F489800
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1087 | 453 | 1031 | 212 |
Family's Representative Sequence
| Representative Sequence | 3300006353|Ga0075370_10435859|Ga0075370_104358591 |
| Length | 232 |
| Sequence | MHSKPHPMHGLFISFEGIDGAGKSTHIAGLADAFKAEGRVVTLTREPGGTPLAEKLRAMVLNDAMDPLTEALLIFAARRDHIVNVIAPALLRGEVVLCDRFTDATFAYQGAGRGFDLKLLATLEQWVQSDEGLLGDPAGNTPMKPGVETVIEPHLTVWFDLAPEEAALRLAGARVPDKFEAQPLEFFRRVAQGYADRQKNHPERFARIDAAKSRDEVWQAVRQVFMAKGWLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 4 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 5 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 6 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 7 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 8 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 9 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 10 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 11 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 12 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 13 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 14 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 15 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 16 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 17 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 18 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 19 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 20 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 21 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 22 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 23 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 24 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 25 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 26 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 27 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 28 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 29 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 30 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 31 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 32 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 33 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 34 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 35 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 36 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 37 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 38 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 39 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 40 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 41 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 42 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 43 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 44 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 45 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 46 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 47 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 48 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 49 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 50 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 51 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 52 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 53 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 54 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 55 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 56 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 57 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 58 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 59 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 60 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 61 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 62 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 63 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 64 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 65 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 66 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 67 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 68 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 69 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 70 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 71 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 72 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 73 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 74 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 75 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 76 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 77 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 78 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 79 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 80 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 81 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 82 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 83 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 84 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 87 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 90 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 92 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 94 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 96 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 104 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 112 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 115 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 116 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 118 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 120 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 122 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 123 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 124 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 126 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 127 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 128 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 129 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 130 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 131 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 132 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 133 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 134 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 135 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 136 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 137 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 138 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 139 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 140 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 141 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 142 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 143 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 144 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 146 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 147 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 148 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 149 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 151 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 152 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 153 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 154 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 167 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 179 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 183 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 184 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 186 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 191 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 192 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 193 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 195 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 196 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 198 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 203 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 206 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 264 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 266 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 267 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 269 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 273 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 274 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 275 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 276 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 277 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 278 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 279 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 280 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 281 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 282 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 283 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 284 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 285 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 286 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 287 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 288 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 289 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 290 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 291 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 292 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 293 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 294 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 295 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 296 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 297 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 298 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 299 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 300 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 301 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 302 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 303 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 304 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 305 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 306 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 307 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 308 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 309 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 310 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 311 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 312 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 313 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 314 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 315 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 316 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 317 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 318 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 319 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 320 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 321 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 322 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 323 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 324 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 325 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 326 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 327 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 328 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 329 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 330 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 331 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 332 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 333 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 334 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 335 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 336 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 337 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 338 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 339 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 340 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 341 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 342 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 343 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 344 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 345 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 346 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 347 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 348 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 349 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 350 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 351 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 352 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 353 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 354 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 355 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 356 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 357 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 358 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 359 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 390 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 391 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 392 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 393 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 394 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 395 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 396 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 398 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 399 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 400 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 401 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 402 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 403 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 404 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 405 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 406 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 407 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 408 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 409 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 410 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 411 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 412 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 416 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 419 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 420 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 421 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 422 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 423 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 424 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 426 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 427 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 428 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 429 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 430 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 431 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 432 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 433 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 434 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 435 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 436 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 437 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 438 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 439 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 440 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 441 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 442 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 443 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 444 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 445 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 446 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 447 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 448 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 449 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 450 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 451 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 452 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 453 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.85 |
| Metatranscriptomes | 0 |
| Isolates | 5.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 23.83 |
| Nodule | 1.1 |
| Rhizoplane | 2.85 |
| Rhizosphere | 61.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000036 | 3300002704 | Bacteria | 97790 |
| 2 | JGI25156J39149_1000047 | 3300002705 | Bacteria | 97697 |
| 3 | JGI25154J39366_1000068 | 3300002738 | Bacteria | 97697 |
| 4 | JGI25157J39369_1000066 | 3300002741 | Bacteria | 97697 |
| 5 | JGI25150J39212_1000384 | 3300002774 | Bacteria | 21069 |
| 6 | JGI25150J39212_1012834 | 3300002774 | Bacteria | 1469 |
| 7 | JGI25159J45721_1000103 | 3300002987 | Bacteria | 40372 |
| 8 | JGI25159J45721_1001201 | 3300002987 | Bacteria | 11034 |
| 9 | JGI25159J45721_1003535 | 3300002987 | Bacteria | 5500 |
| 10 | JGI25159J45721_1004784 | 3300002987 | Bacteria | 4379 |
| 11 | JGI25151J46595_10001581 | 3300003187 | Bacteria | 15162 |
| 12 | JGI25151J46595_10010059 | 3300003187 | Bacteria | 4430 |
| 13 | JGI25151J46595_10011766 | 3300003187 | Bacteria | 4009 |
| 14 | JGI25151J46595_10015382 | 3300003187 | Bacteria | 3374 |
| 15 | JGI25151J46595_10019969 | 3300003187 | Bacteria | 2833 |
| 16 | JGI25151J46595_10038775 | 3300003187 | Bacteria | 1768 |
| 17 | JGI25151J46595_10056542 | 3300003187 | Bacteria | 1286 |
| 18 | JGI25153J46596_10013918 | 3300003215 | Bacteria | 3374 |
| 19 | rootH2_10003527 | 3300003320 | Bacteria | 15338 |
| 20 | rootH2_10072340 | 3300003320 | Bacteria | 1443 |
| 21 | rootL2_10001454 | 3300003322 | Bacteria | 27837 |
| 22 | rootH1_10003240 | 3300003323 | Bacteria | 16991 |
| 23 | rootH1_10074149 | 3300003323 | Bacteria | 2400 |
| 24 | JGI25160J50197_1000145 | 3300003354 | Bacteria | 63479 |
| 25 | JGI25160J50197_1000255 | 3300003354 | Bacteria | 40372 |
| 26 | JGI25160J50197_1006714 | 3300003354 | Bacteria | 4620 |
| 27 | JGI25161J50226_1000032 | 3300003374 | Bacteria | 138440 |
| 28 | JGI25161J50226_1000064 | 3300003374 | Bacteria | 99448 |
| 29 | JGI25161J50226_1000393 | 3300003374 | Bacteria | 21899 |
| 30 | JGI25161J50226_1004942 | 3300003374 | Bacteria | 2699 |
| 31 | Ga0055535_1000305 | 3300003761 | Bacteria | 49948 |
| 32 | Ga0055542_1000021 | 3300003762 | Bacteria | 331499 |
| 33 | Ga0055526_1001415 | 3300003771 | Bacteria | 17076 |
| 34 | Ga0055526_1002303 | 3300003771 | Bacteria | 13026 |
| 35 | Ga0055526_1013837 | 3300003771 | Bacteria | 3374 |
| 36 | Ga0055526_1031591 | 3300003771 | Bacteria | 1514 |
| 37 | Ga0055526_1038852 | 3300003771 | Bacteria | 1220 |
| 38 | Ga0055537_1000036 | 3300003773 | Bacteria | 96045 |
| 39 | Ga0055537_1000043 | 3300003773 | Bacteria | 90816 |
| 40 | Ga0055537_1003375 | 3300003773 | Bacteria | 4931 |
| 41 | Ga0055524_1000012 | 3300003775 | Bacteria | 260384 |
| 42 | Ga0055524_1000583 | 3300003775 | Bacteria | 26605 |
| 43 | Ga0055524_1000632 | 3300003775 | Bacteria | 25061 |
| 44 | Ga0055524_1005356 | 3300003775 | Bacteria | 5746 |
| 45 | Ga0055524_1011877 | 3300003775 | Bacteria | 3374 |
| 46 | Ga0055524_1011918 | 3300003775 | Bacteria | 3366 |
| 47 | Ga0055536_1000396 | 3300003781 | Bacteria | 31602 |
| 48 | Ga0055536_1002959 | 3300003781 | Bacteria | 9315 |
| 49 | Ga0055536_1004300 | 3300003781 | Bacteria | 7333 |
| 50 | Ga0055536_1012104 | 3300003781 | Bacteria | 3235 |
| 51 | Ga0055534_1000018 | 3300003784 | Bacteria | 138136 |
| 52 | Ga0055534_1002944 | 3300003784 | Bacteria | 5644 |
| 53 | Ga0055534_1005504 | 3300003784 | Bacteria | 3374 |
| 54 | Ga0055534_1005797 | 3300003784 | Bacteria | 3233 |
| 55 | Ga0055528_1000647 | 3300003790 | Bacteria | 25459 |
| 56 | Ga0055528_1000903 | 3300003790 | Bacteria | 20020 |
| 57 | Ga0055528_1007234 | 3300003790 | Bacteria | 4931 |
| 58 | Ga0055530_10000015 | 3300003791 | Bacteria | 148790 |
| 59 | Ga0055530_10000086 | 3300003791 | Bacteria | 80109 |
| 60 | Ga0055530_10000991 | 3300003791 | Bacteria | 22764 |
| 61 | Ga0055540_1000039 | 3300003792 | Bacteria | 161844 |
| 62 | Ga0055540_1000405 | 3300003792 | Bacteria | 34908 |
| 63 | Ga0055540_1001568 | 3300003792 | Bacteria | 13345 |
| 64 | Ga0055540_1004907 | 3300003792 | Bacteria | 5838 |
| 65 | Ga0055540_1009436 | 3300003792 | Bacteria | 3371 |
| 66 | Ga0055531_10000515 | 3300003794 | Bacteria | 34908 |
| 67 | Ga0055531_10001279 | 3300003794 | Bacteria | 18961 |
| 68 | Ga0055531_10007067 | 3300003794 | Bacteria | 6208 |
| 69 | Ga0055531_10008849 | 3300003794 | Bacteria | 5233 |
| 70 | Ga0055531_10015372 | 3300003794 | Bacteria | 3377 |
| 71 | Ga0055531_10015402 | 3300003794 | Bacteria | 3371 |
| 72 | Ga0055531_10019645 | 3300003794 | Bacteria | 2718 |
| 73 | Ga0055543_1000262 | 3300004625 | Bacteria | 39412 |
| 74 | Ga0055543_1003819 | 3300004625 | Bacteria | 4279 |
| 75 | Ga0055543_1004354 | 3300004625 | Bacteria | 3885 |
| 76 | Ga0055543_1005364 | 3300004625 | Bacteria | 3283 |
| 77 | Ga0065165_1000024 | 3300005262 | Bacteria | 247672 |
| 78 | Ga0065165_1000494 | 3300005262 | Bacteria | 60929 |
| 79 | Ga0065165_1005649 | 3300005262 | Bacteria | 6915 |
| 80 | Ga0065165_1006329 | 3300005262 | Bacteria | 6254 |
| 81 | Ga0065165_1035867 | 3300005262 | Bacteria | 1518 |
| 82 | Ga0065714_10097146 | 3300005288 | Bacteria | 1743 |
| 83 | Ga0070658_10020838 | 3300005327 | Bacteria | 5253 |
| 84 | Ga0070658_10070127 | 3300005327 | Bacteria | 2869 |
| 85 | Ga0070658_10153359 | 3300005327 | Bacteria | 1930 |
| 86 | Ga0070676_10032497 | 3300005328 | Bacteria | 2990 |
| 87 | Ga0070676_10094772 | 3300005328 | Bacteria | 1835 |
| 88 | Ga0070676_10458262 | 3300005328 | Bacteria | 898 |
| 89 | Ga0070690_100008484 | 3300005330 | Bacteria | 5921 |
| 90 | Ga0070690_100015438 | 3300005330 | Bacteria | 4555 |
| 91 | Ga0070690_100433523 | 3300005330 | Bacteria | 971 |
| 92 | Ga0070690_100701688 | 3300005330 | Bacteria | 777 |
| 93 | Ga0070670_100016508 | 3300005331 | Bacteria | 6338 |
| 94 | Ga0070670_100031821 | 3300005331 | Bacteria | 4543 |
| 95 | Ga0070670_100031847 | 3300005331 | Bacteria | 4541 |
| 96 | Ga0070670_100138098 | 3300005331 | Bacteria | 2107 |
| 97 | Ga0070670_100239530 | 3300005331 | Bacteria | 1579 |
| 98 | Ga0070670_100320268 | 3300005331 | Bacteria | 1358 |
| 99 | Ga0070677_10005552 | 3300005333 | Bacteria | 4160 |
| 100 | Ga0070677_10034580 | 3300005333 | Bacteria | 1953 |
| 101 | Ga0070677_10314110 | 3300005333 | Bacteria | 800 |
| 102 | Ga0068869_100010437 | 3300005334 | Bacteria | 6059 |
| 103 | Ga0068869_100021031 | 3300005334 | Bacteria | 4485 |
| 104 | Ga0068869_100498911 | 3300005334 | Bacteria | 1016 |
| 105 | Ga0070666_10004785 | 3300005335 | Bacteria | 8276 |
| 106 | Ga0070666_10042499 | 3300005335 | Bacteria | 3042 |
| 107 | Ga0070666_10066977 | 3300005335 | Bacteria | 2438 |
| 108 | Ga0070666_10139135 | 3300005335 | Bacteria | 1690 |
| 109 | Ga0068868_100011186 | 3300005338 | Bacteria | 6534 |
| 110 | Ga0068868_100019427 | 3300005338 | Bacteria | 5091 |
| 111 | Ga0068868_100021348 | 3300005338 | Bacteria | 4876 |
| 112 | Ga0068868_100087945 | 3300005338 | Bacteria | 2500 |
| 113 | Ga0068868_100194380 | 3300005338 | Bacteria | 1688 |
| 114 | Ga0068868_100325397 | 3300005338 | Bacteria | 1310 |
| 115 | Ga0068868_101046668 | 3300005338 | Bacteria | 749 |
| 116 | Ga0070660_100018204 | 3300005339 | Bacteria | 5129 |
| 117 | Ga0070660_100074568 | 3300005339 | Bacteria | 2655 |
| 118 | Ga0070689_100033724 | 3300005340 | Bacteria | 3903 |
| 119 | Ga0070691_10063677 | 3300005341 | Bacteria | 1778 |
| 120 | Ga0070687_100048247 | 3300005343 | Bacteria | 2189 |
| 121 | Ga0070661_100054069 | 3300005344 | Bacteria | 2941 |
| 122 | Ga0070661_100122320 | 3300005344 | Bacteria | 1950 |
| 123 | Ga0070661_100287573 | 3300005344 | Bacteria | 1277 |
| 124 | Ga0070661_100526676 | 3300005344 | Bacteria | 948 |
| 125 | Ga0070668_100001397 | 3300005347 | Bacteria | 17353 |
| 126 | Ga0070668_100050633 | 3300005347 | Bacteria | 3198 |
| 127 | Ga0070669_100045955 | 3300005353 | Bacteria | 3183 |
| 128 | Ga0070669_100093615 | 3300005353 | Bacteria | 2257 |
| 129 | Ga0070669_100157673 | 3300005353 | Bacteria | 1761 |
| 130 | Ga0070669_100177198 | 3300005353 | Bacteria | 1666 |
| 131 | Ga0070669_100185260 | 3300005353 | Bacteria | 1631 |
| 132 | Ga0070675_100001074 | 3300005354 | Bacteria | 19712 |
| 133 | Ga0070675_100036414 | 3300005354 | Bacteria | 4004 |
| 134 | Ga0070675_100040906 | 3300005354 | Bacteria | 3786 |
| 135 | Ga0070675_100065666 | 3300005354 | Bacteria | 3000 |
| 136 | Ga0070675_100104680 | 3300005354 | Bacteria | 2387 |
| 137 | Ga0070675_100124967 | 3300005354 | Bacteria | 2188 |
| 138 | Ga0070675_100512785 | 3300005354 | Bacteria | 1081 |
| 139 | Ga0070671_100008753 | 3300005355 | Bacteria | 8120 |
| 140 | Ga0070671_100012181 | 3300005355 | Bacteria | 6921 |
| 141 | Ga0070671_100016332 | 3300005355 | Bacteria | 6003 |
| 142 | Ga0070671_100129532 | 3300005355 | Bacteria | 2125 |
| 143 | Ga0070671_100176614 | 3300005355 | Bacteria | 1807 |
| 144 | Ga0070671_100317007 | 3300005355 | Bacteria | 1328 |
| 145 | Ga0070674_100010482 | 3300005356 | Bacteria | 5606 |
| 146 | Ga0070674_100020727 | 3300005356 | Bacteria | 4207 |
| 147 | Ga0070674_100104530 | 3300005356 | Bacteria | 2069 |
| 148 | Ga0070674_100278944 | 3300005356 | Bacteria | 1324 |
| 149 | Ga0070674_100646059 | 3300005356 | Bacteria | 899 |
| 150 | Ga0070674_100912887 | 3300005356 | Bacteria | 766 |
| 151 | Ga0070673_100003123 | 3300005364 | Bacteria | 10258 |
| 152 | Ga0070673_100038766 | 3300005364 | Bacteria | 3641 |
| 153 | Ga0070673_100276447 | 3300005364 | Bacteria | 1471 |
| 154 | Ga0070673_100595761 | 3300005364 | Bacteria | 1008 |
| 155 | Ga0070688_100029186 | 3300005365 | Bacteria | 3301 |
| 156 | Ga0070688_100318854 | 3300005365 | Bacteria | 1129 |
| 157 | Ga0070688_100360287 | 3300005365 | Bacteria | 1067 |
| 158 | Ga0070688_100518057 | 3300005365 | Bacteria | 902 |
| 159 | Ga0070659_100012819 | 3300005366 | Bacteria | 6225 |
| 160 | Ga0070667_100002896 | 3300005367 | Bacteria | 14740 |
| 161 | Ga0070667_100128762 | 3300005367 | Bacteria | 2208 |
| 162 | Ga0070667_100531451 | 3300005367 | Bacteria | 1080 |
| 163 | Ga0070667_100789883 | 3300005367 | Bacteria | 881 |
| 164 | Ga0070667_100802064 | 3300005367 | Bacteria | 874 |
| 165 | Ga0070714_100098982 | 3300005435 | Bacteria | 2566 |
| 166 | Ga0070701_10233997 | 3300005438 | Bacteria | 1102 |
| 167 | Ga0070663_100403733 | 3300005455 | Bacteria | 1118 |
| 168 | Ga0070663_100447059 | 3300005455 | Bacteria | 1064 |
| 169 | Ga0070678_100005243 | 3300005456 | Bacteria | 7462 |
| 170 | Ga0070678_100051960 | 3300005456 | Bacteria | 2973 |
| 171 | Ga0070678_100137458 | 3300005456 | Bacteria | 1951 |
| 172 | Ga0070678_100457609 | 3300005456 | Bacteria | 1119 |
| 173 | Ga0070678_100498604 | 3300005456 | Bacteria | 1074 |
| 174 | Ga0070678_100545753 | 3300005456 | Bacteria | 1028 |
| 175 | Ga0070678_100731769 | 3300005456 | Bacteria | 893 |
| 176 | Ga0070662_100004781 | 3300005457 | Bacteria | 8578 |
| 177 | Ga0070662_100024236 | 3300005457 | Bacteria | 4178 |
| 178 | Ga0070662_100139249 | 3300005457 | Bacteria | 1879 |
| 179 | Ga0070662_100440965 | 3300005457 | Bacteria | 1079 |
| 180 | Ga0068867_100001670 | 3300005459 | Bacteria | 15459 |
| 181 | Ga0068867_100013320 | 3300005459 | Bacteria | 5826 |
| 182 | Ga0068867_100027719 | 3300005459 | Bacteria | 4074 |
| 183 | Ga0068867_100050623 | 3300005459 | Bacteria | 3062 |
| 184 | Ga0068867_100119176 | 3300005459 | Bacteria | 2037 |
| 185 | Ga0068867_100199674 | 3300005459 | Bacteria | 1600 |
| 186 | Ga0068867_100440708 | 3300005459 | Bacteria | 1107 |
| 187 | Ga0070706_100000388 | 3300005467 | Bacteria | 52771 |
| 188 | Ga0070706_100431629 | 3300005467 | Bacteria | 1226 |
| 189 | Ga0070707_100356958 | 3300005468 | Bacteria | 1420 |
| 190 | Ga0070679_100031430 | 3300005530 | Bacteria | 5244 |
| 191 | Ga0068853_100018345 | 3300005539 | Bacteria | 5790 |
| 192 | Ga0068853_100020855 | 3300005539 | Bacteria | 5451 |
| 193 | Ga0068853_100555627 | 3300005539 | Bacteria | 1088 |
| 194 | Ga0068853_100561748 | 3300005539 | Bacteria | 1082 |
| 195 | Ga0070672_100012480 | 3300005543 | Bacteria | 5967 |
| 196 | Ga0070672_100019005 | 3300005543 | Bacteria | 4980 |
| 197 | Ga0070672_100033357 | 3300005543 | Bacteria | 3898 |
| 198 | Ga0070672_100050430 | 3300005543 | Bacteria | 3241 |
| 199 | Ga0070672_100102564 | 3300005543 | Bacteria | 2322 |
| 200 | Ga0070672_100503673 | 3300005543 | Bacteria | 1048 |
| 201 | Ga0070686_100133155 | 3300005544 | Bacteria | 1721 |
| 202 | Ga0070686_100740068 | 3300005544 | Bacteria | 788 |
| 203 | Ga0070665_100040895 | 3300005548 | Bacteria | 4658 |
| 204 | Ga0068855_100009342 | 3300005563 | Bacteria | 11841 |
| 205 | Ga0068855_100094764 | 3300005563 | Bacteria | 3442 |
| 206 | Ga0068855_100153746 | 3300005563 | Bacteria | 2615 |
| 207 | Ga0068855_101023342 | 3300005563 | Bacteria | 867 |
| 208 | Ga0068855_101050171 | 3300005563 | Bacteria | 854 |
| 209 | Ga0070664_100165367 | 3300005564 | Bacteria | 1960 |
| 210 | Ga0070664_100211415 | 3300005564 | Bacteria | 1733 |
| 211 | Ga0070664_100229315 | 3300005564 | Bacteria | 1664 |
| 212 | Ga0070664_100240264 | 3300005564 | Bacteria | 1626 |
| 213 | Ga0070664_100426239 | 3300005564 | Bacteria | 1216 |
| 214 | Ga0070664_100561621 | 3300005564 | Bacteria | 1056 |
| 215 | Ga0068857_100112387 | 3300005577 | Bacteria | 2449 |
| 216 | Ga0068857_100228885 | 3300005577 | Bacteria | 1700 |
| 217 | Ga0068857_100298797 | 3300005577 | Bacteria | 1484 |
| 218 | Ga0068854_100055556 | 3300005578 | Bacteria | 2851 |
| 219 | Ga0068854_100075713 | 3300005578 | Bacteria | 2472 |
| 220 | Ga0068854_100206316 | 3300005578 | Bacteria | 1548 |
| 221 | Ga0068856_100007479 | 3300005614 | Bacteria | 10663 |
| 222 | Ga0068856_100088244 | 3300005614 | Bacteria | 3084 |
| 223 | Ga0068856_100400526 | 3300005614 | Bacteria | 1392 |
| 224 | Ga0068856_100527512 | 3300005614 | Bacteria | 1202 |
| 225 | Ga0070702_100038663 | 3300005615 | Bacteria | 2659 |
| 226 | Ga0068852_100002342 | 3300005616 | Bacteria | 13038 |
| 227 | Ga0068852_100013873 | 3300005616 | Bacteria | 6180 |
| 228 | Ga0068852_100021650 | 3300005616 | Bacteria | 5139 |
| 229 | Ga0068852_100188255 | 3300005616 | Bacteria | 1945 |
| 230 | Ga0068852_101365473 | 3300005616 | Bacteria | 730 |
| 231 | Ga0068859_100008331 | 3300005617 | Bacteria | 10506 |
| 232 | Ga0068859_100382016 | 3300005617 | Bacteria | 1504 |
| 233 | Ga0068864_100005602 | 3300005618 | Bacteria | 10295 |
| 234 | Ga0068864_100538190 | 3300005618 | Bacteria | 1128 |
| 235 | Ga0068866_10006058 | 3300005718 | Bacteria | 5033 |
| 236 | Ga0068861_100004282 | 3300005719 | Bacteria | 9569 |
| 237 | Ga0068861_100035769 | 3300005719 | Bacteria | 3681 |
| 238 | Ga0068861_100476271 | 3300005719 | Bacteria | 1124 |
| 239 | Ga0068851_10007641 | 3300005834 | Bacteria | 4972 |
| 240 | Ga0068851_10137676 | 3300005834 | Bacteria | 1325 |
| 241 | Ga0068870_10059449 | 3300005840 | Bacteria | 2049 |
| 242 | Ga0068870_10075153 | 3300005840 | Bacteria | 1853 |
| 243 | Ga0068870_10173291 | 3300005840 | Bacteria | 1289 |
| 244 | Ga0068870_10465951 | 3300005840 | Bacteria | 836 |
| 245 | Ga0068863_100011592 | 3300005841 | Bacteria | 8530 |
| 246 | Ga0068863_100033604 | 3300005841 | Bacteria | 4886 |
| 247 | Ga0068863_100047596 | 3300005841 | Bacteria | 4067 |
| 248 | Ga0068863_100155102 | 3300005841 | Bacteria | 2192 |
| 249 | Ga0068863_100162171 | 3300005841 | Bacteria | 2142 |
| 250 | Ga0068863_100211047 | 3300005841 | Bacteria | 1870 |
| 251 | Ga0068863_100538207 | 3300005841 | Bacteria | 1152 |
| 252 | Ga0068863_100654907 | 3300005841 | Bacteria | 1042 |
| 253 | Ga0068858_100002455 | 3300005842 | Bacteria | 18716 |
| 254 | Ga0068858_100006422 | 3300005842 | Bacteria | 11450 |
| 255 | Ga0068858_100046142 | 3300005842 | Bacteria | 4040 |
| 256 | Ga0068858_100047409 | 3300005842 | Bacteria | 3983 |
| 257 | Ga0068858_100783692 | 3300005842 | Bacteria | 930 |
| 258 | Ga0068860_100020361 | 3300005843 | Bacteria | 6426 |
| 259 | Ga0068860_100038019 | 3300005843 | Bacteria | 4606 |
| 260 | Ga0068860_100065038 | 3300005843 | Bacteria | 3464 |
| 261 | Ga0068862_100064391 | 3300005844 | Bacteria | 3156 |
| 262 | Ga0068862_100087607 | 3300005844 | Bacteria | 2708 |
| 263 | Ga0068862_100153731 | 3300005844 | Bacteria | 2049 |
| 264 | Ga0068862_101175313 | 3300005844 | Bacteria | 765 |
| 265 | Ga0075365_10046079 | 3300006038 | Bacteria | 2862 |
| 266 | Ga0075365_10101422 | 3300006038 | Bacteria | 1971 |
| 267 | Ga0075368_10003959 | 3300006042 | Bacteria | 4989 |
| 268 | Ga0075368_10061326 | 3300006042 | Bacteria | 1506 |
| 269 | Ga0075368_10109924 | 3300006042 | Bacteria | 1136 |
| 270 | Ga0075363_100006375 | 3300006048 | Bacteria | 5348 |
| 271 | Ga0075363_100027660 | 3300006048 | Bacteria | 2909 |
| 272 | Ga0075363_100031855 | 3300006048 | Bacteria | 2735 |
| 273 | Ga0075363_100069601 | 3300006048 | Bacteria | 1909 |
| 274 | Ga0075364_10022128 | 3300006051 | Bacteria | 4012 |
| 275 | Ga0075364_10318497 | 3300006051 | Bacteria | 1059 |
| 276 | Ga0075364_10403967 | 3300006051 | Bacteria | 932 |
| 277 | Ga0075432_10020439 | 3300006058 | Bacteria | 2264 |
| 278 | Ga0075362_10014387 | 3300006177 | Bacteria | 3192 |
| 279 | Ga0075362_10032725 | 3300006177 | Bacteria | 2258 |
| 280 | Ga0075362_10080360 | 3300006177 | Bacteria | 1502 |
| 281 | Ga0075362_10089147 | 3300006177 | Bacteria | 1430 |
| 282 | Ga0075367_10071104 | 3300006178 | Bacteria | 2093 |
| 283 | Ga0075367_10071974 | 3300006178 | Bacteria | 2080 |
| 284 | Ga0075366_10030192 | 3300006195 | Bacteria | 3186 |
| 285 | Ga0075366_10030863 | 3300006195 | Bacteria | 3152 |
| 286 | Ga0075366_10049031 | 3300006195 | Bacteria | 2505 |
| 287 | Ga0075366_10061793 | 3300006195 | Bacteria | 2227 |
| 288 | Ga0075366_10104372 | 3300006195 | Bacteria | 1703 |
| 289 | Ga0075366_10180051 | 3300006195 | Bacteria | 1284 |
| 290 | Ga0097621_100150780 | 3300006237 | Bacteria | 1994 |
| 291 | Ga0075370_10006928 | 3300006353 | Bacteria | 5741 |
| 292 | Ga0075370_10012797 | 3300006353 | Bacteria | 4443 |
| 293 | Ga0075370_10050158 | 3300006353 | Bacteria | 2367 |
| 294 | Ga0075370_10066053 | 3300006353 | Bacteria | 2063 |
| 295 | Ga0075370_10074619 | 3300006353 | Bacteria | 1944 |
| 296 | Ga0075370_10117330 | 3300006353 | Bacteria | 1548 |
| 297 | Ga0075370_10242268 | 3300006353 | Bacteria | 1068 |
| 298 | Ga0075370_10273630 | 3300006353 | Bacteria | 1002 |
| 299 | Ga0075370_10283321 | 3300006353 | Bacteria | 984 |
| 300 | Ga0075370_10435859 | 3300006353 | Bacteria | 788 |
| 301 | Ga0068871_100008050 | 3300006358 | Bacteria | 7566 |
| 302 | Ga0068871_100069971 | 3300006358 | Bacteria | 2883 |
| 303 | Ga0068871_100201166 | 3300006358 | Bacteria | 1720 |
| 304 | Ga0068871_100241436 | 3300006358 | Bacteria | 1571 |
| 305 | Ga0075434_100427884 | 3300006871 | Bacteria | 1345 |
| 306 | Ga0068865_100015377 | 3300006881 | Bacteria | 4880 |
| 307 | Ga0068865_100038189 | 3300006881 | Bacteria | 3248 |
| 308 | Ga0068865_100235311 | 3300006881 | Bacteria | 1439 |
| 309 | Ga0068865_100313365 | 3300006881 | Bacteria | 1260 |
| 310 | Ga0097620_100008331 | 3300006931 | Bacteria | 10506 |
| 311 | Ga0097620_100382037 | 3300006931 | Bacteria | 1504 |
| 312 | Ga0099823_1003766 | 3300006944 | Bacteria | 14557 |
| 313 | Ga0079104_1000011 | 3300006946 | Bacteria | 359962 |
| 314 | Ga0079104_1016024 | 3300006946 | Bacteria | 2203 |
| 315 | Ga0099826_10003330 | 3300006948 | Bacteria | 10855 |
| 316 | Ga0099826_10072148 | 3300006948 | Bacteria | 2187 |
| 317 | Ga0099826_10275303 | 3300006948 | Bacteria | 873 |
| 318 | Ga0075435_100118395 | 3300007076 | Bacteria | 2208 |
| 319 | Ga0105244_10006079 | 3300009036 | Bacteria | 7894 |
| 320 | Ga0105250_10052315 | 3300009092 | Bacteria | 1638 |
| 321 | Ga0105240_10017248 | 3300009093 | Bacteria | 9739 |
| 322 | Ga0105240_10093187 | 3300009093 | Bacteria | 3677 |
| 323 | Ga0105245_10008645 | 3300009098 | Bacteria | 8880 |
| 324 | Ga0105245_10195835 | 3300009098 | Bacteria | 1938 |
| 325 | Ga0105245_10236879 | 3300009098 | Bacteria | 1767 |
| 326 | Ga0105243_10000481 | 3300009148 | Bacteria | 40913 |
| 327 | Ga0105243_10015811 | 3300009148 | Bacteria | 5708 |
| 328 | Ga0105243_10016483 | 3300009148 | Bacteria | 5585 |
| 329 | Ga0105243_10074640 | 3300009148 | Bacteria | 2751 |
| 330 | Ga0105243_10085514 | 3300009148 | Bacteria | 2585 |
| 331 | Ga0105243_10338670 | 3300009148 | Bacteria | 1377 |
| 332 | Ga0105243_10365387 | 3300009148 | Bacteria | 1330 |
| 333 | Ga0105243_10929338 | 3300009148 | Bacteria | 867 |
| 334 | Ga0105242_10191510 | 3300009176 | Bacteria | 1811 |
| 335 | Ga0105248_10010384 | 3300009177 | Bacteria | 10253 |
| 336 | Ga0105248_10073710 | 3300009177 | Bacteria | 3836 |
| 337 | Ga0105248_10223138 | 3300009177 | Bacteria | 2122 |
| 338 | Ga0105248_10588206 | 3300009177 | Bacteria | 1256 |
| 339 | Ga0105237_10022949 | 3300009545 | Bacteria | 6399 |
| 340 | Ga0105238_10018905 | 3300009551 | Bacteria | 7017 |
| 341 | Ga0105238_10402474 | 3300009551 | Bacteria | 1362 |
| 342 | Ga0105249_10246893 | 3300009553 | Bacteria | 1767 |
| 343 | Ga0105249_11097357 | 3300009553 | Bacteria | 866 |
| 344 | Ga0105239_10399593 | 3300010375 | Bacteria | 1555 |
| 345 | Ga0105246_10170572 | 3300011119 | Bacteria | 1666 |
| 346 | Ga0105246_10240635 | 3300011119 | Bacteria | 1430 |
| 347 | Ga0157319_1000001 | 3300012497 | Bacteria | 423237 |
| 348 | Ga0157373_10048353 | 3300013100 | Bacteria | 3033 |
| 349 | Ga0157373_10059627 | 3300013100 | Bacteria | 2704 |
| 350 | Ga0157373_10497492 | 3300013100 | Bacteria | 880 |
| 351 | Ga0157371_10189039 | 3300013102 | Bacteria | 1474 |
| 352 | Ga0157370_10138552 | 3300013104 | Bacteria | 2267 |
| 353 | Ga0157370_10292047 | 3300013104 | Bacteria | 1506 |
| 354 | Ga0157370_10453641 | 3300013104 | Bacteria | 1179 |
| 355 | Ga0157370_10561572 | 3300013104 | Bacteria | 1046 |
| 356 | Ga0157370_10827754 | 3300013104 | Bacteria | 842 |
| 357 | Ga0157369_10315473 | 3300013105 | Bacteria | 1625 |
| 358 | Ga0157369_11007943 | 3300013105 | Bacteria | 852 |
| 359 | Ga0157374_10037506 | 3300013296 | Bacteria | 4449 |
| 360 | Ga0157374_10474832 | 3300013296 | Bacteria | 1253 |
| 361 | Ga0157378_10225791 | 3300013297 | Bacteria | 1782 |
| 362 | Ga0157378_10550468 | 3300013297 | Bacteria | 1159 |
| 363 | Ga0163162_10017073 | 3300013306 | Bacteria | 7100 |
| 364 | Ga0163162_10059244 | 3300013306 | Bacteria | 3860 |
| 365 | Ga0163162_10266175 | 3300013306 | Bacteria | 1845 |
| 366 | Ga0163162_10521408 | 3300013306 | Bacteria | 1318 |
| 367 | Ga0157372_10022443 | 3300013307 | Bacteria | 6830 |
| 368 | Ga0157372_10615863 | 3300013307 | Bacteria | 1265 |
| 369 | Ga0157375_10011944 | 3300013308 | Bacteria | 7686 |
| 370 | Ga0157375_10087312 | 3300013308 | Bacteria | 3171 |
| 371 | Ga0157375_10088676 | 3300013308 | Bacteria | 3148 |
| 372 | Ga0157375_10173858 | 3300013308 | Bacteria | 2302 |
| 373 | Ga0157375_10193123 | 3300013308 | Bacteria | 2191 |
| 374 | Ga0157375_10372738 | 3300013308 | Bacteria | 1594 |
| 375 | Ga0157375_10540579 | 3300013308 | Bacteria | 1327 |
| 376 | Ga0157375_10716809 | 3300013308 | Bacteria | 1153 |
| 377 | Ga0163163_10007006 | 3300014325 | Bacteria | 9903 |
| 378 | Ga0163163_10079621 | 3300014325 | Bacteria | 3275 |
| 379 | Ga0157380_10004553 | 3300014326 | Bacteria | 9622 |
| 380 | Ga0157380_10011560 | 3300014326 | Bacteria | 6380 |
| 381 | Ga0157380_10123026 | 3300014326 | Bacteria | 2201 |
| 382 | Ga0182008_10002841 | 3300014497 | Bacteria | 10711 |
| 383 | Ga0182008_10004507 | 3300014497 | Bacteria | 8130 |
| 384 | Ga0182008_10116407 | 3300014497 | Bacteria | 1326 |
| 385 | Ga0182008_10121730 | 3300014497 | Bacteria | 1297 |
| 386 | Ga0157377_10002433 | 3300014745 | Bacteria | 8222 |
| 387 | Ga0157379_10025811 | 3300014968 | Bacteria | 5223 |
| 388 | Ga0157379_10059469 | 3300014968 | Bacteria | 3417 |
| 389 | Ga0157379_10524262 | 3300014968 | Bacteria | 1100 |
| 390 | Ga0157376_10002446 | 3300014969 | Bacteria | 12555 |
| 391 | Ga0157376_10005021 | 3300014969 | Bacteria | 9232 |
| 392 | Ga0157376_10295298 | 3300014969 | Bacteria | 1532 |
| 393 | Ga0157376_10358511 | 3300014969 | Bacteria | 1398 |
| 394 | Ga0182006_1002817 | 3300015261 | Bacteria | 9274 |
| 395 | Ga0182006_1059750 | 3300015261 | Bacteria | 1442 |
| 396 | Ga0182006_1090141 | 3300015261 | Bacteria | 1105 |
| 397 | Ga0182007_10000727 | 3300015262 | Bacteria | 18605 |
| 398 | Ga0163161_10000578 | 3300017792 | Bacteria | 29487 |
| 399 | Ga0163161_10010469 | 3300017792 | Bacteria | 6420 |
| 400 | Ga0163161_10018036 | 3300017792 | Bacteria | 4947 |
| 401 | Ga0163161_10055046 | 3300017792 | Bacteria | 2888 |
| 402 | Ga0163161_10229392 | 3300017792 | Bacteria | 1440 |
| 403 | Ga0163161_10799671 | 3300017792 | Bacteria | 792 |
| 404 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 405 | Ga0209436_104755 | 3300025208 | Bacteria | 3281 |
| 406 | Ga0209436_107635 | 3300025208 | Bacteria | 2235 |
| 407 | Ga0209672_105495 | 3300025228 | Bacteria | 2165 |
| 408 | Ga0209147_100716 | 3300025229 | Bacteria | 16796 |
| 409 | Ga0209258_100058 | 3300025242 | Bacteria | 331567 |
| 410 | Ga0207425_1000087 | 3300025245 | Bacteria | 93219 |
| 411 | Ga0207425_1000861 | 3300025245 | Bacteria | 14859 |
| 412 | Ga0207425_1002867 | 3300025245 | Bacteria | 5790 |
| 413 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 414 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 415 | Ga0209148_1000071 | 3300025254 | Bacteria | 331551 |
| 416 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 417 | Ga0209129_1000007 | 3300025258 | Bacteria | 771325 |
| 418 | Ga0209129_1001475 | 3300025258 | Bacteria | 13084 |
| 419 | Ga0209129_1002386 | 3300025258 | Bacteria | 9246 |
| 420 | Ga0209129_1021579 | 3300025258 | Bacteria | 1177 |
| 421 | Ga0209565_1000004 | 3300025263 | Bacteria | 983150 |
| 422 | Ga0209565_1000038 | 3300025263 | Bacteria | 286433 |
| 423 | Ga0209565_1000075 | 3300025263 | Bacteria | 162259 |
| 424 | Ga0209565_1000407 | 3300025263 | Bacteria | 35850 |
| 425 | Ga0209565_1001142 | 3300025263 | Bacteria | 12781 |
| 426 | Ga0209673_1000066 | 3300025273 | Bacteria | 250037 |
| 427 | Ga0209673_1000080 | 3300025273 | Bacteria | 223503 |
| 428 | Ga0209673_1000357 | 3300025273 | Bacteria | 82249 |
| 429 | Ga0209673_1002015 | 3300025273 | Bacteria | 15619 |
| 430 | Ga0209673_1003648 | 3300025273 | Bacteria | 8902 |
| 431 | Ga0209673_1007212 | 3300025273 | Bacteria | 5179 |
| 432 | Ga0209673_1021856 | 3300025273 | Bacteria | 2225 |
| 433 | Ga0209130_1000082 | 3300025284 | Bacteria | 164441 |
| 434 | Ga0209130_1000094 | 3300025284 | Bacteria | 145569 |
| 435 | Ga0209130_1000131 | 3300025284 | Bacteria | 119977 |
| 436 | Ga0209130_1000137 | 3300025284 | Bacteria | 116784 |
| 437 | Ga0209675_1000061 | 3300025291 | Bacteria | 181096 |
| 438 | Ga0209675_1000074 | 3300025291 | Bacteria | 162260 |
| 439 | Ga0209675_1000102 | 3300025291 | Bacteria | 123742 |
| 440 | Ga0209675_1001838 | 3300025291 | Bacteria | 11553 |
| 441 | Ga0209675_1017338 | 3300025291 | Bacteria | 2059 |
| 442 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 443 | Ga0209676_1000029 | 3300025292 | Bacteria | 520536 |
| 444 | Ga0209676_1000139 | 3300025292 | Bacteria | 177886 |
| 445 | Ga0209676_1000186 | 3300025292 | Bacteria | 142440 |
| 446 | Ga0209676_1000703 | 3300025292 | Bacteria | 46688 |
| 447 | Ga0209676_1001078 | 3300025292 | Bacteria | 30809 |
| 448 | Ga0209676_1062212 | 3300025292 | Bacteria | 923 |
| 449 | Ga0209025_1000056 | 3300025294 | Bacteria | 316188 |
| 450 | Ga0209025_1000088 | 3300025294 | Bacteria | 255087 |
| 451 | Ga0209025_1000104 | 3300025294 | Bacteria | 226895 |
| 452 | Ga0209025_1001422 | 3300025294 | Bacteria | 31645 |
| 453 | Ga0209025_1003318 | 3300025294 | Bacteria | 15473 |
| 454 | Ga0209025_1008022 | 3300025294 | Bacteria | 7690 |
| 455 | Ga0209025_1027766 | 3300025294 | Bacteria | 2795 |
| 456 | Ga0209025_1032944 | 3300025294 | Bacteria | 2409 |
| 457 | Ga0209564_1000005 | 3300025295 | Bacteria | 1147192 |
| 458 | Ga0209564_1000073 | 3300025295 | Bacteria | 288080 |
| 459 | Ga0209564_1000090 | 3300025295 | Bacteria | 249298 |
| 460 | Ga0209564_1000969 | 3300025295 | Bacteria | 36292 |
| 461 | Ga0209564_1001231 | 3300025295 | Bacteria | 28910 |
| 462 | Ga0209758_1000044 | 3300025297 | Bacteria | 398448 |
| 463 | Ga0209758_1037697 | 3300025297 | Bacteria | 1864 |
| 464 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 465 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 466 | Ga0209050_1000250 | 3300025298 | Bacteria | 115980 |
| 467 | Ga0209050_1003639 | 3300025298 | Bacteria | 11147 |
| 468 | Ga0209050_1005618 | 3300025298 | Bacteria | 7780 |
| 469 | Ga0209050_1030793 | 3300025298 | Bacteria | 1686 |
| 470 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 471 | Ga0209256_1000020 | 3300025299 | Bacteria | 542402 |
| 472 | Ga0209256_1000022 | 3300025299 | Bacteria | 481843 |
| 473 | Ga0209256_1000767 | 3300025299 | Bacteria | 41661 |
| 474 | Ga0209256_1001313 | 3300025299 | Bacteria | 26644 |
| 475 | Ga0209256_1029187 | 3300025299 | Bacteria | 1542 |
| 476 | Ga0209256_1039718 | 3300025299 | Bacteria | 1208 |
| 477 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 478 | Ga0207426_1000025 | 3300025302 | Bacteria | 532921 |
| 479 | Ga0207426_1000031 | 3300025302 | Bacteria | 460699 |
| 480 | Ga0207426_1004459 | 3300025302 | Bacteria | 6816 |
| 481 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 482 | Ga0209051_1000036 | 3300025303 | Bacteria | 339863 |
| 483 | Ga0209051_1000160 | 3300025303 | Bacteria | 126473 |
| 484 | Ga0209051_1000213 | 3300025303 | Bacteria | 98755 |
| 485 | Ga0209051_1000257 | 3300025303 | Bacteria | 88842 |
| 486 | Ga0209051_1003662 | 3300025303 | Bacteria | 9946 |
| 487 | Ga0209051_1011578 | 3300025303 | Bacteria | 4342 |
| 488 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 489 | Ga0209257_1000018 | 3300025304 | Bacteria | 836016 |
| 490 | Ga0209257_1000116 | 3300025304 | Bacteria | 228733 |
| 491 | Ga0209257_1000222 | 3300025304 | Bacteria | 134717 |
| 492 | Ga0209257_1000990 | 3300025304 | Bacteria | 38532 |
| 493 | Ga0209257_1002294 | 3300025304 | Bacteria | 19431 |
| 494 | Ga0209257_1003620 | 3300025304 | Bacteria | 13011 |
| 495 | Ga0207697_10216185 | 3300025315 | Bacteria | 845 |
| 496 | Ga0207656_10062707 | 3300025321 | Bacteria | 1635 |
| 497 | Ga0207656_10083798 | 3300025321 | Bacteria | 1437 |
| 498 | Ga0207696_1032993 | 3300025711 | Bacteria | 1554 |
| 499 | Ga0207655_1005759 | 3300025728 | Bacteria | 8346 |
| 500 | Ga0207682_10028273 | 3300025893 | Bacteria | 2237 |
| 501 | Ga0207682_10042718 | 3300025893 | Bacteria | 1853 |
| 502 | Ga0207682_10061978 | 3300025893 | Bacteria | 1567 |
| 503 | Ga0207682_10275181 | 3300025893 | Bacteria | 787 |
| 504 | Ga0207688_10060902 | 3300025901 | Bacteria | 2127 |
| 505 | Ga0207688_10074391 | 3300025901 | Bacteria | 1932 |
| 506 | Ga0207680_10003607 | 3300025903 | Bacteria | 7270 |
| 507 | Ga0207645_10004843 | 3300025907 | Bacteria | 9885 |
| 508 | Ga0207645_10028889 | 3300025907 | Bacteria | 3577 |
| 509 | Ga0207645_10307889 | 3300025907 | Bacteria | 1055 |
| 510 | Ga0207643_10035653 | 3300025908 | Bacteria | 2790 |
| 511 | Ga0207643_10174656 | 3300025908 | Bacteria | 1298 |
| 512 | Ga0207705_10067743 | 3300025909 | Bacteria | 2584 |
| 513 | Ga0207705_10412283 | 3300025909 | Bacteria | 1045 |
| 514 | Ga0207684_10328499 | 3300025910 | Bacteria | 1318 |
| 515 | Ga0207654_10658557 | 3300025911 | Bacteria | 750 |
| 516 | Ga0207695_10169856 | 3300025913 | Bacteria | 2107 |
| 517 | Ga0207662_10054937 | 3300025918 | Bacteria | 2375 |
| 518 | Ga0207662_10208347 | 3300025918 | Bacteria | 1268 |
| 519 | Ga0207657_10027817 | 3300025919 | Bacteria | 5171 |
| 520 | Ga0207657_10035337 | 3300025919 | Bacteria | 4482 |
| 521 | Ga0207657_10154974 | 3300025919 | Bacteria | 1863 |
| 522 | Ga0207657_10168000 | 3300025919 | Bacteria | 1778 |
| 523 | Ga0207649_10076912 | 3300025920 | Bacteria | 2149 |
| 524 | Ga0207649_10592056 | 3300025920 | Bacteria | 852 |
| 525 | Ga0207652_10528384 | 3300025921 | Bacteria | 1061 |
| 526 | Ga0207681_10003695 | 3300025923 | Bacteria | 9506 |
| 527 | Ga0207681_10049975 | 3300025923 | Bacteria | 2828 |
| 528 | Ga0207681_10064872 | 3300025923 | Bacteria | 2523 |
| 529 | Ga0207681_10355541 | 3300025923 | Bacteria | 1173 |
| 530 | Ga0207694_10065979 | 3300025924 | Bacteria | 2822 |
| 531 | Ga0207694_10312541 | 3300025924 | Bacteria | 1296 |
| 532 | Ga0207650_10020396 | 3300025925 | Bacteria | 4673 |
| 533 | Ga0207650_10043137 | 3300025925 | Bacteria | 3310 |
| 534 | Ga0207650_10066144 | 3300025925 | Bacteria | 2710 |
| 535 | Ga0207650_10106487 | 3300025925 | Bacteria | 2165 |
| 536 | Ga0207650_10221301 | 3300025925 | Bacteria | 1523 |
| 537 | Ga0207650_10518117 | 3300025925 | Bacteria | 998 |
| 538 | Ga0207650_10776745 | 3300025925 | Bacteria | 811 |
| 539 | Ga0207659_10010349 | 3300025926 | Bacteria | 5858 |
| 540 | Ga0207659_10013231 | 3300025926 | Bacteria | 5277 |
| 541 | Ga0207659_10018641 | 3300025926 | Bacteria | 4553 |
| 542 | Ga0207659_10032482 | 3300025926 | Bacteria | 3583 |
| 543 | Ga0207687_10136113 | 3300025927 | Bacteria | 1858 |
| 544 | Ga0207687_10617927 | 3300025927 | Bacteria | 914 |
| 545 | Ga0207664_10568092 | 3300025929 | Bacteria | 1018 |
| 546 | Ga0207644_10017836 | 3300025931 | Bacteria | 4800 |
| 547 | Ga0207644_10046482 | 3300025931 | Bacteria | 3093 |
| 548 | Ga0207644_10079055 | 3300025931 | Bacteria | 2425 |
| 549 | Ga0207644_10202541 | 3300025931 | Bacteria | 1566 |
| 550 | Ga0207644_10344893 | 3300025931 | Bacteria | 1208 |
| 551 | Ga0207644_10687902 | 3300025931 | Bacteria | 852 |
| 552 | Ga0207644_10731487 | 3300025931 | Bacteria | 826 |
| 553 | Ga0207690_10086195 | 3300025932 | Bacteria | 2206 |
| 554 | Ga0207706_10012717 | 3300025933 | Bacteria | 7661 |
| 555 | Ga0207706_10016241 | 3300025933 | Bacteria | 6725 |
| 556 | Ga0207706_10087115 | 3300025933 | Bacteria | 2745 |
| 557 | Ga0207706_10122025 | 3300025933 | Bacteria | 2292 |
| 558 | Ga0207706_10313150 | 3300025933 | Bacteria | 1366 |
| 559 | Ga0207686_10192865 | 3300025934 | Bacteria | 1454 |
| 560 | Ga0207709_10000074 | 3300025935 | Bacteria | 174947 |
| 561 | Ga0207709_10000292 | 3300025935 | Bacteria | 56565 |
| 562 | Ga0207709_10001791 | 3300025935 | Bacteria | 14395 |
| 563 | Ga0207709_10002968 | 3300025935 | Bacteria | 10339 |
| 564 | Ga0207709_10009056 | 3300025935 | Bacteria | 5489 |
| 565 | Ga0207709_10141454 | 3300025935 | Bacteria | 1654 |
| 566 | Ga0207709_10197351 | 3300025935 | Bacteria | 1434 |
| 567 | Ga0207709_10325830 | 3300025935 | Bacteria | 1151 |
| 568 | Ga0207709_10561338 | 3300025935 | Bacteria | 899 |
| 569 | Ga0207670_10022243 | 3300025936 | Bacteria | 3927 |
| 570 | Ga0207669_10006635 | 3300025937 | Bacteria | 5305 |
| 571 | Ga0207669_10103034 | 3300025937 | Bacteria | 1892 |
| 572 | Ga0207669_10130945 | 3300025937 | Bacteria | 1723 |
| 573 | Ga0207669_10222460 | 3300025937 | Bacteria | 1386 |
| 574 | Ga0207669_10276161 | 3300025937 | Bacteria | 1265 |
| 575 | Ga0207669_10401340 | 3300025937 | Bacteria | 1074 |
| 576 | Ga0207704_10012471 | 3300025938 | Bacteria | 4218 |
| 577 | Ga0207704_10198640 | 3300025938 | Bacteria | 1466 |
| 578 | Ga0207665_10580347 | 3300025939 | Bacteria | 874 |
| 579 | Ga0207691_10022193 | 3300025940 | Bacteria | 5987 |
| 580 | Ga0207691_10023049 | 3300025940 | Bacteria | 5865 |
| 581 | Ga0207691_10033193 | 3300025940 | Bacteria | 4806 |
| 582 | Ga0207691_10033246 | 3300025940 | Bacteria | 4801 |
| 583 | Ga0207691_10034742 | 3300025940 | Bacteria | 4685 |
| 584 | Ga0207691_10043476 | 3300025940 | Bacteria | 4141 |
| 585 | Ga0207691_10131329 | 3300025940 | Bacteria | 2212 |
| 586 | Ga0207691_10134082 | 3300025940 | Bacteria | 2186 |
| 587 | Ga0207691_10134169 | 3300025940 | Bacteria | 2185 |
| 588 | Ga0207691_10184828 | 3300025940 | Bacteria | 1820 |
| 589 | Ga0207711_10093160 | 3300025941 | Bacteria | 2653 |
| 590 | Ga0207711_10109659 | 3300025941 | Bacteria | 2453 |
| 591 | Ga0207711_10141921 | 3300025941 | Bacteria | 2162 |
| 592 | Ga0207711_10167418 | 3300025941 | Bacteria | 1993 |
| 593 | Ga0207689_10001429 | 3300025942 | Bacteria | 22803 |
| 594 | Ga0207689_10012424 | 3300025942 | Bacteria | 7280 |
| 595 | Ga0207689_10048915 | 3300025942 | Bacteria | 3488 |
| 596 | Ga0207689_10260474 | 3300025942 | Bacteria | 1435 |
| 597 | Ga0207679_10086588 | 3300025945 | Bacteria | 2410 |
| 598 | Ga0207679_10112660 | 3300025945 | Bacteria | 2150 |
| 599 | Ga0207679_10218174 | 3300025945 | Bacteria | 1604 |
| 600 | Ga0207679_10528849 | 3300025945 | Bacteria | 1056 |
| 601 | Ga0207679_10799971 | 3300025945 | Bacteria | 859 |
| 602 | Ga0207679_11065686 | 3300025945 | Bacteria | 741 |
| 603 | Ga0207667_10050606 | 3300025949 | Bacteria | 4383 |
| 604 | Ga0207667_10140675 | 3300025949 | Bacteria | 2485 |
| 605 | Ga0207667_10181107 | 3300025949 | Bacteria | 2164 |
| 606 | Ga0207651_10006261 | 3300025960 | Bacteria | 6205 |
| 607 | Ga0207651_10648348 | 3300025960 | Bacteria | 927 |
| 608 | Ga0207712_10859901 | 3300025961 | Bacteria | 800 |
| 609 | Ga0207668_10190360 | 3300025972 | Bacteria | 1625 |
| 610 | Ga0207668_10419443 | 3300025972 | Bacteria | 1136 |
| 611 | Ga0207640_10032954 | 3300025981 | Bacteria | 3218 |
| 612 | Ga0207640_10353060 | 3300025981 | Bacteria | 1182 |
| 613 | Ga0207658_10003143 | 3300025986 | Bacteria | 11814 |
| 614 | Ga0207658_10162165 | 3300025986 | Bacteria | 1833 |
| 615 | Ga0207677_10001922 | 3300026023 | Bacteria | 10987 |
| 616 | Ga0207677_10005418 | 3300026023 | Bacteria | 6927 |
| 617 | Ga0207677_10029151 | 3300026023 | Bacteria | 3503 |
| 618 | Ga0207677_10383589 | 3300026023 | Bacteria | 1187 |
| 619 | Ga0207677_10421183 | 3300026023 | Bacteria | 1137 |
| 620 | Ga0207677_10546724 | 3300026023 | Bacteria | 1009 |
| 621 | Ga0207703_10002152 | 3300026035 | Bacteria | 17313 |
| 622 | Ga0207703_10019182 | 3300026035 | Bacteria | 5342 |
| 623 | Ga0207703_10105189 | 3300026035 | Bacteria | 2399 |
| 624 | Ga0207703_10220216 | 3300026035 | Bacteria | 1696 |
| 625 | Ga0207703_10735262 | 3300026035 | Bacteria | 940 |
| 626 | Ga0207639_10043681 | 3300026041 | Bacteria | 3366 |
| 627 | Ga0207639_10069404 | 3300026041 | Bacteria | 2749 |
| 628 | Ga0207639_10179844 | 3300026041 | Bacteria | 1798 |
| 629 | Ga0207639_10424226 | 3300026041 | Bacteria | 1203 |
| 630 | Ga0207678_10035138 | 3300026067 | Bacteria | 4364 |
| 631 | Ga0207678_10253242 | 3300026067 | Bacteria | 1508 |
| 632 | Ga0207678_10468518 | 3300026067 | Bacteria | 1096 |
| 633 | Ga0207678_10657450 | 3300026067 | Bacteria | 921 |
| 634 | Ga0207702_10009730 | 3300026078 | Bacteria | 8073 |
| 635 | Ga0207702_10029676 | 3300026078 | Bacteria | 4552 |
| 636 | Ga0207641_10001478 | 3300026088 | Bacteria | 23038 |
| 637 | Ga0207641_10039250 | 3300026088 | Bacteria | 3959 |
| 638 | Ga0207641_10057522 | 3300026088 | Bacteria | 3307 |
| 639 | Ga0207641_10137763 | 3300026088 | Bacteria | 2198 |
| 640 | Ga0207641_10149917 | 3300026088 | Bacteria | 2111 |
| 641 | Ga0207641_10164601 | 3300026088 | Bacteria | 2019 |
| 642 | Ga0207641_10790446 | 3300026088 | Bacteria | 938 |
| 643 | Ga0207641_10977797 | 3300026088 | Bacteria | 842 |
| 644 | Ga0207648_10000115 | 3300026089 | Bacteria | 77967 |
| 645 | Ga0207648_10002367 | 3300026089 | Bacteria | 20334 |
| 646 | Ga0207648_10007133 | 3300026089 | Bacteria | 11021 |
| 647 | Ga0207648_10034806 | 3300026089 | Bacteria | 4440 |
| 648 | Ga0207648_10037225 | 3300026089 | Bacteria | 4285 |
| 649 | Ga0207648_10105584 | 3300026089 | Bacteria | 2471 |
| 650 | Ga0207648_10109236 | 3300026089 | Bacteria | 2428 |
| 651 | Ga0207648_11104592 | 3300026089 | Bacteria | 744 |
| 652 | Ga0207676_10005107 | 3300026095 | Bacteria | 9292 |
| 653 | Ga0207676_10052821 | 3300026095 | Bacteria | 3178 |
| 654 | Ga0207676_10361541 | 3300026095 | Bacteria | 1345 |
| 655 | Ga0207676_10502718 | 3300026095 | Bacteria | 1151 |
| 656 | Ga0207676_10727915 | 3300026095 | Bacteria | 963 |
| 657 | Ga0207676_10821321 | 3300026095 | Bacteria | 908 |
| 658 | Ga0207676_10980787 | 3300026095 | Bacteria | 832 |
| 659 | Ga0207674_10014143 | 3300026116 | Bacteria | 8818 |
| 660 | Ga0207674_10076121 | 3300026116 | Bacteria | 3365 |
| 661 | Ga0207674_10351268 | 3300026116 | Bacteria | 1425 |
| 662 | Ga0207674_10877099 | 3300026116 | Bacteria | 865 |
| 663 | Ga0207675_100000595 | 3300026118 | Bacteria | 35352 |
| 664 | Ga0207675_100000814 | 3300026118 | Bacteria | 31037 |
| 665 | Ga0207675_100042538 | 3300026118 | Bacteria | 4243 |
| 666 | Ga0207675_100160711 | 3300026118 | Bacteria | 2142 |
| 667 | Ga0207683_10011209 | 3300026121 | Bacteria | 7641 |
| 668 | Ga0207683_10017698 | 3300026121 | Bacteria | 6076 |
| 669 | Ga0207683_10018267 | 3300026121 | Bacteria | 5982 |
| 670 | Ga0207683_10130883 | 3300026121 | Bacteria | 2257 |
| 671 | Ga0207683_10238197 | 3300026121 | Bacteria | 1660 |
| 672 | Ga0207683_10262615 | 3300026121 | Bacteria | 1577 |
| 673 | Ga0207683_10382435 | 3300026121 | Bacteria | 1294 |
| 674 | Ga0207683_10636938 | 3300026121 | Bacteria | 987 |
| 675 | Ga0207683_10726588 | 3300026121 | Bacteria | 921 |
| 676 | Ga0207683_11117800 | 3300026121 | Bacteria | 731 |
| 677 | Ga0207698_10016220 | 3300026142 | Bacteria | 5015 |
| 678 | Ga0207698_10022258 | 3300026142 | Bacteria | 4400 |
| 679 | Ga0207698_10070787 | 3300026142 | Bacteria | 2765 |
| 680 | Ga0207698_10165630 | 3300026142 | Bacteria | 1939 |
| 681 | Ga0207698_10311886 | 3300026142 | Bacteria | 1469 |
| 682 | Ga0207698_10429733 | 3300026142 | Bacteria | 1269 |
| 683 | Ga0209281_1000005 | 3300027111 | Bacteria | 1242284 |
| 684 | Ga0209973_1015957 | 3300027252 | Bacteria | 953 |
| 685 | Ga0209389_1015149 | 3300027296 | Bacteria | 7002 |
| 686 | Ga0209282_1000221 | 3300027666 | Bacteria | 29591 |
| 687 | Ga0209282_1130980 | 3300027666 | Bacteria | 1240 |
| 688 | Ga0209974_10009563 | 3300027876 | Bacteria | 3291 |
| 689 | Ga0209974_10026679 | 3300027876 | Bacteria | 1911 |
| 690 | Ga0207428_10193228 | 3300027907 | Bacteria | 1534 |
| 691 | Ga0268266_10020271 | 3300028379 | Bacteria | 5669 |
| 692 | Ga0268265_10074199 | 3300028380 | Bacteria | 2660 |
| 693 | Ga0268265_10121140 | 3300028380 | Bacteria | 2155 |
| 694 | Ga0268265_10505451 | 3300028380 | Bacteria | 1140 |
| 695 | Ga0268264_10067137 | 3300028381 | Bacteria | 3027 |
| 696 | Ga0268264_10092983 | 3300028381 | Bacteria | 2604 |
| 697 | Ga0268264_10197504 | 3300028381 | Bacteria | 1838 |
| 698 | Ga0268264_10468657 | 3300028381 | Bacteria | 1223 |
| 699 | Ga0265318_10095149 | 3300028577 | Bacteria | 1097 |
| 700 | Ga0307517_10004912 | 3300028786 | Bacteria | 20370 |
| 701 | Ga0307515_10000306 | 3300028794 | Bacteria | 121448 |
| 702 | Ga0307515_10000652 | 3300028794 | Bacteria | 80185 |
| 703 | Ga0307515_10001063 | 3300028794 | Bacteria | 62886 |
| 704 | Ga0307515_10005560 | 3300028794 | Bacteria | 25507 |
| 705 | Ga0307515_10005581 | 3300028794 | Bacteria | 25423 |
| 706 | Ga0307515_10095345 | 3300028794 | Bacteria | 3663 |
| 707 | Ga0307515_10209656 | 3300028794 | Bacteria | 1796 |
| 708 | Ga0307515_10294695 | 3300028794 | Bacteria | 1314 |
| 709 | Ga0307512_10036774 | 3300030522 | Bacteria | 4146 |
| 710 | Ga0307512_10152045 | 3300030522 | Bacteria | 1381 |
| 711 | Ga0316177_1105017 | 3300030731 | Bacteria | 5728 |
| 712 | Ga0316176_1013009 | 3300030732 | Bacteria | 2964 |
| 713 | Ga0314311_1155152 | 3300030733 | Bacteria | 3630 |
| 714 | Ga0316178_1038440 | 3300030735 | Bacteria | 2166 |
| 715 | Ga0316183_1039891 | 3300030742 | Bacteria | 7261 |
| 716 | Ga0265330_10000344 | 3300031235 | Bacteria | 33165 |
| 717 | Ga0265332_10000002 | 3300031238 | Bacteria | 709510 |
| 718 | Ga0265332_10000094 | 3300031238 | Bacteria | 77636 |
| 719 | Ga0265325_10010778 | 3300031241 | Bacteria | 5275 |
| 720 | Ga0265327_10006203 | 3300031251 | Bacteria | 9642 |
| 721 | Ga0265327_10079841 | 3300031251 | Bacteria | 1619 |
| 722 | Ga0307513_10000019 | 3300031456 | Bacteria | 231194 |
| 723 | Ga0307513_10000051 | 3300031456 | Bacteria | 149733 |
| 724 | Ga0307513_10028964 | 3300031456 | Bacteria | 6322 |
| 725 | Ga0307513_10109212 | 3300031456 | Bacteria | 2764 |
| 726 | Ga0307513_10128037 | 3300031456 | Bacteria | 2490 |
| 727 | Ga0307513_10138268 | 3300031456 | Bacteria | 2367 |
| 728 | Ga0307513_10464070 | 3300031456 | Bacteria | 989 |
| 729 | Ga0307509_10004147 | 3300031507 | Bacteria | 21173 |
| 730 | Ga0307509_10004183 | 3300031507 | Bacteria | 21075 |
| 731 | Ga0307509_10019347 | 3300031507 | Bacteria | 7768 |
| 732 | Ga0307509_10101786 | 3300031507 | Bacteria | 2906 |
| 733 | Ga0307509_10197700 | 3300031507 | Bacteria | 1852 |
| 734 | Ga0307509_10316734 | 3300031507 | Bacteria | 1299 |
| 735 | Ga0307408_100000048 | 3300031548 | Bacteria | 165579 |
| 736 | Ga0307408_100006460 | 3300031548 | Bacteria | 7773 |
| 737 | Ga0307408_100060094 | 3300031548 | Bacteria | 2769 |
| 738 | Ga0307408_100087987 | 3300031548 | Bacteria | 2338 |
| 739 | Ga0307408_100112074 | 3300031548 | Bacteria | 2097 |
| 740 | Ga0307408_100167055 | 3300031548 | Bacteria | 1753 |
| 741 | Ga0307408_100201438 | 3300031548 | Bacteria | 1611 |
| 742 | Ga0307408_100537944 | 3300031548 | Bacteria | 1029 |
| 743 | Ga0307408_100842451 | 3300031548 | Bacteria | 835 |
| 744 | Ga0307408_100849166 | 3300031548 | Bacteria | 832 |
| 745 | Ga0307508_10000163 | 3300031616 | Bacteria | 80086 |
| 746 | Ga0307508_10000385 | 3300031616 | Bacteria | 53049 |
| 747 | Ga0307508_10011794 | 3300031616 | Bacteria | 7987 |
| 748 | Ga0307508_10329205 | 3300031616 | Bacteria | 1119 |
| 749 | Ga0307514_10002111 | 3300031649 | Bacteria | 21455 |
| 750 | Ga0307514_10048620 | 3300031649 | Bacteria | 3303 |
| 751 | Ga0307514_10338710 | 3300031649 | Bacteria | 811 |
| 752 | Ga0265314_10000012 | 3300031711 | Bacteria | 415184 |
| 753 | Ga0265342_10137520 | 3300031712 | Bacteria | 1365 |
| 754 | Ga0307516_10000381 | 3300031730 | Bacteria | 58016 |
| 755 | Ga0307516_10009467 | 3300031730 | Bacteria | 10853 |
| 756 | Ga0307405_10001524 | 3300031731 | Bacteria | 9813 |
| 757 | Ga0307405_10019585 | 3300031731 | Bacteria | 3762 |
| 758 | Ga0307405_10743538 | 3300031731 | Bacteria | 816 |
| 759 | Ga0307413_10007656 | 3300031824 | Bacteria | 5039 |
| 760 | Ga0307413_10225930 | 3300031824 | Bacteria | 1371 |
| 761 | Ga0307410_10017440 | 3300031852 | Bacteria | 4312 |
| 762 | Ga0307406_10000164 | 3300031901 | Bacteria | 39993 |
| 763 | Ga0307406_10003567 | 3300031901 | Bacteria | 8482 |
| 764 | Ga0307406_10140953 | 3300031901 | Bacteria | 1706 |
| 765 | Ga0307406_10225625 | 3300031901 | Bacteria | 1395 |
| 766 | Ga0307407_10128376 | 3300031903 | Bacteria | 1618 |
| 767 | Ga0307407_10262684 | 3300031903 | Bacteria | 1188 |
| 768 | Ga0307412_10010332 | 3300031911 | Bacteria | 5376 |
| 769 | Ga0307412_10054105 | 3300031911 | Bacteria | 2663 |
| 770 | Ga0307412_10172681 | 3300031911 | Bacteria | 1617 |
| 771 | Ga0307412_10386146 | 3300031911 | Bacteria | 1135 |
| 772 | Ga0307412_10595524 | 3300031911 | Bacteria | 935 |
| 773 | Ga0307412_11053003 | 3300031911 | Bacteria | 721 |
| 774 | Ga0307409_100002529 | 3300031995 | Bacteria | 9585 |
| 775 | Ga0307409_100023723 | 3300031995 | Bacteria | 4260 |
| 776 | Ga0307416_100043673 | 3300032002 | Bacteria | 3512 |
| 777 | Ga0307416_100071544 | 3300032002 | Bacteria | 2882 |
| 778 | Ga0307416_100357459 | 3300032002 | Bacteria | 1481 |
| 779 | Ga0307411_10065958 | 3300032005 | Bacteria | 2430 |
| 780 | Ga0307411_10210973 | 3300032005 | Bacteria | 1499 |
| 781 | Ga0307411_10566325 | 3300032005 | Bacteria | 972 |
| 782 | Ga0307415_100005787 | 3300032126 | Bacteria | 6600 |
| 783 | Ga0307415_100056340 | 3300032126 | Bacteria | 2694 |
| 784 | Ga0307415_100502849 | 3300032126 | Bacteria | 1060 |
| 785 | Ga0307415_100503742 | 3300032126 | Bacteria | 1059 |
| 786 | Ga0307507_10199264 | 3300033179 | Bacteria | 1389 |
| 787 | Ga0307510_10056403 | 3300033180 | Bacteria | 4091 |
| 788 | Ga0307510_10148812 | 3300033180 | Bacteria | 1966 |
| 789 | Ga0373932_0171284 | 3300035112 | Bacteria | 757 |
| 790 | Ga0373941_0027987 | 3300035115 | Bacteria | 1651 |
| 791 | Ga0373943_0305806 | 3300035170 | Bacteria | 904 |
| 792 | Ga0373955_0401646 | 3300035172 | Bacteria | 833 |
| 793 | Ga0373931_0004194 | 3300035691 | Bacteria | 6562 |
| 794 | Ga0373931_0023887 | 3300035691 | Bacteria | 3090 |
| 795 | Ga0373937_0089892 | 3300036401 | Bacteria | 2844 |
| 796 | Ga0373937_0112459 | 3300036401 | Bacteria | 2533 |
| 797 | Ga0373925_0340305 | 3300037068 | Bacteria | 1217 |
| 798 | Ga0395899_0023506 | 3300037312 | Bacteria | 4667 |
| 799 | Ga0395900_0140666 | 3300037418 | Bacteria | 2471 |
| 800 | Ga0395898_0010832 | 3300037466 | Bacteria | 9525 |
| 801 | Ga0395905_0064674 | 3300037471 | Bacteria | 3423 |
| 802 | Ga0395905_0092135 | 3300037471 | Bacteria | 2842 |
| 803 | Ga0395901_0173441 | 3300038443 | Bacteria | 2262 |
| 804 | Ga0436365_0618815 | 3300039437 | Bacteria | 2465 |
| 805 | Ga0439436_0000212 | 3300041404 | Bacteria | 14029 |
| 806 | Ga0439436_0023349 | 3300041404 | Bacteria | 1830 |
| 807 | Ga0439439_0004076 | 3300041406 | Bacteria | 3265 |
| 808 | Ga0439466_0013780 | 3300041411 | Bacteria | 2956 |
| 809 | Ga0439466_0015553 | 3300041411 | Bacteria | 2763 |
| 810 | Ga0439465_0001922 | 3300041413 | Bacteria | 6811 |
| 811 | Ga0451791_0590277 | 3300041451 | Bacteria | 935 |
| 812 | Ga0451795_0158714 | 3300041456 | Bacteria | 859 |
| 813 | Ga0451802_1063573 | 3300041460 | Bacteria | 1467 |
| 814 | Ga0451807_0895355 | 3300041486 | Bacteria | 932 |
| 815 | Ga0451807_1169175 | 3300041486 | Bacteria | 916 |
| 816 | Ga0451807_1843106 | 3300041486 | Bacteria | 866 |
| 817 | Ga0451833_1094299 | 3300041491 | Bacteria | 935 |
| 818 | Ga0451839_0734584 | 3300041496 | Bacteria | 999 |
| 819 | Ga0451849_0341148 | 3300041505 | Unclassified | 715 |
| 820 | Ga0451851_0387925 | 3300041507 | Bacteria | 1122 |
| 821 | Ga0451843_1319765 | 3300041509 | Bacteria | 982 |
| 822 | Ga0439431_0005958 | 3300041997 | Bacteria | 2689 |
| 823 | Ga0439433_0000802 | 3300041999 | Bacteria | 6213 |
| 824 | Ga0439442_017744 | 3300042002 | Bacteria | 1469 |
| 825 | Ga0439432_005007 | 3300042006 | Bacteria | 4791 |
| 826 | Ga0439432_072444 | 3300042006 | Bacteria | 1049 |
| 827 | Ga0439449_0000162 | 3300042007 | Bacteria | 22807 |
| 828 | Ga0439449_0003523 | 3300042007 | Bacteria | 6078 |
| 829 | Ga0439449_0009856 | 3300042007 | Bacteria | 3615 |
| 830 | Ga0439452_000749 | 3300042010 | Bacteria | 15562 |
| 831 | Ga0439454_002859 | 3300042011 | Bacteria | 1867 |
| 832 | Ga0439462_0004283 | 3300042015 | Bacteria | 3473 |
| 833 | Ga0450911_000660 | 3300042115 | Bacteria | 10320 |
| 834 | Ga0450919_001363 | 3300042121 | Bacteria | 3191 |
| 835 | Ga0450919_012034 | 3300042121 | Bacteria | 981 |
| 836 | Ga0450920_005006 | 3300042122 | Bacteria | 2347 |
| 837 | Ga0450921_000292 | 3300042123 | Bacteria | 2192 |
| 838 | Ga0450923_043732 | 3300042125 | Bacteria | 947 |
| 839 | Ga0450898_004329 | 3300042134 | Bacteria | 2094 |
| 840 | Ga0450899_003556 | 3300042135 | Bacteria | 1675 |
| 841 | Ga0450902_026735 | 3300042137 | Bacteria | 966 |
| 842 | Ga0450906_003932 | 3300042145 | Bacteria | 3148 |
| 843 | Ga0450910_015468 | 3300042147 | Bacteria | 1123 |
| 844 | Ga0439446_0025651 | 3300042156 | Bacteria | 1685 |
| 845 | Ga0439434_0004431 | 3300042435 | Bacteria | 4105 |
| 846 | Ga0439434_0016519 | 3300042435 | Bacteria | 2206 |
| 847 | Ga0439459_0002941 | 3300042438 | Bacteria | 2668 |
| 848 | Ga0439464_0047794 | 3300042439 | Bacteria | 1232 |
| 849 | Ga0450918_000059 | 3300042531 | Bacteria | 22166 |
| 850 | Ga0450918_001383 | 3300042531 | Bacteria | 4855 |
| 851 | Ga0451577_0027133 | 3300042876 | Bacteria | 5183 |
| 852 | Ga0451577_0104026 | 3300042876 | Bacteria | 2538 |
| 853 | Ga0451577_0130548 | 3300042876 | Bacteria | 2253 |
| 854 | Ga0451577_0219491 | 3300042876 | Bacteria | 1718 |
| 855 | Ga0453683_0004191 | 3300044673 | Bacteria | 10312 |
| 856 | Ga0466963_0023743 | 3300044694 | Bacteria | 3898 |
| 857 | Ga0453684_0041347 | 3300044712 | Bacteria | 6237 |
| 858 | Ga0453684_0228294 | 3300044712 | Bacteria | 2151 |
| 859 | Ga0453684_0461575 | 3300044712 | Bacteria | 1412 |
| 860 | Ga0451576_0007413 | 3300045051 | Bacteria | 13122 |
| 861 | Ga0451576_0037564 | 3300045051 | Bacteria | 5130 |
| 862 | Ga0451576_0280482 | 3300045051 | Bacteria | 1742 |
| 863 | Ga0451576_0290193 | 3300045051 | Bacteria | 1710 |
| 864 | Ga0495627_004409 | 3300046453 | Bacteria | 5896 |
| 865 | Ga0495627_007076 | 3300046453 | Bacteria | 4344 |
| 866 | Ga0495629_0092193 | 3300046459 | Bacteria | 2115 |
| 867 | Ga0495580_0113853 | 3300046472 | Bacteria | 1879 |
| 868 | Ga0495583_0128092 | 3300046506 | Bacteria | 1064 |
| 869 | Ga0495610_0017946 | 3300046512 | Bacteria | 4014 |
| 870 | Ga0495610_0023524 | 3300046512 | Bacteria | 3346 |
| 871 | Ga0495610_0038244 | 3300046512 | Bacteria | 2437 |
| 872 | Ga0495616_0001622 | 3300046513 | Bacteria | 15416 |
| 873 | Ga0495618_0127517 | 3300046514 | Bacteria | 1629 |
| 874 | Ga0495620_0097981 | 3300046515 | Bacteria | 1171 |
| 875 | Ga0495620_0228861 | 3300046515 | Bacteria | 711 |
| 876 | Ga0495630_0197903 | 3300046517 | Bacteria | 1533 |
| 877 | Ga0495631_0003611 | 3300046518 | Bacteria | 8442 |
| 878 | Ga0495632_0046600 | 3300046519 | Bacteria | 2153 |
| 879 | Ga0495632_0119730 | 3300046519 | Bacteria | 1231 |
| 880 | Ga0495637_0008897 | 3300046520 | Bacteria | 4914 |
| 881 | Ga0495637_0022431 | 3300046520 | Bacteria | 2879 |
| 882 | Ga0495643_0076794 | 3300046522 | Bacteria | 1746 |
| 883 | Ga0495648_0063897 | 3300046524 | Bacteria | 2171 |
| 884 | Ga0495654_0069440 | 3300046530 | Bacteria | 1673 |
| 885 | Ga0495597_0000065 | 3300046542 | Bacteria | 90745 |
| 886 | Ga0495633_0086478 | 3300046558 | Bacteria | 1458 |
| 887 | Ga0495668_0068549 | 3300046616 | Bacteria | 1951 |
| 888 | Ga0495625_0000057 | 3300046660 | Bacteria | 181623 |
| 889 | Ga0495625_0002324 | 3300046660 | Bacteria | 20802 |
| 890 | Ga0495625_0098618 | 3300046660 | Bacteria | 2010 |
| 891 | Ga0495588_0032582 | 3300046674 | Bacteria | 2627 |
| 892 | Ga0495647_0063978 | 3300046681 | Bacteria | 1458 |
| 893 | Ga0495658_0016346 | 3300046683 | Bacteria | 3820 |
| 894 | Ga0495658_0289786 | 3300046683 | Bacteria | 1034 |
| 895 | Ga0495624_0027325 | 3300046690 | Bacteria | 3736 |
| 896 | Ga0495670_0008089 | 3300046691 | Bacteria | 5168 |
| 897 | Ga0495670_0156247 | 3300046691 | Bacteria | 1197 |
| 898 | Ga0495671_0001783 | 3300046692 | Bacteria | 13918 |
| 899 | Ga0495660_0107457 | 3300046810 | Bacteria | 1428 |
| 900 | Ga0495676_0025847 | 3300047321 | Bacteria | 5061 |
| 901 | Ga0495681_0165643 | 3300047470 | Bacteria | 918 |
| 902 | Ga0495593_0024903 | 3300047673 | Bacteria | 3312 |
| 903 | Ga0495593_0109881 | 3300047673 | Bacteria | 1408 |
| 904 | Ga0495614_0028444 | 3300048089 | Bacteria | 2408 |
| 905 | Ga0496100_0364902 | 3300048903 | Bacteria | 1094 |
| 906 | Ga0496101_0012290 | 3300048904 | Bacteria | 5711 |
| 907 | Ga0496101_0368503 | 3300048904 | Bacteria | 1129 |
| 908 | Ga0496101_0877117 | 3300048904 | Bacteria | 707 |
| 909 | Ga0496102_0004670 | 3300048905 | Bacteria | 11585 |
| 910 | Ga0496102_0016461 | 3300048905 | Bacteria | 6461 |
| 911 | Ga0496102_0063249 | 3300048905 | Bacteria | 3388 |
| 912 | Ga0496104_0401427 | 3300048907 | Bacteria | 1283 |
| 913 | Ga0496105_0683180 | 3300048908 | Bacteria | 789 |
| 914 | Ga0496106_0002144 | 3300048909 | Bacteria | 14740 |
| 915 | Ga0496106_0014626 | 3300048909 | Bacteria | 5799 |
| 916 | Ga0496107_0101397 | 3300048910 | Bacteria | 2111 |
| 917 | Ga0496107_0227846 | 3300048910 | Bacteria | 1386 |
| 918 | Ga0496108_1057641 | 3300048911 | Bacteria | 691 |
| 919 | Ga0496109_0072741 | 3300048912 | Bacteria | 3158 |
| 920 | Ga0496110_0032378 | 3300048913 | Bacteria | 4514 |
| 921 | Ga0496111_0464573 | 3300048914 | Bacteria | 933 |
| 922 | Ga0496112_0082239 | 3300048915 | Bacteria | 3185 |
| 923 | Ga0496113_0035270 | 3300048916 | Bacteria | 3657 |
| 924 | Ga0496114_0032690 | 3300048917 | Bacteria | 4284 |
| 925 | Ga0496114_0289600 | 3300048917 | Bacteria | 1445 |
| 926 | Ga0496114_0626550 | 3300048917 | Bacteria | 947 |
| 927 | Ga0496116_0025716 | 3300048919 | Bacteria | 4322 |
| 928 | Ga0496116_0036615 | 3300048919 | Bacteria | 3431 |
| 929 | Ga0496117_0028533 | 3300048920 | Bacteria | 4320 |
| 930 | Ga0496117_0028546 | 3300048920 | Bacteria | 4319 |
| 931 | Ga0496117_0072533 | 3300048920 | Bacteria | 2301 |
| 932 | Ga0496117_0137384 | 3300048920 | Bacteria | 1470 |
| 933 | Ga0496118_0016121 | 3300048921 | Bacteria | 6872 |
| 934 | Ga0496118_0039128 | 3300048921 | Bacteria | 3788 |
| 935 | Ga0496121_0042381 | 3300048924 | Bacteria | 3960 |
| 936 | Ga0496121_0151260 | 3300048924 | Bacteria | 1707 |
| 937 | Ga0496121_0227039 | 3300048924 | Bacteria | 1310 |
| 938 | Ga0496121_0550840 | 3300048924 | Bacteria | 722 |
| 939 | Ga0496122_0001985 | 3300048925 | Bacteria | 30535 |
| 940 | Ga0496122_0040928 | 3300048925 | Bacteria | 3674 |
| 941 | Ga0496122_0074474 | 3300048925 | Bacteria | 2402 |
| 942 | Ga0496122_0112553 | 3300048925 | Bacteria | 1782 |
| 943 | Ga0496122_0130642 | 3300048925 | Bacteria | 1597 |
| 944 | Ga0496123_0000108 | 3300048926 | Bacteria | 166102 |
| 945 | Ga0496123_0077439 | 3300048926 | Bacteria | 2042 |
| 946 | Ga0496123_0090733 | 3300048926 | Bacteria | 1815 |
| 947 | Ga0496123_0136522 | 3300048926 | Bacteria | 1349 |
| 948 | Ga0496124_0008708 | 3300048927 | Bacteria | 10546 |
| 949 | Ga0496124_0048959 | 3300048927 | Bacteria | 3607 |
| 950 | Ga0496124_0278254 | 3300048927 | Bacteria | 1221 |
| 951 | Ga0496125_0001110 | 3300048928 | Bacteria | 41331 |
| 952 | Ga0496125_0001434 | 3300048928 | Bacteria | 34736 |
| 953 | Ga0496125_0003201 | 3300048928 | Bacteria | 20211 |
| 954 | Ga0496125_0008866 | 3300048928 | Bacteria | 10448 |
| 955 | Ga0496125_0041445 | 3300048928 | Bacteria | 3935 |
| 956 | Ga0496125_0083988 | 3300048928 | Bacteria | 2420 |
| 957 | Ga0496125_0193121 | 3300048928 | Bacteria | 1342 |
| 958 | Ga0496126_0105046 | 3300048929 | Bacteria | 2467 |
| 959 | Ga0496126_0434354 | 3300048929 | Bacteria | 1059 |
| 960 | Ga0501034_0090596 | 3300049571 | Bacteria | 3056 |
| 961 | Ga0501038_0240902 | 3300049574 | Bacteria | 1436 |
| 962 | Ga0501047_0344776 | 3300049581 | Bacteria | 1327 |
| 963 | Ga0501262_004518 | 3300049759 | Bacteria | 1616 |
| 964 | Ga0501035_0102509 | 3300049822 | Bacteria | 2510 |
| 965 | Ga0501044_0090000 | 3300049823 | Bacteria | 3097 |
| 966 | nmdc:mga03683_12585_c1 | 3300050489 | Bacteria | 3095 |
| 967 | nmdc:mga03683_1803_c1 | 3300050489 | Bacteria | 6494 |
| 968 | nmdc:mga03683_33853_c1 | 3300050489 | Bacteria | 2065 |
| 969 | nmdc:mga03n38_133491_c1 | 3300050490 | Bacteria | 1233 |
| 970 | nmdc:mga03n38_362939_c1 | 3300050490 | Bacteria | 790 |
| 971 | nmdc:mga03n38_57895_c1 | 3300050490 | Bacteria | 1754 |
| 972 | nmdc:mga03n38_70019_c1 | 3300050490 | Bacteria | 1621 |
| 973 | nmdc:mga0yw44_174365_c1 | 3300050492 | Bacteria | 1413 |
| 974 | nmdc:mga0yw44_73599_c1 | 3300050492 | Bacteria | 2126 |
| 975 | nmdc:mga0k408_10715_c1 | 3300050493 | Bacteria | 4967 |
| 976 | nmdc:mga0k408_16857_c1 | 3300050493 | Bacteria | 4061 |
| 977 | nmdc:mga0k408_232697_c1 | 3300050493 | Bacteria | 1100 |
| 978 | nmdc:mga0k408_262416_c1 | 3300050493 | Bacteria | 1031 |
| 979 | nmdc:mga0k408_36648_c2 | 3300050493 | Bacteria | 2468 |
| 980 | nmdc:mga0k408_56639_c1 | 3300050493 | Bacteria | 2275 |
| 981 | nmdc:mga0k408_80720_c1 | 3300050493 | Bacteria | 1904 |
| 982 | nmdc:mga06z11_119292_c1 | 3300050494 | Bacteria | 1470 |
| 983 | nmdc:mga06z11_244083_c1 | 3300050494 | Bacteria | 1056 |
| 984 | nmdc:mga07m45_15470_c1 | 3300050496 | Bacteria | 3641 |
| 985 | nmdc:mga07m45_24262_c1 | 3300050496 | Bacteria | 3321 |
| 986 | nmdc:mga07m45_353156_c1 | 3300050496 | Bacteria | 854 |
| 987 | nmdc:mga07m45_48000_c1 | 3300050496 | Bacteria | 2401 |
| 988 | nmdc:mga07m45_7705_c1 | 3300050496 | Bacteria | 5511 |
| 989 | nmdc:mga07m45_9224_c1 | 3300050496 | Bacteria | 4460 |
| 990 | nmdc:mga0rr50_132627_c1 | 3300050513 | Bacteria | 1996 |
| 991 | Ga0500610_0002251 | 3300053079 | Bacteria | 6999 |
| 992 | Ga0500610_0033483 | 3300053079 | Bacteria | 2622 |
| 993 | Ga0500610_0075277 | 3300053079 | Bacteria | 1760 |
| 994 | Ga0500643_004866 | 3300053087 | Bacteria | 5928 |
| 995 | Ga0500583_0093618 | 3300053092 | Bacteria | 1465 |
| 996 | Ga0500651_0000090 | 3300053093 | Bacteria | 58811 |
| 997 | Ga0500651_0008417 | 3300053093 | Bacteria | 6068 |
| 998 | Ga0500566_0031058 | 3300053094 | Bacteria | 3115 |
| 999 | Ga0500566_0190057 | 3300053094 | Bacteria | 1046 |
| 1000 | Ga0500641_0197200 | 3300053096 | Bacteria | 860 |
| 1001 | Ga0500555_083218 | 3300053103 | Bacteria | 830 |
| 1002 | Ga0500562_002544 | 3300053108 | Bacteria | 4546 |
| 1003 | Ga0500571_000014 | 3300053110 | Bacteria | 67097 |
| 1004 | Ga0500592_008465 | 3300053116 | Bacteria | 1632 |
| 1005 | Ga0500593_001074 | 3300053117 | Bacteria | 9866 |
| 1006 | Ga0500593_019315 | 3300053117 | Bacteria | 2978 |
| 1007 | Ga0500594_0002517 | 3300053118 | Bacteria | 3984 |
| 1008 | Ga0500607_000328 | 3300053121 | Bacteria | 44883 |
| 1009 | Ga0500607_013009 | 3300053121 | Bacteria | 4870 |
| 1010 | Ga0500608_003138 | 3300053122 | Bacteria | 6133 |
| 1011 | Ga0500626_194385 | 3300053128 | Bacteria | 805 |
| 1012 | Ga0500628_002038 | 3300053129 | Bacteria | 3395 |
| 1013 | Ga0500655_001389 | 3300053133 | Bacteria | 4586 |
| 1014 | Ga0500658_0000018 | 3300053134 | Bacteria | 141217 |
| 1015 | Ga0500658_0000322 | 3300053134 | Bacteria | 21148 |
| 1016 | Ga0500559_0010108 | 3300053136 | Bacteria | 4061 |
| 1017 | Ga0500559_0012748 | 3300053136 | Bacteria | 3568 |
| 1018 | Ga0500564_010061 | 3300053138 | Bacteria | 4139 |
| 1019 | Ga0500574_003231 | 3300053141 | Bacteria | 2844 |
| 1020 | Ga0500616_0007996 | 3300053153 | Bacteria | 6630 |
| 1021 | Ga0500619_000022 | 3300053154 | Bacteria | 50600 |
| 1022 | Ga0500619_063314 | 3300053154 | Bacteria | 1221 |
| 1023 | Ga0500622_0002013 | 3300053156 | Bacteria | 15185 |
| 1024 | Ga0500627_0001126 | 3300053158 | Bacteria | 7324 |
| 1025 | Ga0500634_0037520 | 3300053161 | Bacteria | 2635 |
| 1026 | Ga0500634_0068195 | 3300053161 | Bacteria | 1868 |
| 1027 | Ga0500638_026886 | 3300053162 | Bacteria | 2758 |
| 1028 | Ga0500636_0042892 | 3300053177 | Bacteria | 2673 |
| 1029 | Ga0500645_000155 | 3300053730 | Bacteria | 53212 |
| 1030 | Ga0500645_000840 | 3300053730 | Bacteria | 18167 |
| 1031 | Ga0500645_028446 | 3300053730 | Bacteria | 1691 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2886848708 | 2886853789 | 170 |
| 2 | 3300025961 | Ga0207712_10859901 | Ga0207712_108599011 | 171 |
| 3 | 3300048904 | Ga0496101_0877117 | Ga0496101_0877117_15_530 | 171 |
| 4 | 3300014969 | Ga0157376_10295298 | Ga0157376_102952981 | 173 |
| 5 | 3300050490 | nmdc:mga03n38_362939_c1 | nmdc:mga03n38_362939_c1_26_589 | 177 |
| 6 | 3300046472 | Ga0495580_0113853 | Ga0495580_0113853_1231_1851 | 184 |
| 7 | 3300006195 | Ga0075366_10180051 | Ga0075366_101800512 | 188 |
| 8 | 3300050493 | nmdc:mga0k408_16857_c1 | nmdc:mga0k408_16857_c1_232_849 | 188 |
| 9 | 3300035170 | Ga0373943_0305806 | Ga0373943_0305806_77_697 | 189 |
| 10 | 3300046515 | Ga0495620_0097981 | Ga0495620_0097981_471_1082 | 190 |
| 11 | 3300046519 | Ga0495632_0046600 | Ga0495632_0046600_378_989 | 190 |
| 12 | 3300028794 | Ga0307515_10005560 | Ga0307515_1000556018 | 192 |
| 13 | 3300028794 | Ga0307515_10294695 | Ga0307515_102946952 | 192 |
| 14 | 3300046522 | Ga0495643_0076794 | Ga0495643_0076794_17_628 | 192 |
| 15 | 3300048905 | Ga0496102_0016461 | Ga0496102_0016461_3550_4128 | 192 |
| 16 | 3300053730 | Ga0500645_000840 | Ga0500645_000840_13_594 | 193 |
| 17 | 3300005344 | Ga0070661_100287573 | Ga0070661_1002875732 | 194 |
| 18 | 3300005539 | Ga0068853_100555627 | Ga0068853_1005556272 | 194 |
| 19 | 3300005616 | Ga0068852_100188255 | Ga0068852_1001882552 | 194 |
| 20 | 3300013104 | Ga0157370_10138552 | Ga0157370_101385522 | 194 |
| 21 | 3300013307 | Ga0157372_10615863 | Ga0157372_106158632 | 194 |
| 22 | 3300026041 | Ga0207639_10424226 | Ga0207639_104242262 | 195 |
| 23 | 3300005616 | Ga0068852_101365473 | Ga0068852_1013654732 | 197 |
| 24 | 3300005330 | Ga0070690_100701688 | Ga0070690_1007016881 | 198 |
| 25 | 3300005367 | Ga0070667_100802064 | Ga0070667_1008020641 | 198 |
| 26 | 3300005841 | Ga0068863_100211047 | Ga0068863_1002110472 | 198 |
| 27 | 3300006051 | Ga0075364_10318497 | Ga0075364_103184972 | 198 |
| 28 | 3300026088 | Ga0207641_10164601 | Ga0207641_101646012 | 198 |
| 29 | 3300031507 | Ga0307509_10019347 | Ga0307509_100193477 | 198 |
| 30 | iso_pu_bacteria | 2585428062 | 2587755034 | 199 |
| 31 | iso_pu_bacteria | 2831864461 | 2831869536 | 199 |
| 32 | 3300025939 | Ga0207665_10580347 | Ga0207665_105803472 | 200 |
| 33 | 3300049571 | Ga0501034_0090596 | Ga0501034_0090596_1044_1646 | 200 |
| 34 | 3300049581 | Ga0501047_0344776 | Ga0501047_0344776_297_899 | 200 |
| 35 | 3300005327 | Ga0070658_10070127 | Ga0070658_100701274 | 201 |
| 36 | 3300005338 | Ga0068868_100194380 | Ga0068868_1001943802 | 201 |
| 37 | 3300005339 | Ga0070660_100018204 | Ga0070660_1000182043 | 201 |
| 38 | 3300005341 | Ga0070691_10063677 | Ga0070691_100636772 | 201 |
| 39 | 3300005355 | Ga0070671_100008753 | Ga0070671_1000087534 | 201 |
| 40 | 3300005356 | Ga0070674_100278944 | Ga0070674_1002789442 | 201 |
| 41 | 3300005435 | Ga0070714_100098982 | Ga0070714_1000989824 | 201 |
| 42 | 3300005456 | Ga0070678_100731769 | Ga0070678_1007317692 | 201 |
| 43 | 3300005459 | Ga0068867_100119176 | Ga0068867_1001191763 | 201 |
| 44 | 3300005530 | Ga0070679_100031430 | Ga0070679_1000314304 | 201 |
| 45 | 3300005563 | Ga0068855_100009342 | Ga0068855_10000934210 | 201 |
| 46 | 3300005564 | Ga0070664_100240264 | Ga0070664_1002402641 | 201 |
| 47 | 3300005614 | Ga0068856_100400526 | Ga0068856_1004005261 | 201 |
| 48 | 3300005841 | Ga0068863_100155102 | Ga0068863_1001551023 | 201 |
| 49 | 3300005841 | Ga0068863_100538207 | Ga0068863_1005382072 | 201 |
| 50 | 3300005842 | Ga0068858_100783692 | Ga0068858_1007836922 | 201 |
| 51 | 3300006358 | Ga0068871_100241436 | Ga0068871_1002414362 | 201 |
| 52 | 3300006881 | Ga0068865_100313365 | Ga0068865_1003133652 | 201 |
| 53 | 3300009093 | Ga0105240_10017248 | Ga0105240_100172486 | 201 |
| 54 | 3300009177 | Ga0105248_10073710 | Ga0105248_100737102 | 201 |
| 55 | 3300009551 | Ga0105238_10402474 | Ga0105238_104024742 | 201 |
| 56 | 3300013296 | Ga0157374_10474832 | Ga0157374_104748322 | 201 |
| 57 | 3300013308 | Ga0157375_10011944 | Ga0157375_100119445 | 201 |
| 58 | 3300014325 | Ga0163163_10079621 | Ga0163163_100796212 | 201 |
| 59 | 3300025913 | Ga0207695_10169856 | Ga0207695_101698562 | 201 |
| 60 | 3300025919 | Ga0207657_10035337 | Ga0207657_100353377 | 201 |
| 61 | 3300025921 | Ga0207652_10528384 | Ga0207652_105283841 | 201 |
| 62 | 3300025924 | Ga0207694_10312541 | Ga0207694_103125412 | 201 |
| 63 | 3300025927 | Ga0207687_10617927 | Ga0207687_106179272 | 201 |
| 64 | 3300025929 | Ga0207664_10568092 | Ga0207664_105680922 | 201 |
| 65 | 3300025931 | Ga0207644_10079055 | Ga0207644_100790552 | 201 |
| 66 | 3300025933 | Ga0207706_10313150 | Ga0207706_103131502 | 201 |
| 67 | 3300025937 | Ga0207669_10130945 | Ga0207669_101309452 | 201 |
| 68 | 3300025940 | Ga0207691_10034742 | Ga0207691_100347426 | 201 |
| 69 | 3300025945 | Ga0207679_10799971 | Ga0207679_107999712 | 201 |
| 70 | 3300026023 | Ga0207677_10383589 | Ga0207677_103835892 | 201 |
| 71 | 3300026035 | Ga0207703_10735262 | Ga0207703_107352622 | 201 |
| 72 | 3300026088 | Ga0207641_10057522 | Ga0207641_100575222 | 201 |
| 73 | 3300026088 | Ga0207641_10149917 | Ga0207641_101499173 | 201 |
| 74 | 3300026089 | Ga0207648_10109236 | Ga0207648_101092362 | 201 |
| 75 | 3300026095 | Ga0207676_10361541 | Ga0207676_103615412 | 201 |
| 76 | 3300026121 | Ga0207683_10636938 | Ga0207683_106369382 | 201 |
| 77 | 3300028577 | Ga0265318_10095149 | Ga0265318_100951491 | 201 |
| 78 | 3300031235 | Ga0265330_10000344 | Ga0265330_1000034418 | 201 |
| 79 | 3300031238 | Ga0265332_10000002 | Ga0265332_10000002308 | 201 |
| 80 | 3300031241 | Ga0265325_10010778 | Ga0265325_100107784 | 201 |
| 81 | 3300031711 | Ga0265314_10000012 | Ga0265314_1000001277 | 201 |
| 82 | 3300031712 | Ga0265342_10137520 | Ga0265342_101375202 | 201 |
| 83 | 3300005841 | Ga0068863_100047596 | Ga0068863_1000475962 | 202 |
| 84 | 3300026088 | Ga0207641_10137763 | Ga0207641_101377632 | 202 |
| 85 | 3300031548 | Ga0307408_100842451 | Ga0307408_1008424512 | 202 |
| 86 | 3300031903 | Ga0307407_10128376 | Ga0307407_101283762 | 202 |
| 87 | 3300031911 | Ga0307412_10172681 | Ga0307412_101726812 | 202 |
| 88 | 3300031995 | Ga0307409_100023723 | Ga0307409_1000237232 | 202 |
| 89 | 3300032126 | Ga0307415_100005787 | Ga0307415_1000057876 | 202 |
| 90 | 3300037471 | Ga0395905_0064674 | Ga0395905_0064674_884_1528 | 202 |
| 91 | 3300003320 | rootH2_10003527 | rootH2_100035275 | 203 |
| 92 | 3300003322 | rootL2_10001454 | rootL2_1000145417 | 203 |
| 93 | 3300003323 | rootH1_10003240 | rootH1_1000324024 | 203 |
| 94 | 3300003323 | rootH1_10074149 | rootH1_100741493 | 203 |
| 95 | 3300003771 | Ga0055526_1001415 | Ga0055526_100141515 | 203 |
| 96 | 3300003775 | Ga0055524_1000583 | Ga0055524_100058318 | 203 |
| 97 | 3300003775 | Ga0055524_1000632 | Ga0055524_10006328 | 203 |
| 98 | 3300003775 | Ga0055524_1005356 | Ga0055524_10053565 | 203 |
| 99 | 3300003794 | Ga0055531_10001279 | Ga0055531_1000127918 | 203 |
| 100 | 3300003794 | Ga0055531_10019645 | Ga0055531_100196453 | 203 |
| 101 | 3300004625 | Ga0055543_1004354 | Ga0055543_10043543 | 203 |
| 102 | 3300005262 | Ga0065165_1000024 | Ga0065165_1000024108 | 203 |
| 103 | 3300005327 | Ga0070658_10153359 | Ga0070658_101533592 | 203 |
| 104 | 3300005328 | Ga0070676_10032497 | Ga0070676_100324974 | 203 |
| 105 | 3300005328 | Ga0070676_10094772 | Ga0070676_100947722 | 203 |
| 106 | 3300005328 | Ga0070676_10458262 | Ga0070676_104582621 | 203 |
| 107 | 3300005330 | Ga0070690_100008484 | Ga0070690_1000084843 | 203 |
| 108 | 3300005331 | Ga0070670_100031821 | Ga0070670_1000318212 | 203 |
| 109 | 3300005331 | Ga0070670_100031847 | Ga0070670_1000318474 | 203 |
| 110 | 3300005331 | Ga0070670_100239530 | Ga0070670_1002395302 | 203 |
| 111 | 3300005331 | Ga0070670_100320268 | Ga0070670_1003202682 | 203 |
| 112 | 3300005333 | Ga0070677_10034580 | Ga0070677_100345802 | 203 |
| 113 | 3300005333 | Ga0070677_10314110 | Ga0070677_103141101 | 203 |
| 114 | 3300005334 | Ga0068869_100021031 | Ga0068869_1000210312 | 203 |
| 115 | 3300005335 | Ga0070666_10042499 | Ga0070666_100424992 | 203 |
| 116 | 3300005335 | Ga0070666_10066977 | Ga0070666_100669772 | 203 |
| 117 | 3300005338 | Ga0068868_100011186 | Ga0068868_1000111865 | 203 |
| 118 | 3300005338 | Ga0068868_100019427 | Ga0068868_1000194276 | 203 |
| 119 | 3300005338 | Ga0068868_101046668 | Ga0068868_1010466681 | 203 |
| 120 | 3300005339 | Ga0070660_100074568 | Ga0070660_1000745682 | 203 |
| 121 | 3300005343 | Ga0070687_100048247 | Ga0070687_1000482472 | 203 |
| 122 | 3300005344 | Ga0070661_100526676 | Ga0070661_1005266762 | 203 |
| 123 | 3300005347 | Ga0070668_100001397 | Ga0070668_10000139719 | 203 |
| 124 | 3300005353 | Ga0070669_100093615 | Ga0070669_1000936152 | 203 |
| 125 | 3300005353 | Ga0070669_100157673 | Ga0070669_1001576731 | 203 |
| 126 | 3300005353 | Ga0070669_100177198 | Ga0070669_1001771981 | 203 |
| 127 | 3300005354 | Ga0070675_100036414 | Ga0070675_1000364142 | 203 |
| 128 | 3300005354 | Ga0070675_100065666 | Ga0070675_1000656663 | 203 |
| 129 | 3300005354 | Ga0070675_100104680 | Ga0070675_1001046802 | 203 |
| 130 | 3300005354 | Ga0070675_100124967 | Ga0070675_1001249673 | 203 |
| 131 | 3300005354 | Ga0070675_100512785 | Ga0070675_1005127852 | 203 |
| 132 | 3300005355 | Ga0070671_100016332 | Ga0070671_1000163326 | 203 |
| 133 | 3300005355 | Ga0070671_100129532 | Ga0070671_1001295322 | 203 |
| 134 | 3300005355 | Ga0070671_100176614 | Ga0070671_1001766142 | 203 |
| 135 | 3300005355 | Ga0070671_100317007 | Ga0070671_1003170072 | 203 |
| 136 | 3300005356 | Ga0070674_100010482 | Ga0070674_1000104826 | 203 |
| 137 | 3300005356 | Ga0070674_100020727 | Ga0070674_1000207272 | 203 |
| 138 | 3300005356 | Ga0070674_100104530 | Ga0070674_1001045302 | 203 |
| 139 | 3300005356 | Ga0070674_100912887 | Ga0070674_1009128872 | 203 |
| 140 | 3300005364 | Ga0070673_100038766 | Ga0070673_1000387662 | 203 |
| 141 | 3300005364 | Ga0070673_100276447 | Ga0070673_1002764472 | 203 |
| 142 | 3300005364 | Ga0070673_100595761 | Ga0070673_1005957612 | 203 |
| 143 | 3300005365 | Ga0070688_100318854 | Ga0070688_1003188542 | 203 |
| 144 | 3300005365 | Ga0070688_100360287 | Ga0070688_1003602871 | 203 |
| 145 | 3300005366 | Ga0070659_100012819 | Ga0070659_1000128194 | 203 |
| 146 | 3300005367 | Ga0070667_100128762 | Ga0070667_1001287622 | 203 |
| 147 | 3300005367 | Ga0070667_100531451 | Ga0070667_1005314512 | 203 |
| 148 | 3300005367 | Ga0070667_100789883 | Ga0070667_1007898832 | 203 |
| 149 | 3300005438 | Ga0070701_10233997 | Ga0070701_102339972 | 203 |
| 150 | 3300005455 | Ga0070663_100403733 | Ga0070663_1004037332 | 203 |
| 151 | 3300005455 | Ga0070663_100447059 | Ga0070663_1004470592 | 203 |
| 152 | 3300005456 | Ga0070678_100051960 | Ga0070678_1000519602 | 203 |
| 153 | 3300005456 | Ga0070678_100137458 | Ga0070678_1001374582 | 203 |
| 154 | 3300005456 | Ga0070678_100498604 | Ga0070678_1004986041 | 203 |
| 155 | 3300005456 | Ga0070678_100545753 | Ga0070678_1005457531 | 203 |
| 156 | 3300005457 | Ga0070662_100004781 | Ga0070662_1000047815 | 203 |
| 157 | 3300005457 | Ga0070662_100440965 | Ga0070662_1004409652 | 203 |
| 158 | 3300005459 | Ga0068867_100001670 | Ga0068867_10000167013 | 203 |
| 159 | 3300005459 | Ga0068867_100013320 | Ga0068867_1000133202 | 203 |
| 160 | 3300005459 | Ga0068867_100027719 | Ga0068867_1000277192 | 203 |
| 161 | 3300005459 | Ga0068867_100440708 | Ga0068867_1004407081 | 203 |
| 162 | 3300005467 | Ga0070706_100000388 | Ga0070706_1000003889 | 203 |
| 163 | 3300005539 | Ga0068853_100020855 | Ga0068853_1000208556 | 203 |
| 164 | 3300005539 | Ga0068853_100561748 | Ga0068853_1005617482 | 203 |
| 165 | 3300005543 | Ga0070672_100012480 | Ga0070672_1000124804 | 203 |
| 166 | 3300005543 | Ga0070672_100019005 | Ga0070672_1000190054 | 203 |
| 167 | 3300005543 | Ga0070672_100033357 | Ga0070672_1000333573 | 203 |
| 168 | 3300005543 | Ga0070672_100102564 | Ga0070672_1001025642 | 203 |
| 169 | 3300005544 | Ga0070686_100740068 | Ga0070686_1007400681 | 203 |
| 170 | 3300005564 | Ga0070664_100211415 | Ga0070664_1002114151 | 203 |
| 171 | 3300005564 | Ga0070664_100426239 | Ga0070664_1004262392 | 203 |
| 172 | 3300005577 | Ga0068857_100112387 | Ga0068857_1001123872 | 203 |
| 173 | 3300005578 | Ga0068854_100075713 | Ga0068854_1000757132 | 203 |
| 174 | 3300005578 | Ga0068854_100206316 | Ga0068854_1002063162 | 203 |
| 175 | 3300005614 | Ga0068856_100088244 | Ga0068856_1000882442 | 203 |
| 176 | 3300005615 | Ga0070702_100038663 | Ga0070702_1000386634 | 203 |
| 177 | 3300005616 | Ga0068852_100002342 | Ga0068852_1000023423 | 203 |
| 178 | 3300005616 | Ga0068852_100013873 | Ga0068852_1000138735 | 203 |
| 179 | 3300005616 | Ga0068852_100021650 | Ga0068852_1000216506 | 203 |
| 180 | 3300005618 | Ga0068864_100538190 | Ga0068864_1005381902 | 203 |
| 181 | 3300005718 | Ga0068866_10006058 | Ga0068866_100060582 | 203 |
| 182 | 3300005719 | Ga0068861_100004282 | Ga0068861_1000042827 | 203 |
| 183 | 3300005719 | Ga0068861_100035769 | Ga0068861_1000357694 | 203 |
| 184 | 3300005834 | Ga0068851_10007641 | Ga0068851_100076416 | 203 |
| 185 | 3300005840 | Ga0068870_10059449 | Ga0068870_100594492 | 203 |
| 186 | 3300005840 | Ga0068870_10075153 | Ga0068870_100751532 | 203 |
| 187 | 3300005841 | Ga0068863_100033604 | Ga0068863_1000336042 | 203 |
| 188 | 3300005841 | Ga0068863_100162171 | Ga0068863_1001621712 | 203 |
| 189 | 3300005841 | Ga0068863_100654907 | Ga0068863_1006549072 | 203 |
| 190 | 3300005842 | Ga0068858_100006422 | Ga0068858_1000064226 | 203 |
| 191 | 3300005842 | Ga0068858_100046142 | Ga0068858_1000461426 | 203 |
| 192 | 3300005842 | Ga0068858_100047409 | Ga0068858_1000474092 | 203 |
| 193 | 3300005843 | Ga0068860_100020361 | Ga0068860_1000203614 | 203 |
| 194 | 3300005843 | Ga0068860_100038019 | Ga0068860_1000380192 | 203 |
| 195 | 3300005844 | Ga0068862_100087607 | Ga0068862_1000876072 | 203 |
| 196 | 3300005844 | Ga0068862_101175313 | Ga0068862_1011753132 | 203 |
| 197 | 3300006042 | Ga0075368_10109924 | Ga0075368_101099242 | 203 |
| 198 | 3300006048 | Ga0075363_100031855 | Ga0075363_1000318552 | 203 |
| 199 | 3300006051 | Ga0075364_10403967 | Ga0075364_104039672 | 203 |
| 200 | 3300006178 | Ga0075367_10071974 | Ga0075367_100719742 | 203 |
| 201 | 3300006195 | Ga0075366_10030863 | Ga0075366_100308633 | 203 |
| 202 | 3300006195 | Ga0075366_10061793 | Ga0075366_100617932 | 203 |
| 203 | 3300006237 | Ga0097621_100150780 | Ga0097621_1001507802 | 203 |
| 204 | 3300006353 | Ga0075370_10074619 | Ga0075370_100746192 | 203 |
| 205 | 3300006358 | Ga0068871_100069971 | Ga0068871_1000699712 | 203 |
| 206 | 3300006871 | Ga0075434_100427884 | Ga0075434_1004278842 | 203 |
| 207 | 3300006881 | Ga0068865_100015377 | Ga0068865_1000153776 | 203 |
| 208 | 3300006881 | Ga0068865_100235311 | Ga0068865_1002353112 | 203 |
| 209 | 3300006944 | Ga0099823_1003766 | Ga0099823_100376615 | 203 |
| 210 | 3300007076 | Ga0075435_100118395 | Ga0075435_1001183952 | 203 |
| 211 | 3300009098 | Ga0105245_10008645 | Ga0105245_1000864510 | 203 |
| 212 | 3300009098 | Ga0105245_10195835 | Ga0105245_101958353 | 203 |
| 213 | 3300009148 | Ga0105243_10085514 | Ga0105243_100855142 | 203 |
| 214 | 3300009148 | Ga0105243_10338670 | Ga0105243_103386702 | 203 |
| 215 | 3300009148 | Ga0105243_10929338 | Ga0105243_109293382 | 203 |
| 216 | 3300009177 | Ga0105248_10010384 | Ga0105248_100103847 | 203 |
| 217 | 3300009177 | Ga0105248_10223138 | Ga0105248_102231382 | 203 |
| 218 | 3300009177 | Ga0105248_10588206 | Ga0105248_105882062 | 203 |
| 219 | 3300009551 | Ga0105238_10018905 | Ga0105238_100189056 | 203 |
| 220 | 3300009553 | Ga0105249_11097357 | Ga0105249_110973571 | 203 |
| 221 | 3300012497 | Ga0157319_1000001 | Ga0157319_10000014 | 203 |
| 222 | 3300013104 | Ga0157370_10827754 | Ga0157370_108277542 | 203 |
| 223 | 3300013105 | Ga0157369_10315473 | Ga0157369_103154732 | 203 |
| 224 | 3300013105 | Ga0157369_11007943 | Ga0157369_110079432 | 203 |
| 225 | 3300013297 | Ga0157378_10225791 | Ga0157378_102257912 | 203 |
| 226 | 3300013306 | Ga0163162_10059244 | Ga0163162_100592444 | 203 |
| 227 | 3300013306 | Ga0163162_10266175 | Ga0163162_102661752 | 203 |
| 228 | 3300013307 | Ga0157372_10022443 | Ga0157372_100224438 | 203 |
| 229 | 3300013308 | Ga0157375_10088676 | Ga0157375_100886762 | 203 |
| 230 | 3300013308 | Ga0157375_10173858 | Ga0157375_101738582 | 203 |
| 231 | 3300013308 | Ga0157375_10193123 | Ga0157375_101931232 | 203 |
| 232 | 3300013308 | Ga0157375_10372738 | Ga0157375_103727382 | 203 |
| 233 | 3300013308 | Ga0157375_10716809 | Ga0157375_107168092 | 203 |
| 234 | 3300014326 | Ga0157380_10004553 | Ga0157380_100045536 | 203 |
| 235 | 3300014326 | Ga0157380_10011560 | Ga0157380_100115606 | 203 |
| 236 | 3300014745 | Ga0157377_10002433 | Ga0157377_100024338 | 203 |
| 237 | 3300014968 | Ga0157379_10025811 | Ga0157379_100258112 | 203 |
| 238 | 3300014968 | Ga0157379_10524262 | Ga0157379_105242622 | 203 |
| 239 | 3300014969 | Ga0157376_10005021 | Ga0157376_1000502110 | 203 |
| 240 | 3300014969 | Ga0157376_10358511 | Ga0157376_103585112 | 203 |
| 241 | 3300017792 | Ga0163161_10018036 | Ga0163161_100180366 | 203 |
| 242 | 3300017792 | Ga0163161_10055046 | Ga0163161_100550462 | 203 |
| 243 | 3300017792 | Ga0163161_10799671 | Ga0163161_107996712 | 203 |
| 244 | 3300025273 | Ga0209673_1007212 | Ga0209673_10072125 | 203 |
| 245 | 3300025273 | Ga0209673_1021856 | Ga0209673_10218563 | 203 |
| 246 | 3300025295 | Ga0209564_1000005 | Ga0209564_1000005494 | 203 |
| 247 | 3300025299 | Ga0209256_1000767 | Ga0209256_100076724 | 203 |
| 248 | 3300025299 | Ga0209256_1001313 | Ga0209256_100131331 | 203 |
| 249 | 3300025299 | Ga0209256_1039718 | Ga0209256_10397182 | 203 |
| 250 | 3300025303 | Ga0209051_1003662 | Ga0209051_10036627 | 203 |
| 251 | 3300025304 | Ga0209257_1000990 | Ga0209257_100099023 | 203 |
| 252 | 3300025304 | Ga0209257_1002294 | Ga0209257_100229422 | 203 |
| 253 | 3300025315 | Ga0207697_10216185 | Ga0207697_102161852 | 203 |
| 254 | 3300025321 | Ga0207656_10083798 | Ga0207656_100837982 | 203 |
| 255 | 3300025893 | Ga0207682_10028273 | Ga0207682_100282732 | 203 |
| 256 | 3300025893 | Ga0207682_10042718 | Ga0207682_100427182 | 203 |
| 257 | 3300025893 | Ga0207682_10061978 | Ga0207682_100619782 | 203 |
| 258 | 3300025901 | Ga0207688_10060902 | Ga0207688_100609022 | 203 |
| 259 | 3300025901 | Ga0207688_10074391 | Ga0207688_100743912 | 203 |
| 260 | 3300025907 | Ga0207645_10004843 | Ga0207645_100048439 | 203 |
| 261 | 3300025907 | Ga0207645_10028889 | Ga0207645_100288894 | 203 |
| 262 | 3300025907 | Ga0207645_10307889 | Ga0207645_103078892 | 203 |
| 263 | 3300025908 | Ga0207643_10035653 | Ga0207643_100356533 | 203 |
| 264 | 3300025909 | Ga0207705_10412283 | Ga0207705_104122832 | 203 |
| 265 | 3300025918 | Ga0207662_10054937 | Ga0207662_100549372 | 203 |
| 266 | 3300025919 | Ga0207657_10027817 | Ga0207657_100278173 | 203 |
| 267 | 3300025919 | Ga0207657_10154974 | Ga0207657_101549741 | 203 |
| 268 | 3300025920 | Ga0207649_10592056 | Ga0207649_105920562 | 203 |
| 269 | 3300025923 | Ga0207681_10003695 | Ga0207681_100036959 | 203 |
| 270 | 3300025924 | Ga0207694_10065979 | Ga0207694_100659793 | 203 |
| 271 | 3300025925 | Ga0207650_10066144 | Ga0207650_100661442 | 203 |
| 272 | 3300025925 | Ga0207650_10106487 | Ga0207650_101064872 | 203 |
| 273 | 3300025925 | Ga0207650_10221301 | Ga0207650_102213012 | 203 |
| 274 | 3300025925 | Ga0207650_10776745 | Ga0207650_107767451 | 203 |
| 275 | 3300025926 | Ga0207659_10013231 | Ga0207659_100132316 | 203 |
| 276 | 3300025926 | Ga0207659_10018641 | Ga0207659_100186412 | 203 |
| 277 | 3300025926 | Ga0207659_10032482 | Ga0207659_100324824 | 203 |
| 278 | 3300025927 | Ga0207687_10136113 | Ga0207687_101361131 | 203 |
| 279 | 3300025931 | Ga0207644_10046482 | Ga0207644_100464823 | 203 |
| 280 | 3300025931 | Ga0207644_10202541 | Ga0207644_102025412 | 203 |
| 281 | 3300025931 | Ga0207644_10344893 | Ga0207644_103448932 | 203 |
| 282 | 3300025931 | Ga0207644_10687902 | Ga0207644_106879022 | 203 |
| 283 | 3300025931 | Ga0207644_10731487 | Ga0207644_107314872 | 203 |
| 284 | 3300025932 | Ga0207690_10086195 | Ga0207690_100861953 | 203 |
| 285 | 3300025933 | Ga0207706_10012717 | Ga0207706_100127178 | 203 |
| 286 | 3300025933 | Ga0207706_10016241 | Ga0207706_100162416 | 203 |
| 287 | 3300025935 | Ga0207709_10001791 | Ga0207709_100017916 | 203 |
| 288 | 3300025935 | Ga0207709_10009056 | Ga0207709_100090563 | 203 |
| 289 | 3300025935 | Ga0207709_10197351 | Ga0207709_101973512 | 203 |
| 290 | 3300025935 | Ga0207709_10561338 | Ga0207709_105613382 | 203 |
| 291 | 3300025937 | Ga0207669_10006635 | Ga0207669_100066352 | 203 |
| 292 | 3300025937 | Ga0207669_10222460 | Ga0207669_102224602 | 203 |
| 293 | 3300025937 | Ga0207669_10401340 | Ga0207669_104013402 | 203 |
| 294 | 3300025938 | Ga0207704_10012471 | Ga0207704_100124715 | 203 |
| 295 | 3300025938 | Ga0207704_10198640 | Ga0207704_101986402 | 203 |
| 296 | 3300025940 | Ga0207691_10022193 | Ga0207691_100221933 | 203 |
| 297 | 3300025940 | Ga0207691_10023049 | Ga0207691_100230495 | 203 |
| 298 | 3300025940 | Ga0207691_10033193 | Ga0207691_100331935 | 203 |
| 299 | 3300025940 | Ga0207691_10033246 | Ga0207691_100332462 | 203 |
| 300 | 3300025940 | Ga0207691_10134082 | Ga0207691_101340823 | 203 |
| 301 | 3300025940 | Ga0207691_10134169 | Ga0207691_101341692 | 203 |
| 302 | 3300025941 | Ga0207711_10093160 | Ga0207711_100931602 | 203 |
| 303 | 3300025941 | Ga0207711_10109659 | Ga0207711_101096592 | 203 |
| 304 | 3300025941 | Ga0207711_10141921 | Ga0207711_101419213 | 203 |
| 305 | 3300025942 | Ga0207689_10001429 | Ga0207689_100014296 | 203 |
| 306 | 3300025942 | Ga0207689_10012424 | Ga0207689_100124243 | 203 |
| 307 | 3300025945 | Ga0207679_10112660 | Ga0207679_101126602 | 203 |
| 308 | 3300025945 | Ga0207679_11065686 | Ga0207679_110656862 | 203 |
| 309 | 3300025949 | Ga0207667_10050606 | Ga0207667_100506062 | 203 |
| 310 | 3300025960 | Ga0207651_10006261 | Ga0207651_100062613 | 203 |
| 311 | 3300025960 | Ga0207651_10648348 | Ga0207651_106483482 | 203 |
| 312 | 3300025972 | Ga0207668_10419443 | Ga0207668_104194432 | 203 |
| 313 | 3300025981 | Ga0207640_10032954 | Ga0207640_100329542 | 203 |
| 314 | 3300025986 | Ga0207658_10162165 | Ga0207658_101621652 | 203 |
| 315 | 3300026023 | Ga0207677_10029151 | Ga0207677_100291513 | 203 |
| 316 | 3300026023 | Ga0207677_10421183 | Ga0207677_104211832 | 203 |
| 317 | 3300026035 | Ga0207703_10019182 | Ga0207703_100191826 | 203 |
| 318 | 3300026035 | Ga0207703_10105189 | Ga0207703_101051892 | 203 |
| 319 | 3300026035 | Ga0207703_10220216 | Ga0207703_102202162 | 203 |
| 320 | 3300026041 | Ga0207639_10069404 | Ga0207639_100694042 | 203 |
| 321 | 3300026041 | Ga0207639_10179844 | Ga0207639_101798442 | 203 |
| 322 | 3300026067 | Ga0207678_10035138 | Ga0207678_100351385 | 203 |
| 323 | 3300026067 | Ga0207678_10253242 | Ga0207678_102532422 | 203 |
| 324 | 3300026067 | Ga0207678_10468518 | Ga0207678_104685182 | 203 |
| 325 | 3300026067 | Ga0207678_10657450 | Ga0207678_106574502 | 203 |
| 326 | 3300026078 | Ga0207702_10029676 | Ga0207702_100296766 | 203 |
| 327 | 3300026088 | Ga0207641_10039250 | Ga0207641_100392502 | 203 |
| 328 | 3300026088 | Ga0207641_10790446 | Ga0207641_107904462 | 203 |
| 329 | 3300026088 | Ga0207641_10977797 | Ga0207641_109777972 | 203 |
| 330 | 3300026089 | Ga0207648_10000115 | Ga0207648_1000011554 | 203 |
| 331 | 3300026089 | Ga0207648_10002367 | Ga0207648_1000236714 | 203 |
| 332 | 3300026089 | Ga0207648_10007133 | Ga0207648_100071335 | 203 |
| 333 | 3300026089 | Ga0207648_10037225 | Ga0207648_100372253 | 203 |
| 334 | 3300026095 | Ga0207676_10052821 | Ga0207676_100528212 | 203 |
| 335 | 3300026095 | Ga0207676_10502718 | Ga0207676_105027182 | 203 |
| 336 | 3300026095 | Ga0207676_10727915 | Ga0207676_107279152 | 203 |
| 337 | 3300026095 | Ga0207676_10821321 | Ga0207676_108213212 | 203 |
| 338 | 3300026095 | Ga0207676_10980787 | Ga0207676_109807872 | 203 |
| 339 | 3300026116 | Ga0207674_10014143 | Ga0207674_100141432 | 203 |
| 340 | 3300026116 | Ga0207674_10877099 | Ga0207674_108770992 | 203 |
| 341 | 3300026118 | Ga0207675_100000595 | Ga0207675_1000005952 | 203 |
| 342 | 3300026118 | Ga0207675_100000814 | Ga0207675_10000081425 | 203 |
| 343 | 3300026121 | Ga0207683_10017698 | Ga0207683_100176985 | 203 |
| 344 | 3300026121 | Ga0207683_10130883 | Ga0207683_101308832 | 203 |
| 345 | 3300026121 | Ga0207683_10238197 | Ga0207683_102381972 | 203 |
| 346 | 3300026121 | Ga0207683_10262615 | Ga0207683_102626152 | 203 |
| 347 | 3300026121 | Ga0207683_10382435 | Ga0207683_103824351 | 203 |
| 348 | 3300026121 | Ga0207683_11117800 | Ga0207683_111178001 | 203 |
| 349 | 3300026142 | Ga0207698_10016220 | Ga0207698_100162203 | 203 |
| 350 | 3300026142 | Ga0207698_10022258 | Ga0207698_100222583 | 203 |
| 351 | 3300026142 | Ga0207698_10165630 | Ga0207698_101656302 | 203 |
| 352 | 3300026142 | Ga0207698_10311886 | Ga0207698_103118862 | 203 |
| 353 | 3300026142 | Ga0207698_10429733 | Ga0207698_104297332 | 203 |
| 354 | 3300027252 | Ga0209973_1015957 | Ga0209973_10159571 | 203 |
| 355 | 3300027296 | Ga0209389_1015149 | Ga0209389_10151492 | 203 |
| 356 | 3300027876 | Ga0209974_10009563 | Ga0209974_100095632 | 203 |
| 357 | 3300028380 | Ga0268265_10074199 | Ga0268265_100741992 | 203 |
| 358 | 3300028380 | Ga0268265_10505451 | Ga0268265_105054512 | 203 |
| 359 | 3300028381 | Ga0268264_10092983 | Ga0268264_100929832 | 203 |
| 360 | 3300028381 | Ga0268264_10197504 | Ga0268264_101975042 | 203 |
| 361 | 3300028381 | Ga0268264_10468657 | Ga0268264_104686572 | 203 |
| 362 | 3300028786 | Ga0307517_10004912 | Ga0307517_1000491214 | 203 |
| 363 | 3300028794 | Ga0307515_10000652 | Ga0307515_1000065245 | 203 |
| 364 | 3300028794 | Ga0307515_10001063 | Ga0307515_1000106324 | 203 |
| 365 | 3300028794 | Ga0307515_10005581 | Ga0307515_100055819 | 203 |
| 366 | 3300028794 | Ga0307515_10095345 | Ga0307515_100953453 | 203 |
| 367 | 3300028794 | Ga0307515_10209656 | Ga0307515_102096562 | 203 |
| 368 | 3300030522 | Ga0307512_10036774 | Ga0307512_100367745 | 203 |
| 369 | 3300031251 | Ga0265327_10079841 | Ga0265327_100798412 | 203 |
| 370 | 3300031456 | Ga0307513_10028964 | Ga0307513_100289644 | 203 |
| 371 | 3300031456 | Ga0307513_10109212 | Ga0307513_101092123 | 203 |
| 372 | 3300031456 | Ga0307513_10128037 | Ga0307513_101280373 | 203 |
| 373 | 3300031507 | Ga0307509_10004147 | Ga0307509_1000414712 | 203 |
| 374 | 3300031507 | Ga0307509_10004183 | Ga0307509_1000418316 | 203 |
| 375 | 3300031507 | Ga0307509_10101786 | Ga0307509_101017864 | 203 |
| 376 | 3300031507 | Ga0307509_10197700 | Ga0307509_101977002 | 203 |
| 377 | 3300031507 | Ga0307509_10316734 | Ga0307509_103167342 | 203 |
| 378 | 3300031548 | Ga0307408_100201438 | Ga0307408_1002014382 | 203 |
| 379 | 3300031548 | Ga0307408_100537944 | Ga0307408_1005379442 | 203 |
| 380 | 3300031616 | Ga0307508_10000163 | Ga0307508_100001634 | 203 |
| 381 | 3300031616 | Ga0307508_10000385 | Ga0307508_1000038525 | 203 |
| 382 | 3300031616 | Ga0307508_10011794 | Ga0307508_100117949 | 203 |
| 383 | 3300031616 | Ga0307508_10329205 | Ga0307508_103292052 | 203 |
| 384 | 3300031649 | Ga0307514_10002111 | Ga0307514_1000211118 | 203 |
| 385 | 3300031649 | Ga0307514_10338710 | Ga0307514_103387101 | 203 |
| 386 | 3300031730 | Ga0307516_10000381 | Ga0307516_1000038139 | 203 |
| 387 | 3300031731 | Ga0307405_10019585 | Ga0307405_100195855 | 203 |
| 388 | 3300031824 | Ga0307413_10007656 | Ga0307413_100076566 | 203 |
| 389 | 3300031852 | Ga0307410_10017440 | Ga0307410_100174405 | 203 |
| 390 | 3300031901 | Ga0307406_10140953 | Ga0307406_101409532 | 203 |
| 391 | 3300031903 | Ga0307407_10262684 | Ga0307407_102626842 | 203 |
| 392 | 3300031911 | Ga0307412_10054105 | Ga0307412_100541052 | 203 |
| 393 | 3300031995 | Ga0307409_100002529 | Ga0307409_1000025299 | 203 |
| 394 | 3300032002 | Ga0307416_100071544 | Ga0307416_1000715444 | 203 |
| 395 | 3300032002 | Ga0307416_100357459 | Ga0307416_1003574592 | 203 |
| 396 | 3300032126 | Ga0307415_100056340 | Ga0307415_1000563402 | 203 |
| 397 | 3300032126 | Ga0307415_100502849 | Ga0307415_1005028492 | 203 |
| 398 | 3300033179 | Ga0307507_10199264 | Ga0307507_101992642 | 203 |
| 399 | 3300033180 | Ga0307510_10056403 | Ga0307510_100564032 | 203 |
| 400 | 3300033180 | Ga0307510_10148812 | Ga0307510_101488122 | 203 |
| 401 | 3300035112 | Ga0373932_0171284 | Ga0373932_0171284_53_721 | 203 |
| 402 | 3300035115 | Ga0373941_0027987 | Ga0373941_0027987_122_742 | 203 |
| 403 | 3300035172 | Ga0373955_0401646 | Ga0373955_0401646_62_682 | 203 |
| 404 | 3300035691 | Ga0373931_0004194 | Ga0373931_0004194_1276_1896 | 203 |
| 405 | 3300035691 | Ga0373931_0023887 | Ga0373931_0023887_167_778 | 203 |
| 406 | 3300036401 | Ga0373937_0089892 | Ga0373937_0089892_617_1228 | 203 |
| 407 | 3300036401 | Ga0373937_0112459 | Ga0373937_0112459_342_962 | 203 |
| 408 | 3300039437 | Ga0436365_0618815 | Ga0436365_0618815_1773_2393 | 203 |
| 409 | 3300041451 | Ga0451791_0590277 | Ga0451791_0590277_45_656 | 203 |
| 410 | 3300041456 | Ga0451795_0158714 | Ga0451795_0158714_86_697 | 203 |
| 411 | 3300041460 | Ga0451802_1063573 | Ga0451802_1063573_535_1146 | 203 |
| 412 | 3300041486 | Ga0451807_0895355 | Ga0451807_0895355_222_833 | 203 |
| 413 | 3300041486 | Ga0451807_1169175 | Ga0451807_1169175_119_730 | 203 |
| 414 | 3300041496 | Ga0451839_0734584 | Ga0451839_0734584_356_967 | 203 |
| 415 | 3300041507 | Ga0451851_0387925 | Ga0451851_0387925_411_1022 | 203 |
| 416 | 3300042011 | Ga0439454_002859 | Ga0439454_002859_580_1191 | 203 |
| 417 | 3300042121 | Ga0450919_001363 | Ga0450919_001363_2165_2776 | 203 |
| 418 | 3300042125 | Ga0450923_043732 | Ga0450923_043732_276_887 | 203 |
| 419 | 3300042438 | Ga0439459_0002941 | Ga0439459_0002941_1467_2078 | 203 |
| 420 | 3300042531 | Ga0450918_000059 | Ga0450918_000059_6382_6993 | 203 |
| 421 | 3300042876 | Ga0451577_0104026 | Ga0451577_0104026_1023_1634 | 203 |
| 422 | 3300044694 | Ga0466963_0023743 | Ga0466963_0023743_370_981 | 203 |
| 423 | 3300044712 | Ga0453684_0228294 | Ga0453684_0228294_53_664 | 203 |
| 424 | 3300045051 | Ga0451576_0037564 | Ga0451576_0037564_3293_3913 | 203 |
| 425 | 3300046512 | Ga0495610_0017946 | Ga0495610_0017946_123_734 | 203 |
| 426 | 3300046514 | Ga0495618_0127517 | Ga0495618_0127517_172_783 | 203 |
| 427 | 3300046517 | Ga0495630_0197903 | Ga0495630_0197903_388_999 | 203 |
| 428 | 3300046519 | Ga0495632_0119730 | Ga0495632_0119730_171_782 | 203 |
| 429 | 3300046524 | Ga0495648_0063897 | Ga0495648_0063897_565_1176 | 203 |
| 430 | 3300046660 | Ga0495625_0002324 | Ga0495625_0002324_11739_12350 | 203 |
| 431 | 3300046660 | Ga0495625_0098618 | Ga0495625_0098618_753_1364 | 203 |
| 432 | 3300046683 | Ga0495658_0016346 | Ga0495658_0016346_1158_1772 | 203 |
| 433 | 3300046683 | Ga0495658_0289786 | Ga0495658_0289786_150_770 | 203 |
| 434 | 3300046690 | Ga0495624_0027325 | Ga0495624_0027325_1263_1874 | 203 |
| 435 | 3300046691 | Ga0495670_0008089 | Ga0495670_0008089_646_1257 | 203 |
| 436 | 3300047321 | Ga0495676_0025847 | Ga0495676_0025847_2509_3120 | 203 |
| 437 | 3300047470 | Ga0495681_0165643 | Ga0495681_0165643_121_741 | 203 |
| 438 | 3300047673 | Ga0495593_0024903 | Ga0495593_0024903_2169_2780 | 203 |
| 439 | 3300048904 | Ga0496101_0012290 | Ga0496101_0012290_2909_3529 | 203 |
| 440 | 3300048905 | Ga0496102_0004670 | Ga0496102_0004670_5406_6017 | 203 |
| 441 | 3300048905 | Ga0496102_0063249 | Ga0496102_0063249_192_812 | 203 |
| 442 | 3300048908 | Ga0496105_0683180 | Ga0496105_0683180_61_681 | 203 |
| 443 | 3300048909 | Ga0496106_0002144 | Ga0496106_0002144_10745_11356 | 203 |
| 444 | 3300048909 | Ga0496106_0014626 | Ga0496106_0014626_2831_3451 | 203 |
| 445 | 3300048910 | Ga0496107_0227846 | Ga0496107_0227846_324_944 | 203 |
| 446 | 3300048912 | Ga0496109_0072741 | Ga0496109_0072741_2098_2718 | 203 |
| 447 | 3300048913 | Ga0496110_0032378 | Ga0496110_0032378_142_762 | 203 |
| 448 | 3300048914 | Ga0496111_0464573 | Ga0496111_0464573_190_810 | 203 |
| 449 | 3300048915 | Ga0496112_0082239 | Ga0496112_0082239_445_1065 | 203 |
| 450 | 3300048916 | Ga0496113_0035270 | Ga0496113_0035270_749_1369 | 203 |
| 451 | 3300048917 | Ga0496114_0032690 | Ga0496114_0032690_3335_3955 | 203 |
| 452 | 3300048917 | Ga0496114_0626550 | Ga0496114_0626550_47_667 | 203 |
| 453 | 3300048924 | Ga0496121_0550840 | Ga0496121_0550840_48_659 | 203 |
| 454 | 3300048929 | Ga0496126_0105046 | Ga0496126_0105046_1489_2100 | 203 |
| 455 | 3300050490 | nmdc:mga03n38_70019_c1 | nmdc:mga03n38_70019_c1_178_789 | 203 |
| 456 | 3300050493 | nmdc:mga0k408_232697_c1 | nmdc:mga0k408_232697_c1_46_681 | 203 |
| 457 | 3300050493 | nmdc:mga0k408_56639_c1 | nmdc:mga0k408_56639_c1_118_735 | 203 |
| 458 | 3300050494 | nmdc:mga06z11_244083_c1 | nmdc:mga06z11_244083_c1_117_728 | 203 |
| 459 | 3300050496 | nmdc:mga07m45_15470_c1 | nmdc:mga07m45_15470_c1_472_1083 | 203 |
| 460 | 3300050513 | nmdc:mga0rr50_132627_c1 | nmdc:mga0rr50_132627_c1_946_1566 | 203 |
| 461 | 3300053092 | Ga0500583_0093618 | Ga0500583_0093618_271_885 | 203 |
| 462 | 3300053154 | Ga0500619_000022 | Ga0500619_000022_44073_44684 | 203 |
| 463 | 3300053156 | Ga0500622_0002013 | Ga0500622_0002013_13297_13908 | 203 |
| 464 | 3300005330 | Ga0070690_100015438 | Ga0070690_1000154383 | 204 |
| 465 | 3300005331 | Ga0070670_100016508 | Ga0070670_1000165085 | 204 |
| 466 | 3300005331 | Ga0070670_100138098 | Ga0070670_1001380982 | 204 |
| 467 | 3300005333 | Ga0070677_10005552 | Ga0070677_100055525 | 204 |
| 468 | 3300005334 | Ga0068869_100010437 | Ga0068869_1000104373 | 204 |
| 469 | 3300005335 | Ga0070666_10004785 | Ga0070666_100047856 | 204 |
| 470 | 3300005335 | Ga0070666_10139135 | Ga0070666_101391352 | 204 |
| 471 | 3300005338 | Ga0068868_100021348 | Ga0068868_1000213485 | 204 |
| 472 | 3300005340 | Ga0070689_100033724 | Ga0070689_1000337243 | 204 |
| 473 | 3300005344 | Ga0070661_100054069 | Ga0070661_1000540694 | 204 |
| 474 | 3300005347 | Ga0070668_100050633 | Ga0070668_1000506332 | 204 |
| 475 | 3300005354 | Ga0070675_100001074 | Ga0070675_10000107415 | 204 |
| 476 | 3300005354 | Ga0070675_100040906 | Ga0070675_1000409062 | 204 |
| 477 | 3300005355 | Ga0070671_100012181 | Ga0070671_1000121812 | 204 |
| 478 | 3300005356 | Ga0070674_100646059 | Ga0070674_1006460591 | 204 |
| 479 | 3300005364 | Ga0070673_100003123 | Ga0070673_1000031237 | 204 |
| 480 | 3300005365 | Ga0070688_100029186 | Ga0070688_1000291862 | 204 |
| 481 | 3300005367 | Ga0070667_100002896 | Ga0070667_1000028965 | 204 |
| 482 | 3300005456 | Ga0070678_100005243 | Ga0070678_1000052436 | 204 |
| 483 | 3300005456 | Ga0070678_100457609 | Ga0070678_1004576092 | 204 |
| 484 | 3300005457 | Ga0070662_100139249 | Ga0070662_1001392492 | 204 |
| 485 | 3300005459 | Ga0068867_100050623 | Ga0068867_1000506234 | 204 |
| 486 | 3300005459 | Ga0068867_100199674 | Ga0068867_1001996742 | 204 |
| 487 | 3300005543 | Ga0070672_100050430 | Ga0070672_1000504305 | 204 |
| 488 | 3300005543 | Ga0070672_100503673 | Ga0070672_1005036732 | 204 |
| 489 | 3300005544 | Ga0070686_100133155 | Ga0070686_1001331552 | 204 |
| 490 | 3300005564 | Ga0070664_100229315 | Ga0070664_1002293152 | 204 |
| 491 | 3300005564 | Ga0070664_100561621 | Ga0070664_1005616212 | 204 |
| 492 | 3300005614 | Ga0068856_100007479 | Ga0068856_1000074794 | 204 |
| 493 | 3300005617 | Ga0068859_100008331 | Ga0068859_1000083317 | 204 |
| 494 | 3300005618 | Ga0068864_100005602 | Ga0068864_1000056027 | 204 |
| 495 | 3300005719 | Ga0068861_100476271 | Ga0068861_1004762712 | 204 |
| 496 | 3300005834 | Ga0068851_10137676 | Ga0068851_101376762 | 204 |
| 497 | 3300005840 | Ga0068870_10173291 | Ga0068870_101732912 | 204 |
| 498 | 3300005840 | Ga0068870_10465951 | Ga0068870_104659512 | 204 |
| 499 | 3300005841 | Ga0068863_100011592 | Ga0068863_1000115927 | 204 |
| 500 | 3300005842 | Ga0068858_100002455 | Ga0068858_10000245515 | 204 |
| 501 | 3300005843 | Ga0068860_100065038 | Ga0068860_1000650383 | 204 |
| 502 | 3300005844 | Ga0068862_100153731 | Ga0068862_1001537312 | 204 |
| 503 | 3300006353 | Ga0075370_10242268 | Ga0075370_102422682 | 204 |
| 504 | 3300006358 | Ga0068871_100008050 | Ga0068871_1000080507 | 204 |
| 505 | 3300006358 | Ga0068871_100201166 | Ga0068871_1002011662 | 204 |
| 506 | 3300006881 | Ga0068865_100038189 | Ga0068865_1000381893 | 204 |
| 507 | 3300006931 | Ga0097620_100008331 | Ga0097620_1000083317 | 204 |
| 508 | 3300009176 | Ga0105242_10191510 | Ga0105242_101915102 | 204 |
| 509 | 3300009553 | Ga0105249_10246893 | Ga0105249_102468932 | 204 |
| 510 | 3300013296 | Ga0157374_10037506 | Ga0157374_100375063 | 204 |
| 511 | 3300013306 | Ga0163162_10017073 | Ga0163162_100170736 | 204 |
| 512 | 3300013306 | Ga0163162_10521408 | Ga0163162_105214082 | 204 |
| 513 | 3300013308 | Ga0157375_10087312 | Ga0157375_100873122 | 204 |
| 514 | 3300013308 | Ga0157375_10540579 | Ga0157375_105405792 | 204 |
| 515 | 3300014325 | Ga0163163_10007006 | Ga0163163_100070063 | 204 |
| 516 | 3300014326 | Ga0157380_10123026 | Ga0157380_101230262 | 204 |
| 517 | 3300014968 | Ga0157379_10059469 | Ga0157379_100594692 | 204 |
| 518 | 3300025321 | Ga0207656_10062707 | Ga0207656_100627072 | 204 |
| 519 | 3300025893 | Ga0207682_10275181 | Ga0207682_102751812 | 204 |
| 520 | 3300025903 | Ga0207680_10003607 | Ga0207680_100036074 | 204 |
| 521 | 3300025908 | Ga0207643_10174656 | Ga0207643_101746562 | 204 |
| 522 | 3300025918 | Ga0207662_10208347 | Ga0207662_102083472 | 204 |
| 523 | 3300025923 | Ga0207681_10049975 | Ga0207681_100499753 | 204 |
| 524 | 3300025925 | Ga0207650_10020396 | Ga0207650_100203962 | 204 |
| 525 | 3300025925 | Ga0207650_10043137 | Ga0207650_100431373 | 204 |
| 526 | 3300025925 | Ga0207650_10518117 | Ga0207650_105181171 | 204 |
| 527 | 3300025926 | Ga0207659_10010349 | Ga0207659_100103492 | 204 |
| 528 | 3300025931 | Ga0207644_10017836 | Ga0207644_100178362 | 204 |
| 529 | 3300025933 | Ga0207706_10087115 | Ga0207706_100871154 | 204 |
| 530 | 3300025934 | Ga0207686_10192865 | Ga0207686_101928652 | 204 |
| 531 | 3300025936 | Ga0207670_10022243 | Ga0207670_100222434 | 204 |
| 532 | 3300025937 | Ga0207669_10103034 | Ga0207669_101030342 | 204 |
| 533 | 3300025937 | Ga0207669_10276161 | Ga0207669_102761612 | 204 |
| 534 | 3300025940 | Ga0207691_10043476 | Ga0207691_100434762 | 204 |
| 535 | 3300025940 | Ga0207691_10131329 | Ga0207691_101313293 | 204 |
| 536 | 3300025940 | Ga0207691_10184828 | Ga0207691_101848282 | 204 |
| 537 | 3300025941 | Ga0207711_10167418 | Ga0207711_101674183 | 204 |
| 538 | 3300025942 | Ga0207689_10048915 | Ga0207689_100489153 | 204 |
| 539 | 3300025945 | Ga0207679_10086588 | Ga0207679_100865882 | 204 |
| 540 | 3300025945 | Ga0207679_10528849 | Ga0207679_105288492 | 204 |
| 541 | 3300025972 | Ga0207668_10190360 | Ga0207668_101903602 | 204 |
| 542 | 3300025981 | Ga0207640_10353060 | Ga0207640_103530602 | 204 |
| 543 | 3300025986 | Ga0207658_10003143 | Ga0207658_1000314310 | 204 |
| 544 | 3300026023 | Ga0207677_10001922 | Ga0207677_100019229 | 204 |
| 545 | 3300026035 | Ga0207703_10002152 | Ga0207703_1000215212 | 204 |
| 546 | 3300026078 | Ga0207702_10009730 | Ga0207702_100097302 | 204 |
| 547 | 3300026088 | Ga0207641_10001478 | Ga0207641_100014787 | 204 |
| 548 | 3300026089 | Ga0207648_10034806 | Ga0207648_100348062 | 204 |
| 549 | 3300026089 | Ga0207648_10105584 | Ga0207648_101055843 | 204 |
| 550 | 3300026095 | Ga0207676_10005107 | Ga0207676_100051077 | 204 |
| 551 | 3300026118 | Ga0207675_100042538 | Ga0207675_1000425383 | 204 |
| 552 | 3300026118 | Ga0207675_100160711 | Ga0207675_1001607112 | 204 |
| 553 | 3300026121 | Ga0207683_10011209 | Ga0207683_100112095 | 204 |
| 554 | 3300026142 | Ga0207698_10070787 | Ga0207698_100707872 | 204 |
| 555 | 3300028381 | Ga0268264_10067137 | Ga0268264_100671373 | 204 |
| 556 | 3300037068 | Ga0373925_0340305 | Ga0373925_0340305_409_1023 | 204 |
| 557 | 3300041505 | Ga0451849_0341148 | Ga0451849_0341148_39_677 | 204 |
| 558 | 3300046681 | Ga0495647_0063978 | Ga0495647_0063978_91_705 | 204 |
| 559 | 3300048903 | Ga0496100_0364902 | Ga0496100_0364902_334_948 | 204 |
| 560 | 3300048907 | Ga0496104_0401427 | Ga0496104_0401427_329_943 | 204 |
| 561 | 3300048911 | Ga0496108_1057641 | Ga0496108_1057641_58_672 | 204 |
| 562 | 3300048917 | Ga0496114_0289600 | Ga0496114_0289600_671_1285 | 204 |
| 563 | 3300042876 | Ga0451577_0027133 | Ga0451577_0027133_2549_3175 | 205 |
| 564 | iso_pu_bacteria | 2885192300 | 2885192570 | 206 |
| 565 | iso_pu_bacteria | 2842747753 | 2842751525 | 207 |
| 566 | iso_pu_bacteria | 2945909444 | 2945912121 | 207 |
| 567 | iso_pu_bacteria | 2945984333 | 2945985594 | 207 |
| 568 | iso_pu_bacteria | 2954767861 | 2954772138 | 207 |
| 569 | iso_pu_bacteria | 2513020051 | 2513226420 | 208 |
| 570 | iso_pu_bacteria | 2643221628 | 2644163325 | 208 |
| 571 | iso_pu_bacteria | 2643221658 | 2644327814 | 208 |
| 572 | iso_pu_bacteria | 2643221672 | 2644400509 | 208 |
| 573 | iso_pu_bacteria | 2818991446 | 2819597454 | 208 |
| 574 | iso_pu_bacteria | 2831265667 | 2831266632 | 208 |
| 575 | iso_pu_bacteria | 2838054893 | 2838057289 | 208 |
| 576 | iso_pu_bacteria | 2842677519 | 2842679570 | 208 |
| 577 | iso_pu_bacteria | 2899924645 | 2899924964 | 208 |
| 578 | iso_pu_bacteria | 2904449895 | 2904455669 | 208 |
| 579 | iso_pu_bacteria | 2904456579 | 2904462821 | 208 |
| 580 | iso_pu_bacteria | 2904479285 | 2904482564 | 208 |
| 581 | iso_pu_bacteria | 2919462493 | 2919467334 | 208 |
| 582 | iso_pu_bacteria | 2928037797 | 2928038912 | 208 |
| 583 | iso_pu_bacteria | 2928044640 | 2928045483 | 208 |
| 584 | iso_pu_bacteria | 2928051484 | 2928058380 | 208 |
| 585 | iso_pu_bacteria | 2928064002 | 2928064039 | 208 |
| 586 | iso_pu_bacteria | 2928084124 | 2928084647 | 208 |
| 587 | iso_pu_bacteria | 2929520902 | 2929522657 | 208 |
| 588 | iso_pu_bacteria | 2945972063 | 2945977337 | 208 |
| 589 | 3300005577 | Ga0068857_100298797 | Ga0068857_1002987972 | 209 |
| 590 | 3300014497 | Ga0182008_10121730 | Ga0182008_101217302 | 209 |
| 591 | 3300026116 | Ga0207674_10351268 | Ga0207674_103512682 | 209 |
| 592 | iso_pu_bacteria | 2842733646 | 2842734861 | 209 |
| 593 | 3300003320 | rootH2_10072340 | rootH2_100723402 | 210 |
| 594 | 3300005844 | Ga0068862_100064391 | Ga0068862_1000643912 | 210 |
| 595 | 3300028380 | Ga0268265_10121140 | Ga0268265_101211402 | 210 |
| 596 | 3300031251 | Ga0265327_10006203 | Ga0265327_100062035 | 210 |
| 597 | 3300031456 | Ga0307513_10464070 | Ga0307513_104640702 | 210 |
| 598 | 3300042006 | Ga0439432_072444 | Ga0439432_072444_304_945 | 210 |
| 599 | 3300042007 | Ga0439449_0003523 | Ga0439449_0003523_2695_3336 | 210 |
| 600 | 3300050492 | nmdc:mga0yw44_174365_c1 | nmdc:mga0yw44_174365_c1_280_912 | 210 |
| 601 | 3300053079 | Ga0500610_0075277 | Ga0500610_0075277_853_1497 | 210 |
| 602 | iso_pu_bacteria | 2885198086 | 2885201345 | 210 |
| 603 | iso_pu_bacteria | 2885211737 | 2885214973 | 210 |
| 604 | 3300005327 | Ga0070658_10020838 | Ga0070658_100208385 | 211 |
| 605 | 3300005353 | Ga0070669_100045955 | Ga0070669_1000459552 | 211 |
| 606 | 3300006177 | Ga0075362_10089147 | Ga0075362_100891472 | 211 |
| 607 | 3300013104 | Ga0157370_10453641 | Ga0157370_104536412 | 211 |
| 608 | 3300017792 | Ga0163161_10000578 | Ga0163161_1000057818 | 211 |
| 609 | 3300025909 | Ga0207705_10067743 | Ga0207705_100677432 | 211 |
| 610 | 3300025923 | Ga0207681_10064872 | Ga0207681_100648722 | 211 |
| 611 | 3300026121 | Ga0207683_10726588 | Ga0207683_107265881 | 211 |
| 612 | 3300030522 | Ga0307512_10152045 | Ga0307512_101520452 | 211 |
| 613 | 3300031238 | Ga0265332_10000094 | Ga0265332_1000009424 | 211 |
| 614 | 3300031456 | Ga0307513_10138268 | Ga0307513_101382682 | 211 |
| 615 | 3300031548 | Ga0307408_100849166 | Ga0307408_1008491661 | 211 |
| 616 | 3300031911 | Ga0307412_10010332 | Ga0307412_100103328 | 211 |
| 617 | 3300041404 | Ga0439436_0000212 | Ga0439436_0000212_10554_11195 | 211 |
| 618 | 3300041406 | Ga0439439_0004076 | Ga0439439_0004076_2205_2846 | 211 |
| 619 | 3300041411 | Ga0439466_0015553 | Ga0439466_0015553_379_1020 | 211 |
| 620 | 3300041413 | Ga0439465_0001922 | Ga0439465_0001922_2603_3244 | 211 |
| 621 | 3300041997 | Ga0439431_0005958 | Ga0439431_0005958_1527_2168 | 211 |
| 622 | 3300041999 | Ga0439433_0000802 | Ga0439433_0000802_1282_1923 | 211 |
| 623 | 3300042006 | Ga0439432_005007 | Ga0439432_005007_1499_2140 | 211 |
| 624 | 3300042007 | Ga0439449_0000162 | Ga0439449_0000162_6163_6804 | 211 |
| 625 | 3300042010 | Ga0439452_000749 | Ga0439452_000749_2775_3416 | 211 |
| 626 | 3300042015 | Ga0439462_0004283 | Ga0439462_0004283_177_818 | 211 |
| 627 | 3300042156 | Ga0439446_0025651 | Ga0439446_0025651_251_892 | 211 |
| 628 | 3300042435 | Ga0439434_0004431 | Ga0439434_0004431_2979_3620 | 211 |
| 629 | 3300046453 | Ga0495627_007076 | Ga0495627_007076_1326_1985 | 211 |
| 630 | 3300046512 | Ga0495610_0038244 | Ga0495610_0038244_1216_1875 | 211 |
| 631 | 3300046520 | Ga0495637_0008897 | Ga0495637_0008897_2107_2766 | 211 |
| 632 | 3300046530 | Ga0495654_0069440 | Ga0495654_0069440_403_1062 | 211 |
| 633 | 3300046558 | Ga0495633_0086478 | Ga0495633_0086478_474_1133 | 211 |
| 634 | 3300046674 | Ga0495588_0032582 | Ga0495588_0032582_1273_1932 | 211 |
| 635 | 3300046691 | Ga0495670_0156247 | Ga0495670_0156247_22_681 | 211 |
| 636 | 3300046692 | Ga0495671_0001783 | Ga0495671_0001783_11243_11902 | 211 |
| 637 | 3300046810 | Ga0495660_0107457 | Ga0495660_0107457_499_1158 | 211 |
| 638 | 3300048927 | Ga0496124_0278254 | Ga0496124_0278254_458_1093 | 211 |
| 639 | 3300048929 | Ga0496126_0434354 | Ga0496126_0434354_278_913 | 211 |
| 640 | 3300053079 | Ga0500610_0002251 | Ga0500610_0002251_5361_6020 | 211 |
| 641 | 3300053079 | Ga0500610_0033483 | Ga0500610_0033483_980_1639 | 211 |
| 642 | 3300053096 | Ga0500641_0197200 | Ga0500641_0197200_177_836 | 211 |
| 643 | 3300053117 | Ga0500593_019315 | Ga0500593_019315_557_1216 | 211 |
| 644 | 3300053121 | Ga0500607_000328 | Ga0500607_000328_18060_18719 | 211 |
| 645 | 3300053158 | Ga0500627_0001126 | Ga0500627_0001126_2234_2893 | 211 |
| 646 | iso_pu_bacteria | 2547132374 | 2548500950 | 211 |
| 647 | iso_pu_bacteria | 2599185214 | 2599626500 | 211 |
| 648 | iso_pu_bacteria | 2599185226 | 2599675564 | 211 |
| 649 | iso_pu_bacteria | 2599185227 | 2599684037 | 211 |
| 650 | iso_pu_bacteria | 2599185229 | 2599696051 | 211 |
| 651 | iso_pu_bacteria | 2643221570 | 2643865578 | 211 |
| 652 | iso_pu_bacteria | 2643221596 | 2643993410 | 211 |
| 653 | iso_pu_bacteria | 2643221652 | 2644294539 | 211 |
| 654 | iso_pu_bacteria | 2643221717 | 2644646202 | 211 |
| 655 | iso_pu_bacteria | 2904541872 | 2904544910 | 211 |
| 656 | iso_pu_bacteria | 2928070936 | 2928071412 | 211 |
| 657 | iso_pu_bacteria | 2929160207 | 2929163420 | 211 |
| 658 | iso_pu_bacteria | 2945945610 | 2945947818 | 211 |
| 659 | iso_pu_bacteria | 2990710928 | 2990712646 | 211 |
| 660 | 3300002774 | JGI25150J39212_1000384 | JGI25150J39212_10003842 | 212 |
| 661 | 3300002987 | JGI25159J45721_1000103 | JGI25159J45721_100010340 | 212 |
| 662 | 3300002987 | JGI25159J45721_1004784 | JGI25159J45721_10047845 | 212 |
| 663 | 3300003187 | JGI25151J46595_10015382 | JGI25151J46595_100153822 | 212 |
| 664 | 3300003215 | JGI25153J46596_10013918 | JGI25153J46596_100139182 | 212 |
| 665 | 3300003354 | JGI25160J50197_1000255 | JGI25160J50197_10002552 | 212 |
| 666 | 3300003354 | JGI25160J50197_1006714 | JGI25160J50197_10067142 | 212 |
| 667 | 3300003374 | JGI25161J50226_1000393 | JGI25161J50226_10003932 | 212 |
| 668 | 3300003374 | JGI25161J50226_1004942 | JGI25161J50226_10049422 | 212 |
| 669 | 3300003761 | Ga0055535_1000305 | Ga0055535_100030538 | 212 |
| 670 | 3300003762 | Ga0055542_1000021 | Ga0055542_1000021113 | 212 |
| 671 | 3300003771 | Ga0055526_1013837 | Ga0055526_10138372 | 212 |
| 672 | 3300003773 | Ga0055537_1000036 | Ga0055537_100003673 | 212 |
| 673 | 3300003773 | Ga0055537_1003375 | Ga0055537_10033754 | 212 |
| 674 | 3300003775 | Ga0055524_1011877 | Ga0055524_10118772 | 212 |
| 675 | 3300003775 | Ga0055524_1011918 | Ga0055524_10119182 | 212 |
| 676 | 3300003781 | Ga0055536_1000396 | Ga0055536_100039636 | 212 |
| 677 | 3300003781 | Ga0055536_1002959 | Ga0055536_10029597 | 212 |
| 678 | 3300003781 | Ga0055536_1012104 | Ga0055536_10121043 | 212 |
| 679 | 3300003784 | Ga0055534_1000018 | Ga0055534_100001811 | 212 |
| 680 | 3300003784 | Ga0055534_1002944 | Ga0055534_10029445 | 212 |
| 681 | 3300003784 | Ga0055534_1005504 | Ga0055534_10055042 | 212 |
| 682 | 3300003790 | Ga0055528_1000903 | Ga0055528_100090316 | 212 |
| 683 | 3300003790 | Ga0055528_1007234 | Ga0055528_10072344 | 212 |
| 684 | 3300003791 | Ga0055530_10000086 | Ga0055530_1000008637 | 212 |
| 685 | 3300003791 | Ga0055530_10000991 | Ga0055530_100009917 | 212 |
| 686 | 3300003792 | Ga0055540_1000405 | Ga0055540_100040510 | 212 |
| 687 | 3300003792 | Ga0055540_1004907 | Ga0055540_10049074 | 212 |
| 688 | 3300003792 | Ga0055540_1009436 | Ga0055540_10094362 | 212 |
| 689 | 3300003794 | Ga0055531_10000515 | Ga0055531_1000051510 | 212 |
| 690 | 3300003794 | Ga0055531_10015372 | Ga0055531_100153722 | 212 |
| 691 | 3300003794 | Ga0055531_10015402 | Ga0055531_100154022 | 212 |
| 692 | 3300004625 | Ga0055543_1000262 | Ga0055543_10002622 | 212 |
| 693 | 3300004625 | Ga0055543_1005364 | Ga0055543_10053643 | 212 |
| 694 | 3300005262 | Ga0065165_1000494 | Ga0065165_10004942 | 212 |
| 695 | 3300005288 | Ga0065714_10097146 | Ga0065714_100971462 | 212 |
| 696 | 3300005344 | Ga0070661_100122320 | Ga0070661_1001223202 | 212 |
| 697 | 3300005457 | Ga0070662_100024236 | Ga0070662_1000242365 | 212 |
| 698 | 3300005539 | Ga0068853_100018345 | Ga0068853_1000183453 | 212 |
| 699 | 3300005563 | Ga0068855_101050171 | Ga0068855_1010501712 | 212 |
| 700 | 3300005564 | Ga0070664_100165367 | Ga0070664_1001653672 | 212 |
| 701 | 3300005577 | Ga0068857_100228885 | Ga0068857_1002288852 | 212 |
| 702 | 3300005614 | Ga0068856_100527512 | Ga0068856_1005275122 | 212 |
| 703 | 3300006042 | Ga0075368_10061326 | Ga0075368_100613262 | 212 |
| 704 | 3300006048 | Ga0075363_100027660 | Ga0075363_1000276602 | 212 |
| 705 | 3300006048 | Ga0075363_100069601 | Ga0075363_1000696012 | 212 |
| 706 | 3300006177 | Ga0075362_10032725 | Ga0075362_100327252 | 212 |
| 707 | 3300006195 | Ga0075366_10030192 | Ga0075366_100301923 | 212 |
| 708 | 3300006353 | Ga0075370_10006928 | Ga0075370_100069287 | 212 |
| 709 | 3300006353 | Ga0075370_10050158 | Ga0075370_100501582 | 212 |
| 710 | 3300006353 | Ga0075370_10066053 | Ga0075370_100660532 | 212 |
| 711 | 3300006353 | Ga0075370_10283321 | Ga0075370_102833212 | 212 |
| 712 | 3300006948 | Ga0099826_10003330 | Ga0099826_100033307 | 212 |
| 713 | 3300006948 | Ga0099826_10072148 | Ga0099826_100721482 | 212 |
| 714 | 3300006948 | Ga0099826_10275303 | Ga0099826_102753032 | 212 |
| 715 | 3300009036 | Ga0105244_10006079 | Ga0105244_100060796 | 212 |
| 716 | 3300009148 | Ga0105243_10016483 | Ga0105243_100164832 | 212 |
| 717 | 3300009148 | Ga0105243_10365387 | Ga0105243_103653872 | 212 |
| 718 | 3300011119 | Ga0105246_10170572 | Ga0105246_101705722 | 212 |
| 719 | 3300011119 | Ga0105246_10240635 | Ga0105246_102406352 | 212 |
| 720 | 3300013100 | Ga0157373_10497492 | Ga0157373_104974922 | 212 |
| 721 | 3300013102 | Ga0157371_10189039 | Ga0157371_101890392 | 212 |
| 722 | 3300013104 | Ga0157370_10292047 | Ga0157370_102920472 | 212 |
| 723 | 3300013104 | Ga0157370_10561572 | Ga0157370_105615722 | 212 |
| 724 | 3300014497 | Ga0182008_10002841 | Ga0182008_100028413 | 212 |
| 725 | 3300014497 | Ga0182008_10004507 | Ga0182008_100045072 | 212 |
| 726 | 3300015261 | Ga0182006_1002817 | Ga0182006_10028175 | 212 |
| 727 | 3300015261 | Ga0182006_1059750 | Ga0182006_10597502 | 212 |
| 728 | 3300015262 | Ga0182007_10000727 | Ga0182007_100007272 | 212 |
| 729 | 3300017792 | Ga0163161_10229392 | Ga0163161_102293922 | 212 |
| 730 | 3300025208 | Ga0209436_104755 | Ga0209436_1047552 | 212 |
| 731 | 3300025208 | Ga0209436_107635 | Ga0209436_1076352 | 212 |
| 732 | 3300025228 | Ga0209672_105495 | Ga0209672_1054952 | 212 |
| 733 | 3300025229 | Ga0209147_100716 | Ga0209147_1007162 | 212 |
| 734 | 3300025242 | Ga0209258_100058 | Ga0209258_100058113 | 212 |
| 735 | 3300025245 | Ga0207425_1000087 | Ga0207425_100008760 | 212 |
| 736 | 3300025254 | Ga0209148_1000071 | Ga0209148_1000071113 | 212 |
| 737 | 3300025258 | Ga0209129_1000007 | Ga0209129_1000007700 | 212 |
| 738 | 3300025258 | Ga0209129_1001475 | Ga0209129_100147510 | 212 |
| 739 | 3300025263 | Ga0209565_1000038 | Ga0209565_100003898 | 212 |
| 740 | 3300025263 | Ga0209565_1000075 | Ga0209565_1000075146 | 212 |
| 741 | 3300025263 | Ga0209565_1001142 | Ga0209565_10011425 | 212 |
| 742 | 3300025273 | Ga0209673_1000066 | Ga0209673_100006654 | 212 |
| 743 | 3300025273 | Ga0209673_1000080 | Ga0209673_1000080162 | 212 |
| 744 | 3300025273 | Ga0209673_1002015 | Ga0209673_10020158 | 212 |
| 745 | 3300025273 | Ga0209673_1003648 | Ga0209673_10036484 | 212 |
| 746 | 3300025284 | Ga0209130_1000131 | Ga0209130_100013190 | 212 |
| 747 | 3300025284 | Ga0209130_1000137 | Ga0209130_100013761 | 212 |
| 748 | 3300025291 | Ga0209675_1000074 | Ga0209675_1000074146 | 212 |
| 749 | 3300025291 | Ga0209675_1000102 | Ga0209675_100010247 | 212 |
| 750 | 3300025291 | Ga0209675_1001838 | Ga0209675_10018387 | 212 |
| 751 | 3300025292 | Ga0209676_1000005 | Ga0209676_1000005915 | 212 |
| 752 | 3300025292 | Ga0209676_1000186 | Ga0209676_1000186101 | 212 |
| 753 | 3300025292 | Ga0209676_1000703 | Ga0209676_100070340 | 212 |
| 754 | 3300025292 | Ga0209676_1001078 | Ga0209676_100107820 | 212 |
| 755 | 3300025292 | Ga0209676_1062212 | Ga0209676_10622122 | 212 |
| 756 | 3300025294 | Ga0209025_1000056 | Ga0209025_1000056186 | 212 |
| 757 | 3300025294 | Ga0209025_1008022 | Ga0209025_10080225 | 212 |
| 758 | 3300025295 | Ga0209564_1000073 | Ga0209564_1000073222 | 212 |
| 759 | 3300025295 | Ga0209564_1000090 | Ga0209564_100009037 | 212 |
| 760 | 3300025297 | Ga0209758_1000044 | Ga0209758_1000044173 | 212 |
| 761 | 3300025298 | Ga0209050_1000007 | Ga0209050_1000007182 | 212 |
| 762 | 3300025298 | Ga0209050_1000250 | Ga0209050_100025063 | 212 |
| 763 | 3300025299 | Ga0209256_1000020 | Ga0209256_1000020176 | 212 |
| 764 | 3300025299 | Ga0209256_1000022 | Ga0209256_1000022255 | 212 |
| 765 | 3300025302 | Ga0207426_1000001 | Ga0207426_1000001811 | 212 |
| 766 | 3300025302 | Ga0207426_1000031 | Ga0207426_1000031412 | 212 |
| 767 | 3300025303 | Ga0209051_1000036 | Ga0209051_1000036266 | 212 |
| 768 | 3300025303 | Ga0209051_1000160 | Ga0209051_100016071 | 212 |
| 769 | 3300025303 | Ga0209051_1000213 | Ga0209051_100021310 | 212 |
| 770 | 3300025303 | Ga0209051_1011578 | Ga0209051_10115785 | 212 |
| 771 | 3300025304 | Ga0209257_1000011 | Ga0209257_1000011889 | 212 |
| 772 | 3300025304 | Ga0209257_1000116 | Ga0209257_100011652 | 212 |
| 773 | 3300025304 | Ga0209257_1000222 | Ga0209257_1000222112 | 212 |
| 774 | 3300025728 | Ga0207655_1005759 | Ga0207655_10057599 | 212 |
| 775 | 3300025911 | Ga0207654_10658557 | Ga0207654_106585571 | 212 |
| 776 | 3300025919 | Ga0207657_10168000 | Ga0207657_101680002 | 212 |
| 777 | 3300025920 | Ga0207649_10076912 | Ga0207649_100769122 | 212 |
| 778 | 3300025933 | Ga0207706_10122025 | Ga0207706_101220252 | 212 |
| 779 | 3300025935 | Ga0207709_10002968 | Ga0207709_100029688 | 212 |
| 780 | 3300025935 | Ga0207709_10325830 | Ga0207709_103258302 | 212 |
| 781 | 3300025945 | Ga0207679_10218174 | Ga0207679_102181742 | 212 |
| 782 | 3300026041 | Ga0207639_10043681 | Ga0207639_100436813 | 212 |
| 783 | 3300026089 | Ga0207648_11104592 | Ga0207648_111045921 | 212 |
| 784 | 3300026116 | Ga0207674_10076121 | Ga0207674_100761213 | 212 |
| 785 | 3300027666 | Ga0209282_1000221 | Ga0209282_100022123 | 212 |
| 786 | 3300027666 | Ga0209282_1130980 | Ga0209282_11309802 | 212 |
| 787 | 3300028794 | Ga0307515_10000306 | Ga0307515_10000306111 | 212 |
| 788 | 3300030731 | Ga0316177_1105017 | Ga0316177_11050176 | 212 |
| 789 | 3300030732 | Ga0316176_1013009 | Ga0316176_10130092 | 212 |
| 790 | 3300030733 | Ga0314311_1155152 | Ga0314311_11551525 | 212 |
| 791 | 3300030735 | Ga0316178_1038440 | Ga0316178_10384402 | 212 |
| 792 | 3300030742 | Ga0316183_1039891 | Ga0316183_10398916 | 212 |
| 793 | 3300031548 | Ga0307408_100087987 | Ga0307408_1000879872 | 212 |
| 794 | 3300031548 | Ga0307408_100167055 | Ga0307408_1001670552 | 212 |
| 795 | 3300031649 | Ga0307514_10048620 | Ga0307514_100486204 | 212 |
| 796 | 3300031731 | Ga0307405_10743538 | Ga0307405_107435381 | 212 |
| 797 | 3300031901 | Ga0307406_10225625 | Ga0307406_102256252 | 212 |
| 798 | 3300031911 | Ga0307412_10386146 | Ga0307412_103861462 | 212 |
| 799 | 3300031911 | Ga0307412_10595524 | Ga0307412_105955242 | 212 |
| 800 | 3300031911 | Ga0307412_11053003 | Ga0307412_110530031 | 212 |
| 801 | 3300032002 | Ga0307416_100043673 | Ga0307416_1000436731 | 212 |
| 802 | 3300032126 | Ga0307415_100503742 | Ga0307415_1005037422 | 212 |
| 803 | 3300041404 | Ga0439436_0023349 | Ga0439436_0023349_685_1344 | 212 |
| 804 | 3300041411 | Ga0439466_0013780 | Ga0439466_0013780_2048_2707 | 212 |
| 805 | 3300042002 | Ga0439442_017744 | Ga0439442_017744_262_921 | 212 |
| 806 | 3300042007 | Ga0439449_0009856 | Ga0439449_0009856_98_757 | 212 |
| 807 | 3300042121 | Ga0450919_012034 | Ga0450919_012034_35_694 | 212 |
| 808 | 3300042122 | Ga0450920_005006 | Ga0450920_005006_921_1580 | 212 |
| 809 | 3300042123 | Ga0450921_000292 | Ga0450921_000292_83_742 | 212 |
| 810 | 3300042134 | Ga0450898_004329 | Ga0450898_004329_223_882 | 212 |
| 811 | 3300042135 | Ga0450899_003556 | Ga0450899_003556_935_1594 | 212 |
| 812 | 3300042145 | Ga0450906_003932 | Ga0450906_003932_1769_2428 | 212 |
| 813 | 3300042147 | Ga0450910_015468 | Ga0450910_015468_83_742 | 212 |
| 814 | 3300042531 | Ga0450918_001383 | Ga0450918_001383_583_1242 | 212 |
| 815 | 3300046459 | Ga0495629_0092193 | Ga0495629_0092193_1402_2058 | 212 |
| 816 | 3300046506 | Ga0495583_0128092 | Ga0495583_0128092_311_967 | 212 |
| 817 | 3300046512 | Ga0495610_0023524 | Ga0495610_0023524_1837_2493 | 212 |
| 818 | 3300046513 | Ga0495616_0001622 | Ga0495616_0001622_11828_12484 | 212 |
| 819 | 3300046515 | Ga0495620_0228861 | Ga0495620_0228861_10_666 | 212 |
| 820 | 3300046518 | Ga0495631_0003611 | Ga0495631_0003611_1191_1847 | 212 |
| 821 | 3300046520 | Ga0495637_0022431 | Ga0495637_0022431_1101_1757 | 212 |
| 822 | 3300046616 | Ga0495668_0068549 | Ga0495668_0068549_450_1106 | 212 |
| 823 | 3300046660 | Ga0495625_0000057 | Ga0495625_0000057_163539_164198 | 212 |
| 824 | 3300047673 | Ga0495593_0109881 | Ga0495593_0109881_377_1033 | 212 |
| 825 | 3300048089 | Ga0495614_0028444 | Ga0495614_0028444_941_1597 | 212 |
| 826 | 3300048910 | Ga0496107_0101397 | Ga0496107_0101397_1161_1817 | 212 |
| 827 | 3300048919 | Ga0496116_0025716 | Ga0496116_0025716_13_669 | 212 |
| 828 | 3300048920 | Ga0496117_0028533 | Ga0496117_0028533_556_1212 | 212 |
| 829 | 3300048920 | Ga0496117_0028546 | Ga0496117_0028546_849_1502 | 212 |
| 830 | 3300048920 | Ga0496117_0072533 | Ga0496117_0072533_26_682 | 212 |
| 831 | 3300048921 | Ga0496118_0016121 | Ga0496118_0016121_3110_3763 | 212 |
| 832 | 3300048921 | Ga0496118_0039128 | Ga0496118_0039128_2484_3140 | 212 |
| 833 | 3300048924 | Ga0496121_0042381 | Ga0496121_0042381_1141_1797 | 212 |
| 834 | 3300048924 | Ga0496121_0151260 | Ga0496121_0151260_771_1427 | 212 |
| 835 | 3300048925 | Ga0496122_0074474 | Ga0496122_0074474_1132_1788 | 212 |
| 836 | 3300048926 | Ga0496123_0136522 | Ga0496123_0136522_48_704 | 212 |
| 837 | 3300048927 | Ga0496124_0008708 | Ga0496124_0008708_7359_8015 | 212 |
| 838 | 3300048928 | Ga0496125_0008866 | Ga0496125_0008866_6711_7364 | 212 |
| 839 | 3300048928 | Ga0496125_0041445 | Ga0496125_0041445_2157_2813 | 212 |
| 840 | 3300048928 | Ga0496125_0193121 | Ga0496125_0193121_111_767 | 212 |
| 841 | 3300049759 | Ga0501262_004518 | Ga0501262_004518_531_1190 | 212 |
| 842 | 3300050489 | nmdc:mga03683_1803_c1 | nmdc:mga03683_1803_c1_2521_3180 | 212 |
| 843 | 3300050489 | nmdc:mga03683_33853_c1 | nmdc:mga03683_33853_c1_134_793 | 212 |
| 844 | 3300050490 | nmdc:mga03n38_133491_c1 | nmdc:mga03n38_133491_c1_214_873 | 212 |
| 845 | 3300050490 | nmdc:mga03n38_57895_c1 | nmdc:mga03n38_57895_c1_634_1272 | 212 |
| 846 | 3300050493 | nmdc:mga0k408_10715_c1 | nmdc:mga0k408_10715_c1_3300_3938 | 212 |
| 847 | 3300050496 | nmdc:mga07m45_24262_c1 | nmdc:mga07m45_24262_c1_1688_2347 | 212 |
| 848 | 3300050496 | nmdc:mga07m45_48000_c1 | nmdc:mga07m45_48000_c1_1027_1665 | 212 |
| 849 | 3300050496 | nmdc:mga07m45_9224_c1 | nmdc:mga07m45_9224_c1_3310_3966 | 212 |
| 850 | 3300053087 | Ga0500643_004866 | Ga0500643_004866_5106_5762 | 212 |
| 851 | 3300053093 | Ga0500651_0000090 | Ga0500651_0000090_40437_41093 | 212 |
| 852 | 3300053094 | Ga0500566_0031058 | Ga0500566_0031058_156_812 | 212 |
| 853 | 3300053108 | Ga0500562_002544 | Ga0500562_002544_193_849 | 212 |
| 854 | 3300053110 | Ga0500571_000014 | Ga0500571_000014_10076_10732 | 212 |
| 855 | 3300053116 | Ga0500592_008465 | Ga0500592_008465_845_1501 | 212 |
| 856 | 3300053118 | Ga0500594_0002517 | Ga0500594_0002517_52_708 | 212 |
| 857 | 3300053122 | Ga0500608_003138 | Ga0500608_003138_1872_2531 | 212 |
| 858 | 3300053128 | Ga0500626_194385 | Ga0500626_194385_65_721 | 212 |
| 859 | 3300053133 | Ga0500655_001389 | Ga0500655_001389_730_1386 | 212 |
| 860 | 3300053134 | Ga0500658_0000018 | Ga0500658_0000018_66469_67125 | 212 |
| 861 | 3300053134 | Ga0500658_0000322 | Ga0500658_0000322_13180_13836 | 212 |
| 862 | 3300053136 | Ga0500559_0010108 | Ga0500559_0010108_3258_3914 | 212 |
| 863 | 3300053136 | Ga0500559_0012748 | Ga0500559_0012748_1210_1848 | 212 |
| 864 | 3300053138 | Ga0500564_010061 | Ga0500564_010061_2049_2705 | 212 |
| 865 | 3300053141 | Ga0500574_003231 | Ga0500574_003231_2033_2689 | 212 |
| 866 | 3300053153 | Ga0500616_0007996 | Ga0500616_0007996_5696_6352 | 212 |
| 867 | 3300053154 | Ga0500619_063314 | Ga0500619_063314_156_812 | 212 |
| 868 | 3300053161 | Ga0500634_0068195 | Ga0500634_0068195_996_1652 | 212 |
| 869 | 3300053162 | Ga0500638_026886 | Ga0500638_026886_255_911 | 212 |
| 870 | 3300053177 | Ga0500636_0042892 | Ga0500636_0042892_749_1405 | 212 |
| 871 | iso_pu_bacteria | 2738541277 | 2738717925 | 212 |
| 872 | iso_pu_bacteria | 2738543019 | 2739278611 | 212 |
| 873 | iso_pu_bacteria | 2928115317 | 2928118615 | 212 |
| 874 | 3300003187 | JGI25151J46595_10001581 | JGI25151J46595_1000158110 | 213 |
| 875 | 3300006177 | Ga0075362_10014387 | Ga0075362_100143873 | 213 |
| 876 | 3300006177 | Ga0075362_10080360 | Ga0075362_100803602 | 213 |
| 877 | 3300006353 | Ga0075370_10012797 | Ga0075370_100127972 | 213 |
| 878 | 3300006353 | Ga0075370_10273630 | Ga0075370_102736302 | 213 |
| 879 | 3300009148 | Ga0105243_10074640 | Ga0105243_100746402 | 213 |
| 880 | 3300013100 | Ga0157373_10048353 | Ga0157373_100483532 | 213 |
| 881 | 3300014497 | Ga0182008_10116407 | Ga0182008_101164072 | 213 |
| 882 | 3300015261 | Ga0182006_1090141 | Ga0182006_10901412 | 213 |
| 883 | 3300025258 | Ga0209129_1002386 | Ga0209129_10023867 | 213 |
| 884 | 3300025294 | Ga0209025_1000104 | Ga0209025_100010419 | 213 |
| 885 | 3300025935 | Ga0207709_10141454 | Ga0207709_101414542 | 213 |
| 886 | 3300031548 | Ga0307408_100060094 | Ga0307408_1000600942 | 213 |
| 887 | 3300031901 | Ga0307406_10003567 | Ga0307406_100035672 | 213 |
| 888 | 3300037312 | Ga0395899_0023506 | Ga0395899_0023506_2269_2910 | 213 |
| 889 | 3300037418 | Ga0395900_0140666 | Ga0395900_0140666_1447_2088 | 213 |
| 890 | 3300037466 | Ga0395898_0010832 | Ga0395898_0010832_8574_9215 | 213 |
| 891 | 3300037471 | Ga0395905_0092135 | Ga0395905_0092135_862_1503 | 213 |
| 892 | 3300038443 | Ga0395901_0173441 | Ga0395901_0173441_834_1475 | 213 |
| 893 | 3300042137 | Ga0450902_026735 | Ga0450902_026735_99_740 | 213 |
| 894 | 3300042435 | Ga0439434_0016519 | Ga0439434_0016519_47_688 | 213 |
| 895 | 3300042439 | Ga0439464_0047794 | Ga0439464_0047794_262_903 | 213 |
| 896 | 3300048925 | Ga0496122_0001985 | Ga0496122_0001985_7238_7879 | 213 |
| 897 | 3300048926 | Ga0496123_0000108 | Ga0496123_0000108_15487_16128 | 213 |
| 898 | 3300049574 | Ga0501038_0240902 | Ga0501038_0240902_456_1109 | 213 |
| 899 | 3300049822 | Ga0501035_0102509 | Ga0501035_0102509_225_878 | 213 |
| 900 | 3300049823 | Ga0501044_0090000 | Ga0501044_0090000_2237_2890 | 213 |
| 901 | 3300050493 | nmdc:mga0k408_36648_c2 | nmdc:mga0k408_36648_c2_296_949 | 213 |
| 902 | 3300050496 | nmdc:mga07m45_353156_c1 | nmdc:mga07m45_353156_c1_21_683 | 213 |
| 903 | 3300050496 | nmdc:mga07m45_7705_c1 | nmdc:mga07m45_7705_c1_884_1537 | 213 |
| 904 | 3300053161 | Ga0500634_0037520 | Ga0500634_0037520_269_916 | 213 |
| 905 | iso_pu_bacteria | 2643221609 | 2644062740 | 213 |
| 906 | iso_pu_bacteria | 2643221611 | 2644076766 | 213 |
| 907 | iso_pu_bacteria | 2738543012 | 2739244586 | 213 |
| 908 | iso_pu_bacteria | 2816332133 | 2816475210 | 213 |
| 909 | 3300003187 | JGI25151J46595_10056542 | JGI25151J46595_100565422 | 214 |
| 910 | 3300005353 | Ga0070669_100185260 | Ga0070669_1001852602 | 214 |
| 911 | 3300005365 | Ga0070688_100518057 | Ga0070688_1005180571 | 214 |
| 912 | 3300005617 | Ga0068859_100382016 | Ga0068859_1003820162 | 214 |
| 913 | 3300006038 | Ga0075365_10046079 | Ga0075365_100460792 | 214 |
| 914 | 3300006038 | Ga0075365_10101422 | Ga0075365_101014222 | 214 |
| 915 | 3300006042 | Ga0075368_10003959 | Ga0075368_100039595 | 214 |
| 916 | 3300006048 | Ga0075363_100006375 | Ga0075363_1000063755 | 214 |
| 917 | 3300006051 | Ga0075364_10022128 | Ga0075364_100221284 | 214 |
| 918 | 3300006178 | Ga0075367_10071104 | Ga0075367_100711043 | 214 |
| 919 | 3300006195 | Ga0075366_10049031 | Ga0075366_100490312 | 214 |
| 920 | 3300006195 | Ga0075366_10104372 | Ga0075366_101043722 | 214 |
| 921 | 3300006931 | Ga0097620_100382037 | Ga0097620_1003820372 | 214 |
| 922 | 3300009098 | Ga0105245_10236879 | Ga0105245_102368792 | 214 |
| 923 | 3300025291 | Ga0209675_1017338 | Ga0209675_10173382 | 214 |
| 924 | 3300025294 | Ga0209025_1032944 | Ga0209025_10329442 | 214 |
| 925 | 3300025298 | Ga0209050_1005618 | Ga0209050_10056183 | 214 |
| 926 | 3300025923 | Ga0207681_10355541 | Ga0207681_103555412 | 214 |
| 927 | 3300032005 | Ga0307411_10566325 | Ga0307411_105663252 | 214 |
| 928 | 3300045051 | Ga0451576_0280482 | Ga0451576_0280482_594_1238 | 214 |
| 929 | 3300048919 | Ga0496116_0036615 | Ga0496116_0036615_1530_2192 | 214 |
| 930 | 3300048920 | Ga0496117_0137384 | Ga0496117_0137384_496_1158 | 214 |
| 931 | 3300048924 | Ga0496121_0227039 | Ga0496121_0227039_291_953 | 214 |
| 932 | 3300048925 | Ga0496122_0130642 | Ga0496122_0130642_15_677 | 214 |
| 933 | 3300048926 | Ga0496123_0077439 | Ga0496123_0077439_1109_1771 | 214 |
| 934 | 3300048928 | Ga0496125_0083988 | Ga0496125_0083988_684_1346 | 214 |
| 935 | 3300050489 | nmdc:mga03683_12585_c1 | nmdc:mga03683_12585_c1_642_1310 | 214 |
| 936 | 3300050492 | nmdc:mga0yw44_73599_c1 | nmdc:mga0yw44_73599_c1_1280_1948 | 214 |
| 937 | 3300050493 | nmdc:mga0k408_262416_c1 | nmdc:mga0k408_262416_c1_325_999 | 214 |
| 938 | 3300050493 | nmdc:mga0k408_80720_c1 | nmdc:mga0k408_80720_c1_259_927 | 214 |
| 939 | 3300050494 | nmdc:mga06z11_119292_c1 | nmdc:mga06z11_119292_c1_397_1071 | 214 |
| 940 | 3300053121 | Ga0500607_013009 | Ga0500607_013009_214_876 | 214 |
| 941 | iso_pu_bacteria | 2721755523 | 2722884027 | 214 |
| 942 | 3300003187 | JGI25151J46595_10011766 | JGI25151J46595_100117663 | 215 |
| 943 | 3300005330 | Ga0070690_100433523 | Ga0070690_1004335231 | 215 |
| 944 | 3300005334 | Ga0068869_100498911 | Ga0068869_1004989112 | 215 |
| 945 | 3300005338 | Ga0068868_100087945 | Ga0068868_1000879452 | 215 |
| 946 | 3300005338 | Ga0068868_100325397 | Ga0068868_1003253972 | 215 |
| 947 | 3300005563 | Ga0068855_100094764 | Ga0068855_1000947642 | 215 |
| 948 | 3300005563 | Ga0068855_101023342 | Ga0068855_1010233422 | 215 |
| 949 | 3300006353 | Ga0075370_10117330 | Ga0075370_101173302 | 215 |
| 950 | 3300013297 | Ga0157378_10550468 | Ga0157378_105504681 | 215 |
| 951 | 3300014969 | Ga0157376_10002446 | Ga0157376_1000244610 | 215 |
| 952 | 3300017792 | Ga0163161_10010469 | Ga0163161_100104696 | 215 |
| 953 | 3300025294 | Ga0209025_1000088 | Ga0209025_1000088145 | 215 |
| 954 | 3300025942 | Ga0207689_10260474 | Ga0207689_102604742 | 215 |
| 955 | 3300025949 | Ga0207667_10181107 | Ga0207667_101811073 | 215 |
| 956 | 3300026023 | Ga0207677_10005418 | Ga0207677_100054186 | 215 |
| 957 | 3300026023 | Ga0207677_10546724 | Ga0207677_105467242 | 215 |
| 958 | 3300027876 | Ga0209974_10026679 | Ga0209974_100266792 | 215 |
| 959 | 3300031548 | Ga0307408_100000048 | Ga0307408_10000004896 | 215 |
| 960 | 3300031548 | Ga0307408_100112074 | Ga0307408_1001120742 | 215 |
| 961 | 3300031901 | Ga0307406_10000164 | Ga0307406_1000016425 | 215 |
| 962 | 3300032005 | Ga0307411_10210973 | Ga0307411_102109732 | 215 |
| 963 | 3300042876 | Ga0451577_0130548 | Ga0451577_0130548_376_1023 | 215 |
| 964 | 3300042876 | Ga0451577_0219491 | Ga0451577_0219491_121_783 | 215 |
| 965 | 3300044673 | Ga0453683_0004191 | Ga0453683_0004191_998_1645 | 215 |
| 966 | 3300044712 | Ga0453684_0041347 | Ga0453684_0041347_914_1561 | 215 |
| 967 | 3300044712 | Ga0453684_0461575 | Ga0453684_0461575_12_674 | 215 |
| 968 | 3300045051 | Ga0451576_0007413 | Ga0451576_0007413_8105_8752 | 215 |
| 969 | 3300045051 | Ga0451576_0290193 | Ga0451576_0290193_83_745 | 215 |
| 970 | 3300046542 | Ga0495597_0000065 | Ga0495597_0000065_37682_38356 | 215 |
| 971 | iso_pu_bacteria | 2643221683 | 2644468391 | 215 |
| 972 | iso_pu_bacteria | 2738541307 | 2738879582 | 215 |
| 973 | 3300003781 | Ga0055536_1004300 | Ga0055536_10043001 | 216 |
| 974 | 3300003792 | Ga0055540_1001568 | Ga0055540_10015684 | 216 |
| 975 | 3300005548 | Ga0070665_100040895 | Ga0070665_1000408953 | 216 |
| 976 | 3300005563 | Ga0068855_100153746 | Ga0068855_1001537463 | 216 |
| 977 | 3300005578 | Ga0068854_100055556 | Ga0068854_1000555562 | 216 |
| 978 | 3300009093 | Ga0105240_10093187 | Ga0105240_100931874 | 216 |
| 979 | 3300009148 | Ga0105243_10000481 | Ga0105243_1000048117 | 216 |
| 980 | 3300009545 | Ga0105237_10022949 | Ga0105237_100229495 | 216 |
| 981 | 3300010375 | Ga0105239_10399593 | Ga0105239_103995932 | 216 |
| 982 | 3300013100 | Ga0157373_10059627 | Ga0157373_100596272 | 216 |
| 983 | 3300025292 | Ga0209676_1000139 | Ga0209676_100013951 | 216 |
| 984 | 3300025303 | Ga0209051_1000257 | Ga0209051_100025780 | 216 |
| 985 | 3300025304 | Ga0209257_1003620 | Ga0209257_10036208 | 216 |
| 986 | 3300025935 | Ga0207709_10000292 | Ga0207709_100002923 | 216 |
| 987 | 3300025949 | Ga0207667_10140675 | Ga0207667_101406752 | 216 |
| 988 | 3300026121 | Ga0207683_10018267 | Ga0207683_100182676 | 216 |
| 989 | 3300028379 | Ga0268266_10020271 | Ga0268266_100202714 | 216 |
| 990 | 3300031731 | Ga0307405_10001524 | Ga0307405_100015247 | 216 |
| 991 | 3300032005 | Ga0307411_10065958 | Ga0307411_100659583 | 216 |
| 992 | 3300041509 | Ga0451843_1319765 | Ga0451843_1319765_75_731 | 216 |
| 993 | 3300042115 | Ga0450911_000660 | Ga0450911_000660_6425_7105 | 216 |
| 994 | 3300048904 | Ga0496101_0368503 | Ga0496101_0368503_23_691 | 216 |
| 995 | 3300048925 | Ga0496122_0112553 | Ga0496122_0112553_731_1411 | 216 |
| 996 | 3300048927 | Ga0496124_0048959 | Ga0496124_0048959_2659_3330 | 216 |
| 997 | 3300048928 | Ga0496125_0001110 | Ga0496125_0001110_2885_3565 | 216 |
| 998 | 3300048928 | Ga0496125_0003201 | Ga0496125_0003201_18599_19279 | 216 |
| 999 | 3300041486 | Ga0451807_1843106 | Ga0451807_1843106_26_694 | 217 |
| 1000 | 3300048925 | Ga0496122_0040928 | Ga0496122_0040928_511_1206 | 217 |
| 1001 | 3300048926 | Ga0496123_0090733 | Ga0496123_0090733_879_1574 | 217 |
| 1002 | 3300048928 | Ga0496125_0001434 | Ga0496125_0001434_17275_17970 | 217 |
| 1003 | 3300006946 | Ga0079104_1000011 | Ga0079104_1000011186 | 218 |
| 1004 | 3300009092 | Ga0105250_10052315 | Ga0105250_100523152 | 218 |
| 1005 | 3300009148 | Ga0105243_10015811 | Ga0105243_100158114 | 218 |
| 1006 | 3300025711 | Ga0207696_1032993 | Ga0207696_10329932 | 218 |
| 1007 | 3300025935 | Ga0207709_10000074 | Ga0207709_1000007472 | 218 |
| 1008 | 3300027111 | Ga0209281_1000005 | Ga0209281_1000005754 | 218 |
| 1009 | 3300041491 | Ga0451833_1094299 | Ga0451833_1094299_19_705 | 218 |
| 1010 | 3300046453 | Ga0495627_004409 | Ga0495627_004409_2238_2921 | 219 |
| 1011 | 3300005467 | Ga0070706_100431629 | Ga0070706_1004316292 | 225 |
| 1012 | 3300005468 | Ga0070707_100356958 | Ga0070707_1003569581 | 225 |
| 1013 | 3300025294 | Ga0209025_1027766 | Ga0209025_10277664 | 225 |
| 1014 | 3300025910 | Ga0207684_10328499 | Ga0207684_103284992 | 225 |
| 1015 | 3300031456 | Ga0307513_10000019 | Ga0307513_10000019116 | 226 |
| 1016 | 3300031730 | Ga0307516_10009467 | Ga0307516_100094672 | 226 |
| 1017 | 3300031824 | Ga0307413_10225930 | Ga0307413_102259302 | 226 |
| 1018 | iso_pu_bacteria | 2511231002 | 2511247001 | 226 |
| 1019 | 3300006058 | Ga0075432_10020439 | Ga0075432_100204393 | 229 |
| 1020 | 3300006946 | Ga0079104_1016024 | Ga0079104_10160243 | 229 |
| 1021 | 3300027907 | Ga0207428_10193228 | Ga0207428_101932282 | 229 |
| 1022 | 3300053093 | Ga0500651_0008417 | Ga0500651_0008417_3424_4113 | 229 |
| 1023 | 3300002987 | JGI25159J45721_1003535 | JGI25159J45721_10035356 | 230 |
| 1024 | 3300003187 | JGI25151J46595_10038775 | JGI25151J46595_100387752 | 230 |
| 1025 | 3300003771 | Ga0055526_1002303 | Ga0055526_100230311 | 230 |
| 1026 | 3300003773 | Ga0055537_1000043 | Ga0055537_100004328 | 230 |
| 1027 | 3300003775 | Ga0055524_1000012 | Ga0055524_1000012141 | 230 |
| 1028 | 3300003784 | Ga0055534_1005797 | Ga0055534_10057972 | 230 |
| 1029 | 3300003790 | Ga0055528_1000647 | Ga0055528_100064715 | 230 |
| 1030 | 3300003791 | Ga0055530_10000015 | Ga0055530_10000015100 | 230 |
| 1031 | 3300003792 | Ga0055540_1000039 | Ga0055540_100003942 | 230 |
| 1032 | 3300003794 | Ga0055531_10007067 | Ga0055531_100070675 | 230 |
| 1033 | 3300003794 | Ga0055531_10008849 | Ga0055531_100088492 | 230 |
| 1034 | 3300005262 | Ga0065165_1035867 | Ga0065165_10358672 | 230 |
| 1035 | 3300025245 | Ga0207425_1000861 | Ga0207425_10008618 | 230 |
| 1036 | 3300025258 | Ga0209129_1021579 | Ga0209129_10215792 | 230 |
| 1037 | 3300025263 | Ga0209565_1000004 | Ga0209565_1000004494 | 230 |
| 1038 | 3300025273 | Ga0209673_1000357 | Ga0209673_100035754 | 230 |
| 1039 | 3300025284 | Ga0209130_1000082 | Ga0209130_100008224 | 230 |
| 1040 | 3300025291 | Ga0209675_1000061 | Ga0209675_100006194 | 230 |
| 1041 | 3300025292 | Ga0209676_1000029 | Ga0209676_1000029409 | 230 |
| 1042 | 3300025294 | Ga0209025_1003318 | Ga0209025_10033182 | 230 |
| 1043 | 3300025295 | Ga0209564_1000969 | Ga0209564_100096911 | 230 |
| 1044 | 3300025298 | Ga0209050_1000003 | Ga0209050_1000003471 | 230 |
| 1045 | 3300025298 | Ga0209050_1030793 | Ga0209050_10307932 | 230 |
| 1046 | 3300025299 | Ga0209256_1000001 | Ga0209256_1000001473 | 230 |
| 1047 | 3300025302 | Ga0207426_1004459 | Ga0207426_10044593 | 230 |
| 1048 | 3300025303 | Ga0209051_1000003 | Ga0209051_1000003471 | 230 |
| 1049 | 3300025304 | Ga0209257_1000018 | Ga0209257_1000018471 | 230 |
| 1050 | 3300053094 | Ga0500566_0190057 | Ga0500566_0190057_181_876 | 230 |
| 1051 | 3300053103 | Ga0500555_083218 | Ga0500555_083218_121_813 | 230 |
| 1052 | 3300053117 | Ga0500593_001074 | Ga0500593_001074_1316_2008 | 230 |
| 1053 | 3300053129 | Ga0500628_002038 | Ga0500628_002038_1734_2426 | 230 |
| 1054 | 3300053730 | Ga0500645_000155 | Ga0500645_000155_16713_17405 | 230 |
| 1055 | 3300053730 | Ga0500645_028446 | Ga0500645_028446_750_1442 | 230 |
| 1056 | 3300002704 | JGI25155J39150_1000036 | JGI25155J39150_100003685 | 231 |
| 1057 | 3300002705 | JGI25156J39149_1000047 | JGI25156J39149_10000473 | 231 |
| 1058 | 3300002738 | JGI25154J39366_1000068 | JGI25154J39366_10000683 | 231 |
| 1059 | 3300002741 | JGI25157J39369_1000066 | JGI25157J39369_10000663 | 231 |
| 1060 | 3300002774 | JGI25150J39212_1012834 | JGI25150J39212_10128341 | 231 |
| 1061 | 3300002987 | JGI25159J45721_1001201 | JGI25159J45721_100120111 | 231 |
| 1062 | 3300003187 | JGI25151J46595_10010059 | JGI25151J46595_100100591 | 231 |
| 1063 | 3300003187 | JGI25151J46595_10019969 | JGI25151J46595_100199693 | 231 |
| 1064 | 3300003354 | JGI25160J50197_1000145 | JGI25160J50197_100014545 | 231 |
| 1065 | 3300003374 | JGI25161J50226_1000032 | JGI25161J50226_1000032128 | 231 |
| 1066 | 3300003374 | JGI25161J50226_1000064 | JGI25161J50226_100006437 | 231 |
| 1067 | 3300003771 | Ga0055526_1031591 | Ga0055526_10315913 | 231 |
| 1068 | 3300003771 | Ga0055526_1038852 | Ga0055526_10388522 | 231 |
| 1069 | 3300004625 | Ga0055543_1003819 | Ga0055543_10038192 | 231 |
| 1070 | 3300005262 | Ga0065165_1005649 | Ga0065165_10056492 | 231 |
| 1071 | 3300005262 | Ga0065165_1006329 | Ga0065165_10063292 | 231 |
| 1072 | 3300006353 | Ga0075370_10435859 | Ga0075370_104358591 | 231 |
| 1073 | 3300025206 | Ga0209435_100001 | Ga0209435_100001717 | 231 |
| 1074 | 3300025245 | Ga0207425_1002867 | Ga0207425_10028676 | 231 |
| 1075 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000011086 | 231 |
| 1076 | 3300025250 | Ga0209026_1000003 | Ga0209026_1000003717 | 231 |
| 1077 | 3300025256 | Ga0209759_1000001 | Ga0209759_1000001717 | 231 |
| 1078 | 3300025263 | Ga0209565_1000407 | Ga0209565_100040718 | 231 |
| 1079 | 3300025284 | Ga0209130_1000094 | Ga0209130_100009476 | 231 |
| 1080 | 3300025294 | Ga0209025_1001422 | Ga0209025_100142223 | 231 |
| 1081 | 3300025295 | Ga0209564_1001231 | Ga0209564_100123119 | 231 |
| 1082 | 3300025297 | Ga0209758_1037697 | Ga0209758_10376972 | 231 |
| 1083 | 3300025298 | Ga0209050_1003639 | Ga0209050_10036395 | 231 |
| 1084 | 3300025299 | Ga0209256_1029187 | Ga0209256_10291872 | 231 |
| 1085 | 3300025302 | Ga0207426_1000025 | Ga0207426_1000025483 | 231 |
| 1086 | 3300031456 | Ga0307513_10000051 | Ga0307513_1000005123 | 231 |
| 1087 | 3300031548 | Ga0307408_100006460 | Ga0307408_1000064604 | 231 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hjn-assembly1.cif.gz_B | crystal structure of thymidylate kinase in complex with dtdp and adp from thermotoga maritima | 0.9553 | 10 | 222 |
| 3uwo-assembly3.cif.gz_A | structure guided development of novel thymidine mimetics targeting pseudomonas aeruginosa thymidylate kinase: from hit to lead generation | 0.9534 | 10 | 227 |
| 3uwk-assembly3.cif.gz_A | structure guided development of novel thymidine mimetics targeting pseudomonas aeruginosa thymidylate kinase: from hit to lead generation | 0.9512 | 10 | 227 |
| 4e5u-assembly1.cif.gz_A | the crystal structure of thymidylate kinase from pseudomonas aeruginosa pao1 in complex with thymidine monophosphate. | 0.9482 | 9 | 227 |
| 4gmd-assembly2.cif.gz_B | the crystal structure of thymidylate kinase from pseudomonas aeruginosa pao1 in complex with azt monophosphate | 0.9477 | 9 | 227 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2z0hB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9456 | 11 | 222 | 3.40.50.300 |
| 3uwoB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9391 | 10 | 227 | 3.40.50.300 |
| 2z0hB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9352 | 11 | 222 | 3.40.50.300 |
| 5x7jB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9349 | 9 | 227 | 3.40.50.300 |
| 3lv8A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9234 | 9 | 227 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S5R3B2-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.9833 | 9 | 226 |
GO:0004798
GO:0005524 GO:0005829 GO:0006227 GO:0006233 GO:0006235 |
| AF-A0A5C6Z5B3-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.9811 | 9 | 199 |
GO:0004798
GO:0005524 GO:0005829 GO:0006227 GO:0006233 GO:0006235 |
| AF-A0A3S2U673-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.981 | 9 | 228 |
GO:0004798
GO:0005524 GO:0005829 GO:0006227 GO:0006233 GO:0006235 |
| AF-A0A5C7NYF5-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.9809 | 8 | 226 |
GO:0004798
GO:0005524 GO:0005829 GO:0006227 GO:0006233 GO:0006235 |
| AF-A0A3D0W5B2-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.9787 | 9 | 227 |
GO:0004798
GO:0005524 GO:0005829 GO:0006227 GO:0006233 GO:0006235 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar