 | Ga0157379_100041388 | 488 |
| 893 | 3300014969 | Ga0157376_10080074 | Ga0157376_100800742 | 488 |
| 894 | 3300022732 | Ga0224569_101491 | Ga0224569_1014912 | 488 |
| 895 | 3300024225 | Ga0224572_1006665 | Ga0224572_10066652 | 488 |
| 896 | 3300024227 | Ga0228598_1002432 | Ga0228598_10024322 | 488 |
| 897 | 3300025898 | Ga0207692_10041723 | Ga0207692_100417233 | 488 |
| 898 | 3300025899 | Ga0207642_10068661 | Ga0207642_100686611 | 488 |
| 899 | 3300025904 | Ga0207647_10000903 | Ga0207647_1000090317 | 488 |
| 900 | 3300025905 | Ga0207685_10009160 | Ga0207685_100091603 | 488 |
| 901 | 3300025905 | Ga0207685_10021750 | Ga0207685_100217501 | 488 |
| 902 | 3300025910 | Ga0207684_10000267 | Ga0207684_1000026761 | 488 |
| 903 | 3300025910 | Ga0207684_10016631 | Ga0207684_100166317 | 488 |
| 904 | 3300025910 | Ga0207684_10072921 | Ga0207684_100729212 | 488 |
| 905 | 3300025911 | Ga0207654_10085190 | Ga0207654_100851902 | 488 |
| 906 | 3300025912 | Ga0207707_10033504 | Ga0207707_100335044 | 488 |
| 907 | 3300025912 | Ga0207707_10056674 | Ga0207707_100566741 | 488 |
| 908 | 3300025912 | Ga0207707_10124957 | Ga0207707_101249572 | 488 |
| 909 | 3300025913 | Ga0207695_10021905 | Ga0207695_100219056 | 488 |
| 910 | 3300025915 | Ga0207693_10000215 | Ga0207693_1000021542 | 488 |
| 911 | 3300025915 | Ga0207693_10005175 | Ga0207693_100051758 | 488 |
| 912 | 3300025915 | Ga0207693_10007280 | Ga0207693_100072806 | 488 |
| 913 | 3300025915 | Ga0207693_10052764 | Ga0207693_100527642 | 488 |
| 914 | 3300025916 | Ga0207663_10003671 | Ga0207663_100036714 | 488 |
| 915 | 3300025916 | Ga0207663_10085250 | Ga0207663_100852501 | 488 |
| 916 | 3300025917 | Ga0207660_10012171 | Ga0207660_100121715 | 488 |
| 917 | 3300025919 | Ga0207657_10001367 | Ga0207657_1000136710 | 488 |
| 918 | 3300025921 | Ga0207652_10014985 | Ga0207652_100149854 | 488 |
| 919 | 3300025922 | Ga0207646_10001228 | Ga0207646_1000122811 | 488 |
| 920 | 3300025922 | Ga0207646_10009914 | Ga0207646_100099144 | 488 |
| 921 | 3300025922 | Ga0207646_10141232 | Ga0207646_101412321 | 488 |
| 922 | 3300025927 | Ga0207687_10032250 | Ga0207687_100322502 | 488 |
| 923 | 3300025927 | Ga0207687_10037775 | Ga0207687_100377752 | 488 |
| 924 | 3300025928 | Ga0207700_10004203 | Ga0207700_100042037 | 488 |
| 925 | 3300025928 | Ga0207700_10009464 | Ga0207700_100094642 | 488 |
| 926 | 3300025928 | Ga0207700_10014517 | Ga0207700_100145176 | 488 |
| 927 | 3300025929 | Ga0207664_10000033 | Ga0207664_10000033128 | 488 |
| 928 | 3300025929 | Ga0207664_10021505 | Ga0207664_100215054 | 488 |
| 929 | 3300025929 | Ga0207664_10045521 | Ga0207664_100455212 | 488 |
| 930 | 3300025929 | Ga0207664_10072894 | Ga0207664_100728942 | 488 |
| 931 | 3300025933 | Ga0207706_10013270 | Ga0207706_100132703 | 488 |
| 932 | 3300025934 | Ga0207686_10071236 | Ga0207686_100712362 | 488 |
| 933 | 3300025938 | Ga0207704_10100559 | Ga0207704_101005592 | 488 |
| 934 | 3300025939 | Ga0207665_10000313 | Ga0207665_1000031319 | 488 |
| 935 | 3300025939 | Ga0207665_10007816 | Ga0207665_100078168 | 488 |
| 936 | 3300025939 | Ga0207665_10012828 | Ga0207665_100128283 | 488 |
| 937 | 3300025939 | Ga0207665_10015989 | Ga0207665_100159894 | 488 |
| 938 | 3300025939 | Ga0207665_10049177 | Ga0207665_100491772 | 488 |
| 939 | 3300025942 | Ga0207689_10000788 | Ga0207689_1000078814 | 488 |
| 940 | 3300025944 | Ga0207661_10022102 | Ga0207661_100221024 | 488 |
| 941 | 3300025944 | Ga0207661_10044423 | Ga0207661_100444233 | 488 |
| 942 | 3300025981 | Ga0207640_10163867 | Ga0207640_101638671 | 488 |
| 943 | 3300026023 | Ga0207677_10009387 | Ga0207677_100093876 | 488 |
| 944 | 3300026041 | Ga0207639_10080999 | Ga0207639_100809993 | 488 |
| 945 | 3300026078 | Ga0207702_10000479 | Ga0207702_100004792 | 488 |
| 946 | 3300026078 | Ga0207702_10131588 | Ga0207702_101315882 | 488 |
| 947 | 3300026089 | Ga0207648_10016467 | Ga0207648_100164674 | 488 |
| 948 | 3300028800 | Ga0265338_10002910 | Ga0265338_100029106 | 488 |
| 949 | 3300028800 | Ga0265338_10046890 | Ga0265338_100468902 | 488 |
| 950 | 3300029957 | Ga0265324_10032731 | Ga0265324_100327311 | 488 |
| 951 | 3300030760 | Ga0265762_1000283 | Ga0265762_10002837 | 488 |
| 952 | 3300031090 | Ga0265760_10000599 | Ga0265760_100005999 | 488 |
| 953 | 3300031090 | Ga0265760_10006515 | Ga0265760_100065152 | 488 |
| 954 | 3300031090 | Ga0265760_10008310 | Ga0265760_100083102 | 488 |
| 955 | 3300031249 | Ga0265339_10008695 | Ga0265339_100086954 | 488 |
| 956 | 3300031249 | Ga0265339_10015636 | Ga0265339_100156363 | 488 |
| 957 | 3300031344 | Ga0265316_10013551 | Ga0265316_100135512 | 488 |
| 958 | 3300031507 | Ga0307509_10227982 | Ga0307509_102279821 | 488 |
| 959 | 3300035116 | Ga0373945_0000689 | Ga0373945_0000689_7031_8503 | 488 |
| 960 | 3300035170 | Ga0373943_0022494 | Ga0373943_0022494_922_2415 | 488 |
| 961 | 3300035170 | Ga0373943_0058038 | Ga0373943_0058038_181_1647 | 488 |
| 962 | 3300035410 | Ga0373924_0000013 | Ga0373924_0000013_38508_39980 | 488 |
| 963 | 3300035691 | Ga0373931_0073740 | Ga0373931_0073740_162_1628 | 488 |
| 964 | 3300035692 | Ga0373935_0003050 | Ga0373935_0003050_5841_7334 | 488 |
| 965 | 3300035692 | Ga0373935_0017559 | Ga0373935_0017559_17_1510 | 488 |
| 966 | 3300035695 | Ga0373927_0000606 | Ga0373927_0000606_20757_22250 | 488 |
| 967 | 3300035695 | Ga0373927_0024567 | Ga0373927_0024567_351_1844 | 488 |
| 968 | 3300035695 | Ga0373927_0043550 | Ga0373927_0043550_74_1540 | 488 |
| 969 | 3300035725 | Ga0373947_0003698 | Ga0373947_0003698_5073_6566 | 488 |
| 970 | 3300035725 | Ga0373947_0011145 | Ga0373947_0011145_257_1750 | 488 |
| 971 | 3300036401 | Ga0373937_0000745 | Ga0373937_0000745_9975_11447 | 488 |
| 972 | 3300036401 | Ga0373937_0109622 | Ga0373937_0109622_968_2440 | 488 |
| 973 | 3300036401 | Ga0373937_0122520 | Ga0373937_0122520_539_2011 | 488 |
| 974 | 3300037068 | Ga0373925_0003052 | Ga0373925_0003052_4761_6227 | 488 |
| 975 | 3300037068 | Ga0373925_0110317 | Ga0373925_0110317_612_2105 | 488 |
| 976 | 3300037466 | Ga0395898_0013397 | Ga0395898_0013397_6911_8383 | 488 |
| 977 | 3300037471 | Ga0395905_0036111 | Ga0395905_0036111_647_2131 | 488 |
| 978 | 3300037853 | Ga0436364_1507696 | Ga0436364_1507696_1955_3421 | 488 |
| 979 | 3300039450 | Ga0436363_0490604 | Ga0436363_0490604_1100_2566 | 488 |
| 980 | 3300039450 | Ga0436363_1030894 | Ga0436363_1030894_304_1770 | 488 |
| 981 | 3300039453 | Ga0436362_0746214 | Ga0436362_0746214_1581_3047 | 488 |
| 982 | 3300042876 | Ga0451577_0027032 | Ga0451577_0027032_1004_2479 | 488 |
| 983 | 3300042876 | Ga0451577_0083059 | Ga0451577_0083059_162_1637 | 488 |
| 984 | 3300044673 | Ga0453683_0035438 | Ga0453683_0035438_1326_2798 | 488 |
| 985 | 3300044694 | Ga0466963_0005365 | Ga0466963_0005365_4096_5568 | 488 |
| 986 | 3300044712 | Ga0453684_0000104 | Ga0453684_0000104_74837_76309 | 488 |
| 987 | 3300044842 | Ga0466957_0000974 | Ga0466957_0000974_3975_5447 | 488 |
| 988 | 3300045049 | Ga0466959_0004808 | Ga0466959_0004808_414_1880 | 488 |
| 989 | 3300045051 | Ga0451576_0036712 | Ga0451576_0036712_2759_4231 | 488 |
| 990 | 3300045051 | Ga0451576_0185158 | Ga0451576_0185158_556_2031 | 488 |
| 991 | 3300045836 | Ga0466958_0104500 | Ga0466958_0104500_124_1593 | 488 |
| 992 | 3300045836 | Ga0466958_0142049 | Ga0466958_0142049_18_1484 | 488 |
| 993 | 3300045976 | Ga0466967_0004336 | Ga0466967_0004336_4301_5773 | 488 |
| 994 | 3300045976 | Ga0466967_0035956 | Ga0466967_0035956_2150_3616 | 488 |
| 995 | 3300046472 | Ga0495580_0001294 | Ga0495580_0001294_15538_17004 | 488 |
| 996 | 3300046472 | Ga0495580_0001982 | Ga0495580_0001982_8085_9572 | 488 |
| 997 | 3300046472 | Ga0495580_0003645 | Ga0495580_0003645_6937_8403 | 488 |
| 998 | 3300046472 | Ga0495580_0032486 | Ga0495580_0032486_1261_2727 | 488 |
| 999 | 3300046472 | Ga0495580_0046976 | Ga0495580_0046976_1114_2580 | 488 |
| 1000 | 3300046472 | Ga0495580_0075779 | Ga0495580_0075779_267_1733 | 488 |
| 1001 | 3300046472 | Ga0495580_0096718 | Ga0495580_0096718_425_1891 | 488 |
| 1002 | 3300046473 | Ga0495582_0000935 | Ga0495582_0000935_5802_7268 | 488 |
| 1003 | 3300046475 | Ga0495639_0011733 | Ga0495639_0011733_449_1921 | 488 |
| 1004 | 3300046679 | Ga0495623_0021469 | Ga0495623_0021469_515_1987 | 488 |
| 1005 | 3300046683 | Ga0495658_0023244 | Ga0495658_0023244_715_2181 | 488 |
| 1006 | 3300048905 | Ga0496102_0076778 | Ga0496102_0076778_175_1641 | 488 |
| 1007 | 3300048905 | Ga0496102_0233850 | Ga0496102_0233850_36_1577 | 488 |
| 1008 | 3300048908 | Ga0496105_0110999 | Ga0496105_0110999_259_1731 | 488 |
| 1009 | 3300048914 | Ga0496111_0005463 | Ga0496111_0005463_2499_3971 | 488 |
| 1010 | 3300048915 | Ga0496112_0005823 | Ga0496112_0005823_5129_6601 | 488 |
| 1011 | 3300048915 | Ga0496112_0046687 | Ga0496112_0046687_308_1774 | 488 |
| 1012 | 3300048915 | Ga0496112_0078273 | Ga0496112_0078273_156_1622 | 488 |
| 1013 | 3300048916 | Ga0496113_0007338 | Ga0496113_0007338_546_2018 | 488 |
| 1014 | 3300048916 | Ga0496113_0096592 | Ga0496113_0096592_596_2068 | 488 |
| 1015 | 3300048916 | Ga0496113_0151387 | Ga0496113_0151387_19_1485 | 488 |
| 1016 | 3300050512 | nmdc:mga0n895_4619_c1 | nmdc:mga0n895_4619_c1_7291_8757 | 488 |
| 1017 | 3300050512 | nmdc:mga0n895_47_c1 | nmdc:mga0n895_47_c1_26933_28399 | 488 |
| 1018 | 3300050512 | nmdc:mga0n895_5144_c1 | nmdc:mga0n895_5144_c1_8334_9800 | 488 |
| 1019 | 3300050513 | nmdc:mga0rr50_44127_c1 | nmdc:mga0rr50_44127_c1_1469_2935 | 488 |
| 1020 | 3300050513 | nmdc:mga0rr50_52457_c1 | nmdc:mga0rr50_52457_c1_1280_2752 | 488 |
| 1021 | 3300050514 | nmdc:mga08x19_30070_c1 | nmdc:mga08x19_30070_c1_1563_3029 | 488 |
| 1022 | 3300050514 | nmdc:mga08x19_3030_c1 | nmdc:mga08x19_3030_c1_881_2353 | 488 |
| 1023 | 3300050514 | nmdc:mga08x19_7303_c1 | nmdc:mga08x19_7303_c1_3689_5155 | 488 |
| 1024 | 3300050514 | nmdc:mga08x19_9158_c1 | nmdc:mga08x19_9158_c1_3010_4476 | 488 |
| 1025 | 3300050515 | nmdc:mga0a205_1652_c1 | nmdc:mga0a205_1652_c1_6644_8110 | 488 |
| 1026 | 3300050515 | nmdc:mga0a205_23451_c1 | nmdc:mga0a205_23451_c1_289_1755 | 488 |
| 1027 | 3300054114 | Ga0501084_0045664 | Ga0501084_0045664_1180_2646 | 488 |
| 1028 | 3300001991 | JGI24743J22301_10003686 | JGI24743J22301_100036862 | 489 |
| 1029 | 3300002459 | JGI24751J29686_10003684 | JGI24751J29686_100036842 | 489 |
| 1030 | 3300005290 | Ga0065712_10081078 | Ga0065712_100810781 | 489 |
| 1031 | 3300005327 | Ga0070658_10028614 | Ga0070658_100286143 | 489 |
| 1032 | 3300005330 | Ga0070690_100006966 | Ga0070690_1000069662 | 489 |
| 1033 | 3300005338 | Ga0068868_100012000 | Ga0068868_1000120004 | 489 |
| 1034 | 3300005339 | Ga0070660_100011738 | Ga0070660_1000117384 | 489 |
| 1035 | 3300005353 | Ga0070669_100031982 | Ga0070669_1000319822 | 489 |
| 1036 | 3300005354 | Ga0070675_100017919 | Ga0070675_1000179196 | 489 |
| 1037 | 3300005364 | Ga0070673_100043351 | Ga0070673_1000433513 | 489 |
| 1038 | 3300005365 | Ga0070688_100007005 | Ga0070688_1000070053 | 489 |
| 1039 | 3300005459 | Ga0068867_100004171 | Ga0068867_1000041714 | 489 |
| 1040 | 3300005543 | Ga0070672_100007893 | Ga0070672_1000078938 | 489 |
| 1041 | 3300005563 | Ga0068855_100091517 | Ga0068855_1000915172 | 489 |
| 1042 | 3300005614 | Ga0068856_100023496 | Ga0068856_1000234962 | 489 |
| 1043 | 3300005615 | Ga0070702_100001776 | Ga0070702_1000017765 | 489 |
| 1044 | 3300005616 | Ga0068852_100004761 | Ga0068852_1000047617 | 489 |
| 1045 | 3300005718 | Ga0068866_10028536 | Ga0068866_100285363 | 489 |
| 1046 | 3300005834 | Ga0068851_10018430 | Ga0068851_100184302 | 489 |
| 1047 | 3300005844 | Ga0068862_100170857 | Ga0068862_1001708571 | 489 |
| 1048 | 3300009098 | Ga0105245_10071780 | Ga0105245_100717802 | 489 |
| 1049 | 3300009174 | Ga0105241_10062577 | Ga0105241_100625772 | 489 |
| 1050 | 3300009545 | Ga0105237_10033561 | Ga0105237_100335613 | 489 |
| 1051 | 3300011119 | Ga0105246_10013488 | Ga0105246_100134883 | 489 |
| 1052 | 3300013100 | Ga0157373_10005992 | Ga0157373_100059924 | 489 |
| 1053 | 3300013105 | Ga0157369_10031967 | Ga0157369_100319677 | 489 |
| 1054 | 3300013297 | Ga0157378_10204309 | Ga0157378_102043092 | 489 |
| 1055 | 3300013307 | Ga0157372_10193618 | Ga0157372_101936182 | 489 |
| 1056 | 3300014325 | Ga0163163_10050996 | Ga0163163_100509963 | 489 |
| 1057 | 3300014968 | Ga0157379_10047901 | Ga0157379_100479012 | 489 |
| 1058 | 3300017792 | Ga0163161_10009234 | Ga0163161_100092342 | 489 |
| 1059 | 3300025899 | Ga0207642_10004968 | Ga0207642_100049684 | 489 |
| 1060 | 3300025901 | Ga0207688_10008814 | Ga0207688_100088142 | 489 |
| 1061 | 3300025904 | Ga0207647_10010492 | Ga0207647_100104927 | 489 |
| 1062 | 3300025907 | Ga0207645_10001602 | Ga0207645_100016022 | 489 |
| 1063 | 3300025908 | Ga0207643_10004784 | Ga0207643_100047848 | 489 |
| 1064 | 3300025918 | Ga0207662_10002927 | Ga0207662_100029278 | 489 |
| 1065 | 3300025919 | Ga0207657_10002030 | Ga0207657_100020302 | 489 |
| 1066 | 3300025920 | Ga0207649_10000149 | Ga0207649_1000014946 | 489 |
| 1067 | 3300025923 | Ga0207681_10084825 | Ga0207681_100848252 | 489 |
| 1068 | 3300025924 | Ga0207694_10151121 | Ga0207694_101511211 | 489 |
| 1069 | 3300025925 | Ga0207650_10000442 | Ga0207650_1000044215 | 489 |
| 1070 | 3300025926 | Ga0207659_10028334 | Ga0207659_100283342 | 489 |
| 1071 | 3300025933 | Ga0207706_10000651 | Ga0207706_1000065117 | 489 |
| 1072 | 3300025936 | Ga0207670_10041122 | Ga0207670_100411222 | 489 |
| 1073 | 3300025940 | Ga0207691_10005111 | Ga0207691_100051117 | 489 |
| 1074 | 3300025942 | Ga0207689_10008927 | Ga0207689_100089274 | 489 |
| 1075 | 3300025944 | Ga0207661_10000213 | Ga0207661_1000021324 | 489 |
| 1076 | 3300025945 | Ga0207679_10000080 | Ga0207679_1000008066 | 489 |
| 1077 | 3300025960 | Ga0207651_10071562 | Ga0207651_100715621 | 489 |
| 1078 | 3300025972 | Ga0207668_10011337 | Ga0207668_100113372 | 489 |
| 1079 | 3300026088 | Ga0207641_10000432 | Ga0207641_1000043215 | 489 |
| 1080 | 3300026088 | Ga0207641_10173207 | Ga0207641_101732072 | 489 |
| 1081 | 3300026089 | Ga0207648_10001706 | Ga0207648_100017068 | 489 |
| 1082 | 3300026095 | Ga0207676_10000586 | Ga0207676_100005869 | 489 |
| 1083 | 3300026116 | Ga0207674_10001107 | Ga0207674_1000110718 | 489 |
| 1084 | 3300026118 | Ga0207675_100026225 | Ga0207675_1000262252 | 489 |
| 1085 | 3300026121 | Ga0207683_10004817 | Ga0207683_100048177 | 489 |
| 1086 | 3300028379 | Ga0268266_10015724 | Ga0268266_100157244 | 489 |
| 1087 | 3300028380 | Ga0268265_10006060 | Ga0268265_100060604 | 489 |
| 1088 | 3300048911 | Ga0496108_0000228 | Ga0496108_0000228_4114_5583 | 489 |
| 1089 | 3300048912 | Ga0496109_0000362 | Ga0496109_0000362_4997_6466 | 489 |
| 1090 | 3300048913 | Ga0496110_0001221 | Ga0496110_0001221_5972_7441 | 489 |
| 1091 | 3300048914 | Ga0496111_0002551 | Ga0496111_0002551_602_2071 | 489 |
| 1092 | 3300048915 | Ga0496112_0000034 | Ga0496112_0000034_98083_99552 | 489 |
| 1093 | 3300048916 | Ga0496113_0018008 | Ga0496113_0018008_2382_3851 | 489 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vl4-assembly1.cif.gz_B | crystal structure of a putative modulator of a dna gyrase (tm0727) from thermotoga maritima msb8 at 1.95 a resolution | 0.8499 | 2 | 482 |
| 1vl4-assembly1.cif.gz_B | crystal structure of a putative modulator of a dna gyrase (tm0727) from thermotoga maritima msb8 at 1.95 a resolution | 0.8445 | 2 | 482 |
| 3qtd-assembly2.cif.gz_B | crystal structure of putative modulator of gyrase (pmba) from pseudomonas aeruginosa pao1 | 0.8308 | 3 | 481 |
| 5njc-assembly2.cif.gz_D | e. coli microcin-processing metalloprotease tldd/e (tldd e263a mutant) with hexapeptide bound | 0.8231 | 3 | 481 |
| 5njf-assembly2.cif.gz_C | e. coli microcin-processing metalloprotease tldd/e (tldd h262a mutant) with pentapeptide bound | 0.8201 | 1 | 482 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71897_11_222_3.30.2290.10 | Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily | 0.9395 | 2 | 206 | 3.30.2290.10 |
| af_P71897_11_222_3.30.2290.10 | Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily | 0.901 | 2 | 206 | 3.30.2290.10 |
| af_Q58403_4_217_3.30.2290.10 | Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily | 0.901 | 6 | 221 | 3.30.2290.10 |
| af_Q58403_4_217_3.30.2290.10 | Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily | 0.8772 | 6 | 221 | 3.30.2290.10 |
| 1vl4B01 | Alpha Beta;2-Layer Sandwich;PmbA/TldD fold;PmbA/TldD superfamily | 0.7744 | 1 | 223 | 3.30.2290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9V9N3-F1-model_v4 | Peptidase C69 | 0.9929 | 1 | 488 |
GO:0005829
GO:0006508 GO:0008237 |
| AF-A0A7C3MA12-F1-model_v4 | TldD/PmbA family protein | 0.9909 | 1 | 481 |
GO:0005829
GO:0006508 GO:0008237 |
| AF-A0A2V9V9N3-F1-model_v4 | Peptidase C69 | 0.9908 | 1 | 488 |
GO:0005829
GO:0006508 GO:0008237 |
| AF-A0A2V9CAU8-F1-model_v4 | Peptidase C69 | 0.9886 | 1 | 249 |
GO:0005829
GO:0006508 GO:0008237 |
| AF-A0A1H3SFQ0-F1-model_v4 | TldD protein | 0.9872 | 1 | 483 |
GO:0005829
GO:0006508 GO:0008237 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar