F489800

General Info

Members Datasets Scaffolds Average Seq Length
1087 453 1031 212

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10435859|Ga0075370_104358591
Length 232
Sequence MHSKPHPMHGLFISFEGIDGAGKSTHIAGLADAFKAEGRVVTLTREPGGTPLAEKLRAMVLNDAMDPLTEALLIFAARRDHIVNVIAPALLRGEVVLCDRFTDATFAYQGAGRGFDLKLLATLEQWVQSDEGLLGDPAGNTPMKPGVETVIEPHLTVWFDLAPEEAALRLAGARVPDKFEAQPLEFFRRVAQGYADRQKNHPERFARIDAAKSRDEVWQAVRQVFMAKGWLP

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
6 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
7 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
8 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
9 2643221570 Acidovorax sp. Root568 Isolate Unclassified
10 2643221596 Acidovorax sp. Root70 Isolate Unclassified
11 2643221609 Acidovorax sp. Root217 Isolate Unclassified
12 2643221611 Acidovorax sp. Root219 Isolate Unclassified
13 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
14 2643221652 Acidovorax sp. Root402 Isolate Unclassified
15 2643221658 Variovorax sp. Root411 Isolate Unclassified
16 2643221672 Variovorax sp. Root434 Isolate Unclassified
17 2643221683 Variovorax sp. Root473 Isolate Unclassified
18 2643221717 Acidovorax sp. Root267 Isolate Unclassified
19 2721755523 Delftia sp. HK171 Isolate Unclassified
20 2738541277 Variovorax sp. GV051 Isolate Unclassified
21 2738541307 Variovorax sp. GV008 Isolate Unclassified
22 2738543012 Acidovorax sp. CF301 Isolate Unclassified
23 2738543019 Variovorax sp. GV040 Isolate Unclassified
24 2816332133 Acidovorax radicis 2721A Isolate Unclassified
25 2818991446 Variovorax sp. 1180 Isolate Unclassified
26 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
27 2831864461 Roseateles noduli HZ7 Isolate Nodule
28 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
29 2842677519 Variovorax sp. R-72495 Isolate Unclassified
30 2842733646 Variovorax sp. R-72446 Isolate Unclassified
31 2842747753 Variovorax sp. R-72060 Isolate Unclassified
32 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
33 2885198086 Variovorax sp. 679 Isolate Unclassified
34 2885211737 Variovorax sp. 553 Isolate Unclassified
35 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
36 2899924645 Variovorax sp. 369 Isolate Unclassified
37 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
38 2904456579 Variovorax sp. 2002 Isolate Unclassified
39 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
40 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
41 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
42 2928037797 Variovorax sp. 1126 Isolate Unclassified
43 2928044640 Variovorax sp. 1128 Isolate Unclassified
44 2928051484 Variovorax sp. 1133 Isolate Unclassified
45 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
46 2928070936 Variovorax gossypii 1167 Isolate Unclassified
47 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
48 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
49 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
50 2929520902 Variovorax beijingensis 502 Isolate Unclassified
51 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
52 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
53 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
54 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
55 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
56 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
57 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
58 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
59 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
60 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
61 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
62 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
63 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
64 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
65 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
66 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
67 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
68 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
69 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
70 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
71 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
72 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
73 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
74 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
75 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
76 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
77 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
78 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
79 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
80 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
81 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
82 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
83 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
84 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
85 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
86 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
87 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
88 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
89 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
90 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
91 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
92 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
93 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
94 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
95 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
96 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
97 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
98 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
99 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
100 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
101 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
102 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
103 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
104 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
105 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
106 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
107 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
108 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
109 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
110 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
111 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
112 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
113 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
114 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
115 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
116 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
117 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
118 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
119 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
120 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
121 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
122 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
123 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
124 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
125 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
126 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
127 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
128 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
129 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
130 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
131 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
132 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
133 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
134 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
135 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
136 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
137 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
138 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
139 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
140 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
141 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
142 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
143 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
144 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
145 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
146 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
147 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
148 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
149 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
150 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
151 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
152 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
153 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
154 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
155 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
156 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
157 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
158 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
159 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
160 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
161 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
162 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
163 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
164 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
165 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
166 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
167 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
168 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
169 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
170 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
171 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
172 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
173 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
174 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
175 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
176 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
177 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
178 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
179 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
180 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
181 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
182 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
183 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
184 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
185 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
186 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
187 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
191 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
192 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
193 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
195 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
196 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
199 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
202 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
204 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
207 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
264 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
266 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
267 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
269 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
273 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
274 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
275 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
276 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
277 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
278 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
279 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
280 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
281 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
282 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
283 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
284 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
285 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
286 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
287 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
288 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
289 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
290 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
291 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
292 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
293 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
294 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
295 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
296 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
297 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
298 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
299 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
300 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
301 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
302 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
303 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
304 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
305 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
306 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
307 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
308 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
309 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
310 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
311 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
312 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
313 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
314 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
315 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
316 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
317 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
318 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
319 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
320 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
321 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
322 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
323 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
324 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
325 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
326 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
327 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
328 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
329 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
330 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
331 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
332 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
333 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
334 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
335 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
336 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
337 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
338 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
339 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
340 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
341 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
342 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
343 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
344 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
345 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
346 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
347 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
348 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
349 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
350 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
351 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
352 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
353 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
354 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
355 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
356 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
357 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
358 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
359 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
360 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
361 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
362 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
363 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
364 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
365 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
366 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
367 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
368 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
369 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
370 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
371 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
372 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
373 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
374 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
375 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
376 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
377 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
378 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
379 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
380 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
381 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
382 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
383 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
384 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
385 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
386 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
387 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
388 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
389 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
390 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
391 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
392 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
393 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
394 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
395 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
396 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
397 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
398 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
399 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
400 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
401 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
402 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
403 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
404 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
405 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
406 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
407 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
408 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
409 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
410 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
411 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
412 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
416 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
418 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
419 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
420 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
421 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
422 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
423 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
424 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
425 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
426 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
427 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
428 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
429 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
430 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
431 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
432 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
433 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
434 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
435 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
436 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
437 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
438 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
439 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
440 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
441 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
442 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
443 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
444 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
445 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
446 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
447 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
448 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
449 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
450 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
451 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
452 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
453 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.85
Metatranscriptomes 0
Isolates 5.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.83
Nodule 1.1
Rhizoplane 2.85
Rhizosphere 61.18
Stem 0
Stem Tuber 0
Unclassified 11.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000036 3300002704 Bacteria 97790
2 JGI25156J39149_1000047 3300002705 Bacteria 97697
3 JGI25154J39366_1000068 3300002738 Bacteria 97697
4 JGI25157J39369_1000066 3300002741 Bacteria 97697
5 JGI25150J39212_1000384 3300002774 Bacteria 21069
6 JGI25150J39212_1012834 3300002774 Bacteria 1469
7 JGI25159J45721_1000103 3300002987 Bacteria 40372
8 JGI25159J45721_1001201 3300002987 Bacteria 11034
9 JGI25159J45721_1003535 3300002987 Bacteria 5500
10 JGI25159J45721_1004784 3300002987 Bacteria 4379
11 JGI25151J46595_10001581 3300003187 Bacteria 15162
12 JGI25151J46595_10010059 3300003187 Bacteria 4430
13 JGI25151J46595_10011766 3300003187 Bacteria 4009
14 JGI25151J46595_10015382 3300003187 Bacteria 3374
15 JGI25151J46595_10019969 3300003187 Bacteria 2833
16 JGI25151J46595_10038775 3300003187 Bacteria 1768
17 JGI25151J46595_10056542 3300003187 Bacteria 1286
18 JGI25153J46596_10013918 3300003215 Bacteria 3374
19 rootH2_10003527 3300003320 Bacteria 15338
20 rootH2_10072340 3300003320 Bacteria 1443
21 rootL2_10001454 3300003322 Bacteria 27837
22 rootH1_10003240 3300003323 Bacteria 16991
23 rootH1_10074149 3300003323 Bacteria 2400
24 JGI25160J50197_1000145 3300003354 Bacteria 63479
25 JGI25160J50197_1000255 3300003354 Bacteria 40372
26 JGI25160J50197_1006714 3300003354 Bacteria 4620
27 JGI25161J50226_1000032 3300003374 Bacteria 138440
28 JGI25161J50226_1000064 3300003374 Bacteria 99448
29 JGI25161J50226_1000393 3300003374 Bacteria 21899
30 JGI25161J50226_1004942 3300003374 Bacteria 2699
31 Ga0055535_1000305 3300003761 Bacteria 49948
32 Ga0055542_1000021 3300003762 Bacteria 331499
33 Ga0055526_1001415 3300003771 Bacteria 17076
34 Ga0055526_1002303 3300003771 Bacteria 13026
35 Ga0055526_1013837 3300003771 Bacteria 3374
36 Ga0055526_1031591 3300003771 Bacteria 1514
37 Ga0055526_1038852 3300003771 Bacteria 1220
38 Ga0055537_1000036 3300003773 Bacteria 96045
39 Ga0055537_1000043 3300003773 Bacteria 90816
40 Ga0055537_1003375 3300003773 Bacteria 4931
41 Ga0055524_1000012 3300003775 Bacteria 260384
42 Ga0055524_1000583 3300003775 Bacteria 26605
43 Ga0055524_1000632 3300003775 Bacteria 25061
44 Ga0055524_1005356 3300003775 Bacteria 5746
45 Ga0055524_1011877 3300003775 Bacteria 3374
46 Ga0055524_1011918 3300003775 Bacteria 3366
47 Ga0055536_1000396 3300003781 Bacteria 31602
48 Ga0055536_1002959 3300003781 Bacteria 9315
49 Ga0055536_1004300 3300003781 Bacteria 7333
50 Ga0055536_1012104 3300003781 Bacteria 3235
51 Ga0055534_1000018 3300003784 Bacteria 138136
52 Ga0055534_1002944 3300003784 Bacteria 5644
53 Ga0055534_1005504 3300003784 Bacteria 3374
54 Ga0055534_1005797 3300003784 Bacteria 3233
55 Ga0055528_1000647 3300003790 Bacteria 25459
56 Ga0055528_1000903 3300003790 Bacteria 20020
57 Ga0055528_1007234 3300003790 Bacteria 4931
58 Ga0055530_10000015 3300003791 Bacteria 148790
59 Ga0055530_10000086 3300003791 Bacteria 80109
60 Ga0055530_10000991 3300003791 Bacteria 22764
61 Ga0055540_1000039 3300003792 Bacteria 161844
62 Ga0055540_1000405 3300003792 Bacteria 34908
63 Ga0055540_1001568 3300003792 Bacteria 13345
64 Ga0055540_1004907 3300003792 Bacteria 5838
65 Ga0055540_1009436 3300003792 Bacteria 3371
66 Ga0055531_10000515 3300003794 Bacteria 34908
67 Ga0055531_10001279 3300003794 Bacteria 18961
68 Ga0055531_10007067 3300003794 Bacteria 6208
69 Ga0055531_10008849 3300003794 Bacteria 5233
70 Ga0055531_10015372 3300003794 Bacteria 3377
71 Ga0055531_10015402 3300003794 Bacteria 3371
72 Ga0055531_10019645 3300003794 Bacteria 2718
73 Ga0055543_1000262 3300004625 Bacteria 39412
74 Ga0055543_1003819 3300004625 Bacteria 4279
75 Ga0055543_1004354 3300004625 Bacteria 3885
76 Ga0055543_1005364 3300004625 Bacteria 3283
77 Ga0065165_1000024 3300005262 Bacteria 247672
78 Ga0065165_1000494 3300005262 Bacteria 60929
79 Ga0065165_1005649 3300005262 Bacteria 6915
80 Ga0065165_1006329 3300005262 Bacteria 6254
81 Ga0065165_1035867 3300005262 Bacteria 1518
82 Ga0065714_10097146 3300005288 Bacteria 1743
83 Ga0070658_10020838 3300005327 Bacteria 5253
84 Ga0070658_10070127 3300005327 Bacteria 2869
85 Ga0070658_10153359 3300005327 Bacteria 1930
86 Ga0070676_10032497 3300005328 Bacteria 2990
87 Ga0070676_10094772 3300005328 Bacteria 1835
88 Ga0070676_10458262 3300005328 Bacteria 898
89 Ga0070690_100008484 3300005330 Bacteria 5921
90 Ga0070690_100015438 3300005330 Bacteria 4555
91 Ga0070690_100433523 3300005330 Bacteria 971
92 Ga0070690_100701688 3300005330 Bacteria 777
93 Ga0070670_100016508 3300005331 Bacteria 6338
94 Ga0070670_100031821 3300005331 Bacteria 4543
95 Ga0070670_100031847 3300005331 Bacteria 4541
96 Ga0070670_100138098 3300005331 Bacteria 2107
97 Ga0070670_100239530 3300005331 Bacteria 1579
98 Ga0070670_100320268 3300005331 Bacteria 1358
99 Ga0070677_10005552 3300005333 Bacteria 4160
100 Ga0070677_10034580 3300005333 Bacteria 1953
101 Ga0070677_10314110 3300005333 Bacteria 800
102 Ga0068869_100010437 3300005334 Bacteria 6059
103 Ga0068869_100021031 3300005334 Bacteria 4485
104 Ga0068869_100498911 3300005334 Bacteria 1016
105 Ga0070666_10004785 3300005335 Bacteria 8276
106 Ga0070666_10042499 3300005335 Bacteria 3042
107 Ga0070666_10066977 3300005335 Bacteria 2438
108 Ga0070666_10139135 3300005335 Bacteria 1690
109 Ga0068868_100011186 3300005338 Bacteria 6534
110 Ga0068868_100019427 3300005338 Bacteria 5091
111 Ga0068868_100021348 3300005338 Bacteria 4876
112 Ga0068868_100087945 3300005338 Bacteria 2500
113 Ga0068868_100194380 3300005338 Bacteria 1688
114 Ga0068868_100325397 3300005338 Bacteria 1310
115 Ga0068868_101046668 3300005338 Bacteria 749
116 Ga0070660_100018204 3300005339 Bacteria 5129
117 Ga0070660_100074568 3300005339 Bacteria 2655
118 Ga0070689_100033724 3300005340 Bacteria 3903
119 Ga0070691_10063677 3300005341 Bacteria 1778
120 Ga0070687_100048247 3300005343 Bacteria 2189
121 Ga0070661_100054069 3300005344 Bacteria 2941
122 Ga0070661_100122320 3300005344 Bacteria 1950
123 Ga0070661_100287573 3300005344 Bacteria 1277
124 Ga0070661_100526676 3300005344 Bacteria 948
125 Ga0070668_100001397 3300005347 Bacteria 17353
126 Ga0070668_100050633 3300005347 Bacteria 3198
127 Ga0070669_100045955 3300005353 Bacteria 3183
128 Ga0070669_100093615 3300005353 Bacteria 2257
129 Ga0070669_100157673 3300005353 Bacteria 1761
130 Ga0070669_100177198 3300005353 Bacteria 1666
131 Ga0070669_100185260 3300005353 Bacteria 1631
132 Ga0070675_100001074 3300005354 Bacteria 19712
133 Ga0070675_100036414 3300005354 Bacteria 4004
134 Ga0070675_100040906 3300005354 Bacteria 3786
135 Ga0070675_100065666 3300005354 Bacteria 3000
136 Ga0070675_100104680 3300005354 Bacteria 2387
137 Ga0070675_100124967 3300005354 Bacteria 2188
138 Ga0070675_100512785 3300005354 Bacteria 1081
139 Ga0070671_100008753 3300005355 Bacteria 8120
140 Ga0070671_100012181 3300005355 Bacteria 6921
141 Ga0070671_100016332 3300005355 Bacteria 6003
142 Ga0070671_100129532 3300005355 Bacteria 2125
143 Ga0070671_100176614 3300005355 Bacteria 1807
144 Ga0070671_100317007 3300005355 Bacteria 1328
145 Ga0070674_100010482 3300005356 Bacteria 5606
146 Ga0070674_100020727 3300005356 Bacteria 4207
147 Ga0070674_100104530 3300005356 Bacteria 2069
148 Ga0070674_100278944 3300005356 Bacteria 1324
149 Ga0070674_100646059 3300005356 Bacteria 899
150 Ga0070674_100912887 3300005356 Bacteria 766
151 Ga0070673_100003123 3300005364 Bacteria 10258
152 Ga0070673_100038766 3300005364 Bacteria 3641
153 Ga0070673_100276447 3300005364 Bacteria 1471
154 Ga0070673_100595761 3300005364 Bacteria 1008
155 Ga0070688_100029186 3300005365 Bacteria 3301
156 Ga0070688_100318854 3300005365 Bacteria 1129
157 Ga0070688_100360287 3300005365 Bacteria 1067
158 Ga0070688_100518057 3300005365 Bacteria 902
159 Ga0070659_100012819 3300005366 Bacteria 6225
160 Ga0070667_100002896 3300005367 Bacteria 14740
161 Ga0070667_100128762 3300005367 Bacteria 2208
162 Ga0070667_100531451 3300005367 Bacteria 1080
163 Ga0070667_100789883 3300005367 Bacteria 881
164 Ga0070667_100802064 3300005367 Bacteria 874
165 Ga0070714_100098982 3300005435 Bacteria 2566
166 Ga0070701_10233997 3300005438 Bacteria 1102
167 Ga0070663_100403733 3300005455 Bacteria 1118
168 Ga0070663_100447059 3300005455 Bacteria 1064
169 Ga0070678_100005243 3300005456 Bacteria 7462
170 Ga0070678_100051960 3300005456 Bacteria 2973
171 Ga0070678_100137458 3300005456 Bacteria 1951
172 Ga0070678_100457609 3300005456 Bacteria 1119
173 Ga0070678_100498604 3300005456 Bacteria 1074
174 Ga0070678_100545753 3300005456 Bacteria 1028
175 Ga0070678_100731769 3300005456 Bacteria 893
176 Ga0070662_100004781 3300005457 Bacteria 8578
177 Ga0070662_100024236 3300005457 Bacteria 4178
178 Ga0070662_100139249 3300005457 Bacteria 1879
179 Ga0070662_100440965 3300005457 Bacteria 1079
180 Ga0068867_100001670 3300005459 Bacteria 15459
181 Ga0068867_100013320 3300005459 Bacteria 5826
182 Ga0068867_100027719 3300005459 Bacteria 4074
183 Ga0068867_100050623 3300005459 Bacteria 3062
184 Ga0068867_100119176 3300005459 Bacteria 2037
185 Ga0068867_100199674 3300005459 Bacteria 1600
186 Ga0068867_100440708 3300005459 Bacteria 1107
187 Ga0070706_100000388 3300005467 Bacteria 52771
188 Ga0070706_100431629 3300005467 Bacteria 1226
189 Ga0070707_100356958 3300005468 Bacteria 1420
190 Ga0070679_100031430 3300005530 Bacteria 5244
191 Ga0068853_100018345 3300005539 Bacteria 5790
192 Ga0068853_100020855 3300005539 Bacteria 5451
193 Ga0068853_100555627 3300005539 Bacteria 1088
194 Ga0068853_100561748 3300005539 Bacteria 1082
195 Ga0070672_100012480 3300005543 Bacteria 5967
196 Ga0070672_100019005 3300005543 Bacteria 4980
197 Ga0070672_100033357 3300005543 Bacteria 3898
198 Ga0070672_100050430 3300005543 Bacteria 3241
199 Ga0070672_100102564 3300005543 Bacteria 2322
200 Ga0070672_100503673 3300005543 Bacteria 1048
201 Ga0070686_100133155 3300005544 Bacteria 1721
202 Ga0070686_100740068 3300005544 Bacteria 788
203 Ga0070665_100040895 3300005548 Bacteria 4658
204 Ga0068855_100009342 3300005563 Bacteria 11841
205 Ga0068855_100094764 3300005563 Bacteria 3442
206 Ga0068855_100153746 3300005563 Bacteria 2615
207 Ga0068855_101023342 3300005563 Bacteria 867
208 Ga0068855_101050171 3300005563 Bacteria 854
209 Ga0070664_100165367 3300005564 Bacteria 1960
210 Ga0070664_100211415 3300005564 Bacteria 1733
211 Ga0070664_100229315 3300005564 Bacteria 1664
212 Ga0070664_100240264 3300005564 Bacteria 1626
213 Ga0070664_100426239 3300005564 Bacteria 1216
214 Ga0070664_100561621 3300005564 Bacteria 1056
215 Ga0068857_100112387 3300005577 Bacteria 2449
216 Ga0068857_100228885 3300005577 Bacteria 1700
217 Ga0068857_100298797 3300005577 Bacteria 1484
218 Ga0068854_100055556 3300005578 Bacteria 2851
219 Ga0068854_100075713 3300005578 Bacteria 2472
220 Ga0068854_100206316 3300005578 Bacteria 1548
221 Ga0068856_100007479 3300005614 Bacteria 10663
222 Ga0068856_100088244 3300005614 Bacteria 3084
223 Ga0068856_100400526 3300005614 Bacteria 1392
224 Ga0068856_100527512 3300005614 Bacteria 1202
225 Ga0070702_100038663 3300005615 Bacteria 2659
226 Ga0068852_100002342 3300005616 Bacteria 13038
227 Ga0068852_100013873 3300005616 Bacteria 6180
228 Ga0068852_100021650 3300005616 Bacteria 5139
229 Ga0068852_100188255 3300005616 Bacteria 1945
230 Ga0068852_101365473 3300005616 Bacteria 730
231 Ga0068859_100008331 3300005617 Bacteria 10506
232 Ga0068859_100382016 3300005617 Bacteria 1504
233 Ga0068864_100005602 3300005618 Bacteria 10295
234 Ga0068864_100538190 3300005618 Bacteria 1128
235 Ga0068866_10006058 3300005718 Bacteria 5033
236 Ga0068861_100004282 3300005719 Bacteria 9569
237 Ga0068861_100035769 3300005719 Bacteria 3681
238 Ga0068861_100476271 3300005719 Bacteria 1124
239 Ga0068851_10007641 3300005834 Bacteria 4972
240 Ga0068851_10137676 3300005834 Bacteria 1325
241 Ga0068870_10059449 3300005840 Bacteria 2049
242 Ga0068870_10075153 3300005840 Bacteria 1853
243 Ga0068870_10173291 3300005840 Bacteria 1289
244 Ga0068870_10465951 3300005840 Bacteria 836
245 Ga0068863_100011592 3300005841 Bacteria 8530
246 Ga0068863_100033604 3300005841 Bacteria 4886
247 Ga0068863_100047596 3300005841 Bacteria 4067
248 Ga0068863_100155102 3300005841 Bacteria 2192
249 Ga0068863_100162171 3300005841 Bacteria 2142
250 Ga0068863_100211047 3300005841 Bacteria 1870
251 Ga0068863_100538207 3300005841 Bacteria 1152
252 Ga0068863_100654907 3300005841 Bacteria 1042
253 Ga0068858_100002455 3300005842 Bacteria 18716
254 Ga0068858_100006422 3300005842 Bacteria 11450
255 Ga0068858_100046142 3300005842 Bacteria 4040
256 Ga0068858_100047409 3300005842 Bacteria 3983
257 Ga0068858_100783692 3300005842 Bacteria 930
258 Ga0068860_100020361 3300005843 Bacteria 6426
259 Ga0068860_100038019 3300005843 Bacteria 4606
260 Ga0068860_100065038 3300005843 Bacteria 3464
261 Ga0068862_100064391 3300005844 Bacteria 3156
262 Ga0068862_100087607 3300005844 Bacteria 2708
263 Ga0068862_100153731 3300005844 Bacteria 2049
264 Ga0068862_101175313 3300005844 Bacteria 765
265 Ga0075365_10046079 3300006038 Bacteria 2862
266 Ga0075365_10101422 3300006038 Bacteria 1971
267 Ga0075368_10003959 3300006042 Bacteria 4989
268 Ga0075368_10061326 3300006042 Bacteria 1506
269 Ga0075368_10109924 3300006042 Bacteria 1136
270 Ga0075363_100006375 3300006048 Bacteria 5348
271 Ga0075363_100027660 3300006048 Bacteria 2909
272 Ga0075363_100031855 3300006048 Bacteria 2735
273 Ga0075363_100069601 3300006048 Bacteria 1909
274 Ga0075364_10022128 3300006051 Bacteria 4012
275 Ga0075364_10318497 3300006051 Bacteria 1059
276 Ga0075364_10403967 3300006051 Bacteria 932
277 Ga0075432_10020439 3300006058 Bacteria 2264
278 Ga0075362_10014387 3300006177 Bacteria 3192
279 Ga0075362_10032725 3300006177 Bacteria 2258
280 Ga0075362_10080360 3300006177 Bacteria 1502
281 Ga0075362_10089147 3300006177 Bacteria 1430
282 Ga0075367_10071104 3300006178 Bacteria 2093
283 Ga0075367_10071974 3300006178 Bacteria 2080
284 Ga0075366_10030192 3300006195 Bacteria 3186
285 Ga0075366_10030863 3300006195 Bacteria 3152
286 Ga0075366_10049031 3300006195 Bacteria 2505
287 Ga0075366_10061793 3300006195 Bacteria 2227
288 Ga0075366_10104372 3300006195 Bacteria 1703
289 Ga0075366_10180051 3300006195 Bacteria 1284
290 Ga0097621_100150780 3300006237 Bacteria 1994
291 Ga0075370_10006928 3300006353 Bacteria 5741
292 Ga0075370_10012797 3300006353 Bacteria 4443
293 Ga0075370_10050158 3300006353 Bacteria 2367
294 Ga0075370_10066053 3300006353 Bacteria 2063
295 Ga0075370_10074619 3300006353 Bacteria 1944
296 Ga0075370_10117330 3300006353 Bacteria 1548
297 Ga0075370_10242268 3300006353 Bacteria 1068
298 Ga0075370_10273630 3300006353 Bacteria 1002
299 Ga0075370_10283321 3300006353 Bacteria 984
300 Ga0075370_10435859 3300006353 Bacteria 788
301 Ga0068871_100008050 3300006358 Bacteria 7566
302 Ga0068871_100069971 3300006358 Bacteria 2883
303 Ga0068871_100201166 3300006358 Bacteria 1720
304 Ga0068871_100241436 3300006358 Bacteria 1571
305 Ga0075434_100427884 3300006871 Bacteria 1345
306 Ga0068865_100015377 3300006881 Bacteria 4880
307 Ga0068865_100038189 3300006881 Bacteria 3248
308 Ga0068865_100235311 3300006881 Bacteria 1439
309 Ga0068865_100313365 3300006881 Bacteria 1260
310 Ga0097620_100008331 3300006931 Bacteria 10506
311 Ga0097620_100382037 3300006931 Bacteria 1504
312 Ga0099823_1003766 3300006944 Bacteria 14557
313 Ga0079104_1000011 3300006946 Bacteria 359962
314 Ga0079104_1016024 3300006946 Bacteria 2203
315 Ga0099826_10003330 3300006948 Bacteria 10855
316 Ga0099826_10072148 3300006948 Bacteria 2187
317 Ga0099826_10275303 3300006948 Bacteria 873
318 Ga0075435_100118395 3300007076 Bacteria 2208
319 Ga0105244_10006079 3300009036 Bacteria 7894
320 Ga0105250_10052315 3300009092 Bacteria 1638
321 Ga0105240_10017248 3300009093 Bacteria 9739
322 Ga0105240_10093187 3300009093 Bacteria 3677
323 Ga0105245_10008645 3300009098 Bacteria 8880
324 Ga0105245_10195835 3300009098 Bacteria 1938
325 Ga0105245_10236879 3300009098 Bacteria 1767
326 Ga0105243_10000481 3300009148 Bacteria 40913
327 Ga0105243_10015811 3300009148 Bacteria 5708
328 Ga0105243_10016483 3300009148 Bacteria 5585
329 Ga0105243_10074640 3300009148 Bacteria 2751
330 Ga0105243_10085514 3300009148 Bacteria 2585
331 Ga0105243_10338670 3300009148 Bacteria 1377
332 Ga0105243_10365387 3300009148 Bacteria 1330
333 Ga0105243_10929338 3300009148 Bacteria 867
334 Ga0105242_10191510 3300009176 Bacteria 1811
335 Ga0105248_10010384 3300009177 Bacteria 10253
336 Ga0105248_10073710 3300009177 Bacteria 3836
337 Ga0105248_10223138 3300009177 Bacteria 2122
338 Ga0105248_10588206 3300009177 Bacteria 1256
339 Ga0105237_10022949 3300009545 Bacteria 6399
340 Ga0105238_10018905 3300009551 Bacteria 7017
341 Ga0105238_10402474 3300009551 Bacteria 1362
342 Ga0105249_10246893 3300009553 Bacteria 1767
343 Ga0105249_11097357 3300009553 Bacteria 866
344 Ga0105239_10399593 3300010375 Bacteria 1555
345 Ga0105246_10170572 3300011119 Bacteria 1666
346 Ga0105246_10240635 3300011119 Bacteria 1430
347 Ga0157319_1000001 3300012497 Bacteria 423237
348 Ga0157373_10048353 3300013100 Bacteria 3033
349 Ga0157373_10059627 3300013100 Bacteria 2704
350 Ga0157373_10497492 3300013100 Bacteria 880
351 Ga0157371_10189039 3300013102 Bacteria 1474
352 Ga0157370_10138552 3300013104 Bacteria 2267
353 Ga0157370_10292047 3300013104 Bacteria 1506
354 Ga0157370_10453641 3300013104 Bacteria 1179
355 Ga0157370_10561572 3300013104 Bacteria 1046
356 Ga0157370_10827754 3300013104 Bacteria 842
357 Ga0157369_10315473 3300013105 Bacteria 1625
358 Ga0157369_11007943 3300013105 Bacteria 852
359 Ga0157374_10037506 3300013296 Bacteria 4449
360 Ga0157374_10474832 3300013296 Bacteria 1253
361 Ga0157378_10225791 3300013297 Bacteria 1782
362 Ga0157378_10550468 3300013297 Bacteria 1159
363 Ga0163162_10017073 3300013306 Bacteria 7100
364 Ga0163162_10059244 3300013306 Bacteria 3860
365 Ga0163162_10266175 3300013306 Bacteria 1845
366 Ga0163162_10521408 3300013306 Bacteria 1318
367 Ga0157372_10022443 3300013307 Bacteria 6830
368 Ga0157372_10615863 3300013307 Bacteria 1265
369 Ga0157375_10011944 3300013308 Bacteria 7686
370 Ga0157375_10087312 3300013308 Bacteria 3171
371 Ga0157375_10088676 3300013308 Bacteria 3148
372 Ga0157375_10173858 3300013308 Bacteria 2302
373 Ga0157375_10193123 3300013308 Bacteria 2191
374 Ga0157375_10372738 3300013308 Bacteria 1594
375 Ga0157375_10540579 3300013308 Bacteria 1327
376 Ga0157375_10716809 3300013308 Bacteria 1153
377 Ga0163163_10007006 3300014325 Bacteria 9903
378 Ga0163163_10079621 3300014325 Bacteria 3275
379 Ga0157380_10004553 3300014326 Bacteria 9622
380 Ga0157380_10011560 3300014326 Bacteria 6380
381 Ga0157380_10123026 3300014326 Bacteria 2201
382 Ga0182008_10002841 3300014497 Bacteria 10711
383 Ga0182008_10004507 3300014497 Bacteria 8130
384 Ga0182008_10116407 3300014497 Bacteria 1326
385 Ga0182008_10121730 3300014497 Bacteria 1297
386 Ga0157377_10002433 3300014745 Bacteria 8222
387 Ga0157379_10025811 3300014968 Bacteria 5223
388 Ga0157379_10059469 3300014968 Bacteria 3417
389 Ga0157379_10524262 3300014968 Bacteria 1100
390 Ga0157376_10002446 3300014969 Bacteria 12555
391 Ga0157376_10005021 3300014969 Bacteria 9232
392 Ga0157376_10295298 3300014969 Bacteria 1532
393 Ga0157376_10358511 3300014969 Bacteria 1398
394 Ga0182006_1002817 3300015261 Bacteria 9274
395 Ga0182006_1059750 3300015261 Bacteria 1442
396 Ga0182006_1090141 3300015261 Bacteria 1105
397 Ga0182007_10000727 3300015262 Bacteria 18605
398 Ga0163161_10000578 3300017792 Bacteria 29487
399 Ga0163161_10010469 3300017792 Bacteria 6420
400 Ga0163161_10018036 3300017792 Bacteria 4947
401 Ga0163161_10055046 3300017792 Bacteria 2888
402 Ga0163161_10229392 3300017792 Bacteria 1440
403 Ga0163161_10799671 3300017792 Bacteria 792
404 Ga0209435_100001 3300025206 Bacteria 1424171
405 Ga0209436_104755 3300025208 Bacteria 3281
406 Ga0209436_107635 3300025208 Bacteria 2235
407 Ga0209672_105495 3300025228 Bacteria 2165
408 Ga0209147_100716 3300025229 Bacteria 16796
409 Ga0209258_100058 3300025242 Bacteria 331567
410 Ga0207425_1000087 3300025245 Bacteria 93219
411 Ga0207425_1000861 3300025245 Bacteria 14859
412 Ga0207425_1002867 3300025245 Bacteria 5790
413 Ga0209646_1000001 3300025246 Bacteria 3092932
414 Ga0209026_1000003 3300025250 Bacteria 1060571
415 Ga0209148_1000071 3300025254 Bacteria 331551
416 Ga0209759_1000001 3300025256 Bacteria 2799452
417 Ga0209129_1000007 3300025258 Bacteria 771325
418 Ga0209129_1001475 3300025258 Bacteria 13084
419 Ga0209129_1002386 3300025258 Bacteria 9246
420 Ga0209129_1021579 3300025258 Bacteria 1177
421 Ga0209565_1000004 3300025263 Bacteria 983150
422 Ga0209565_1000038 3300025263 Bacteria 286433
423 Ga0209565_1000075 3300025263 Bacteria 162259
424 Ga0209565_1000407 3300025263 Bacteria 35850
425 Ga0209565_1001142 3300025263 Bacteria 12781
426 Ga0209673_1000066 3300025273 Bacteria 250037
427 Ga0209673_1000080 3300025273 Bacteria 223503
428 Ga0209673_1000357 3300025273 Bacteria 82249
429 Ga0209673_1002015 3300025273 Bacteria 15619
430 Ga0209673_1003648 3300025273 Bacteria 8902
431 Ga0209673_1007212 3300025273 Bacteria 5179
432 Ga0209673_1021856 3300025273 Bacteria 2225
433 Ga0209130_1000082 3300025284 Bacteria 164441
434 Ga0209130_1000094 3300025284 Bacteria 145569
435 Ga0209130_1000131 3300025284 Bacteria 119977
436 Ga0209130_1000137 3300025284 Bacteria 116784
437 Ga0209675_1000061 3300025291 Bacteria 181096
438 Ga0209675_1000074 3300025291 Bacteria 162260
439 Ga0209675_1000102 3300025291 Bacteria 123742
440 Ga0209675_1001838 3300025291 Bacteria 11553
441 Ga0209675_1017338 3300025291 Bacteria 2059
442 Ga0209676_1000005 3300025292 Bacteria 1076001
443 Ga0209676_1000029 3300025292 Bacteria 520536
444 Ga0209676_1000139 3300025292 Bacteria 177886
445 Ga0209676_1000186 3300025292 Bacteria 142440
446 Ga0209676_1000703 3300025292 Bacteria 46688
447 Ga0209676_1001078 3300025292 Bacteria 30809
448 Ga0209676_1062212 3300025292 Bacteria 923
449 Ga0209025_1000056 3300025294 Bacteria 316188
450 Ga0209025_1000088 3300025294 Bacteria 255087
451 Ga0209025_1000104 3300025294 Bacteria 226895
452 Ga0209025_1001422 3300025294 Bacteria 31645
453 Ga0209025_1003318 3300025294 Bacteria 15473
454 Ga0209025_1008022 3300025294 Bacteria 7690
455 Ga0209025_1027766 3300025294 Bacteria 2795
456 Ga0209025_1032944 3300025294 Bacteria 2409
457 Ga0209564_1000005 3300025295 Bacteria 1147192
458 Ga0209564_1000073 3300025295 Bacteria 288080
459 Ga0209564_1000090 3300025295 Bacteria 249298
460 Ga0209564_1000969 3300025295 Bacteria 36292
461 Ga0209564_1001231 3300025295 Bacteria 28910
462 Ga0209758_1000044 3300025297 Bacteria 398448
463 Ga0209758_1037697 3300025297 Bacteria 1864
464 Ga0209050_1000003 3300025298 Bacteria 1609245
465 Ga0209050_1000007 3300025298 Bacteria 1187891
466 Ga0209050_1000250 3300025298 Bacteria 115980
467 Ga0209050_1003639 3300025298 Bacteria 11147
468 Ga0209050_1005618 3300025298 Bacteria 7780
469 Ga0209050_1030793 3300025298 Bacteria 1686
470 Ga0209256_1000001 3300025299 Bacteria 2166974
471 Ga0209256_1000020 3300025299 Bacteria 542402
472 Ga0209256_1000022 3300025299 Bacteria 481843
473 Ga0209256_1000767 3300025299 Bacteria 41661
474 Ga0209256_1001313 3300025299 Bacteria 26644
475 Ga0209256_1029187 3300025299 Bacteria 1542
476 Ga0209256_1039718 3300025299 Bacteria 1208
477 Ga0207426_1000001 3300025302 Bacteria 1341301
478 Ga0207426_1000025 3300025302 Bacteria 532921
479 Ga0207426_1000031 3300025302 Bacteria 460699
480 Ga0207426_1004459 3300025302 Bacteria 6816
481 Ga0209051_1000003 3300025303 Bacteria 1609245
482 Ga0209051_1000036 3300025303 Bacteria 339863
483 Ga0209051_1000160 3300025303 Bacteria 126473
484 Ga0209051_1000213 3300025303 Bacteria 98755
485 Ga0209051_1000257 3300025303 Bacteria 88842
486 Ga0209051_1003662 3300025303 Bacteria 9946
487 Ga0209051_1011578 3300025303 Bacteria 4342
488 Ga0209257_1000011 3300025304 Bacteria 1112630
489 Ga0209257_1000018 3300025304 Bacteria 836016
490 Ga0209257_1000116 3300025304 Bacteria 228733
491 Ga0209257_1000222 3300025304 Bacteria 134717
492 Ga0209257_1000990 3300025304 Bacteria 38532
493 Ga0209257_1002294 3300025304 Bacteria 19431
494 Ga0209257_1003620 3300025304 Bacteria 13011
495 Ga0207697_10216185 3300025315 Bacteria 845
496 Ga0207656_10062707 3300025321 Bacteria 1635
497 Ga0207656_10083798 3300025321 Bacteria 1437
498 Ga0207696_1032993 3300025711 Bacteria 1554
499 Ga0207655_1005759 3300025728 Bacteria 8346
500 Ga0207682_10028273 3300025893 Bacteria 2237
501 Ga0207682_10042718 3300025893 Bacteria 1853
502 Ga0207682_10061978 3300025893 Bacteria 1567
503 Ga0207682_10275181 3300025893 Bacteria 787
504 Ga0207688_10060902 3300025901 Bacteria 2127
505 Ga0207688_10074391 3300025901 Bacteria 1932
506 Ga0207680_10003607 3300025903 Bacteria 7270
507 Ga0207645_10004843 3300025907 Bacteria 9885
508 Ga0207645_10028889 3300025907 Bacteria 3577
509 Ga0207645_10307889 3300025907 Bacteria 1055
510 Ga0207643_10035653 3300025908 Bacteria 2790
511 Ga0207643_10174656 3300025908 Bacteria 1298
512 Ga0207705_10067743 3300025909 Bacteria 2584
513 Ga0207705_10412283 3300025909 Bacteria 1045
514 Ga0207684_10328499 3300025910 Bacteria 1318
515 Ga0207654_10658557 3300025911 Bacteria 750
516 Ga0207695_10169856 3300025913 Bacteria 2107
517 Ga0207662_10054937 3300025918 Bacteria 2375
518 Ga0207662_10208347 3300025918 Bacteria 1268
519 Ga0207657_10027817 3300025919 Bacteria 5171
520 Ga0207657_10035337 3300025919 Bacteria 4482
521 Ga0207657_10154974 3300025919 Bacteria 1863
522 Ga0207657_10168000 3300025919 Bacteria 1778
523 Ga0207649_10076912 3300025920 Bacteria 2149
524 Ga0207649_10592056 3300025920 Bacteria 852
525 Ga0207652_10528384 3300025921 Bacteria 1061
526 Ga0207681_10003695 3300025923 Bacteria 9506
527 Ga0207681_10049975 3300025923 Bacteria 2828
528 Ga0207681_10064872 3300025923 Bacteria 2523
529 Ga0207681_10355541 3300025923 Bacteria 1173
530 Ga0207694_10065979 3300025924 Bacteria 2822
531 Ga0207694_10312541 3300025924 Bacteria 1296
532 Ga0207650_10020396 3300025925 Bacteria 4673
533 Ga0207650_10043137 3300025925 Bacteria 3310
534 Ga0207650_10066144 3300025925 Bacteria 2710
535 Ga0207650_10106487 3300025925 Bacteria 2165
536 Ga0207650_10221301 3300025925 Bacteria 1523
537 Ga0207650_10518117 3300025925 Bacteria 998
538 Ga0207650_10776745 3300025925 Bacteria 811
539 Ga0207659_10010349 3300025926 Bacteria 5858
540 Ga0207659_10013231 3300025926 Bacteria 5277
541 Ga0207659_10018641 3300025926 Bacteria 4553
542 Ga0207659_10032482 3300025926 Bacteria 3583
543 Ga0207687_10136113 3300025927 Bacteria 1858
544 Ga0207687_10617927 3300025927 Bacteria 914
545 Ga0207664_10568092 3300025929 Bacteria 1018
546 Ga0207644_10017836 3300025931 Bacteria 4800
547 Ga0207644_10046482 3300025931 Bacteria 3093
548 Ga0207644_10079055 3300025931 Bacteria 2425
549 Ga0207644_10202541 3300025931 Bacteria 1566
550 Ga0207644_10344893 3300025931 Bacteria 1208
551 Ga0207644_10687902 3300025931 Bacteria 852
552 Ga0207644_10731487 3300025931 Bacteria 826
553 Ga0207690_10086195 3300025932 Bacteria 2206
554 Ga0207706_10012717 3300025933 Bacteria 7661
555 Ga0207706_10016241 3300025933 Bacteria 6725
556 Ga0207706_10087115 3300025933 Bacteria 2745
557 Ga0207706_10122025 3300025933 Bacteria 2292
558 Ga0207706_10313150 3300025933 Bacteria 1366
559 Ga0207686_10192865 3300025934 Bacteria 1454
560 Ga0207709_10000074 3300025935 Bacteria 174947
561 Ga0207709_10000292 3300025935 Bacteria 56565
562 Ga0207709_10001791 3300025935 Bacteria 14395
563 Ga0207709_10002968 3300025935 Bacteria 10339
564 Ga0207709_10009056 3300025935 Bacteria 5489
565 Ga0207709_10141454 3300025935 Bacteria 1654
566 Ga0207709_10197351 3300025935 Bacteria 1434
567 Ga0207709_10325830 3300025935 Bacteria 1151
568 Ga0207709_10561338 3300025935 Bacteria 899
569 Ga0207670_10022243 3300025936 Bacteria 3927
570 Ga0207669_10006635 3300025937 Bacteria 5305
571 Ga0207669_10103034 3300025937 Bacteria 1892
572 Ga0207669_10130945 3300025937 Bacteria 1723
573 Ga0207669_10222460 3300025937 Bacteria 1386
574 Ga0207669_10276161 3300025937 Bacteria 1265
575 Ga0207669_10401340 3300025937 Bacteria 1074
576 Ga0207704_10012471 3300025938 Bacteria 4218
577 Ga0207704_10198640 3300025938 Bacteria 1466
578 Ga0207665_10580347 3300025939 Bacteria 874
579 Ga0207691_10022193 3300025940 Bacteria 5987
580 Ga0207691_10023049 3300025940 Bacteria 5865
581 Ga0207691_10033193 3300025940 Bacteria 4806
582 Ga0207691_10033246 3300025940 Bacteria 4801
583 Ga0207691_10034742 3300025940 Bacteria 4685
584 Ga0207691_10043476 3300025940 Bacteria 4141
585 Ga0207691_10131329 3300025940 Bacteria 2212
586 Ga0207691_10134082 3300025940 Bacteria 2186
587 Ga0207691_10134169 3300025940 Bacteria 2185
588 Ga0207691_10184828 3300025940 Bacteria 1820
589 Ga0207711_10093160 3300025941 Bacteria 2653
590 Ga0207711_10109659 3300025941 Bacteria 2453
591 Ga0207711_10141921 3300025941 Bacteria 2162
592 Ga0207711_10167418 3300025941 Bacteria 1993
593 Ga0207689_10001429 3300025942 Bacteria 22803
594 Ga0207689_10012424 3300025942 Bacteria 7280
595 Ga0207689_10048915 3300025942 Bacteria 3488
596 Ga0207689_10260474 3300025942 Bacteria 1435
597 Ga0207679_10086588 3300025945 Bacteria 2410
598 Ga0207679_10112660 3300025945 Bacteria 2150
599 Ga0207679_10218174 3300025945 Bacteria 1604
600 Ga0207679_10528849 3300025945 Bacteria 1056
601 Ga0207679_10799971 3300025945 Bacteria 859
602 Ga0207679_11065686 3300025945 Bacteria 741
603 Ga0207667_10050606 3300025949 Bacteria 4383
604 Ga0207667_10140675 3300025949 Bacteria 2485
605 Ga0207667_10181107 3300025949 Bacteria 2164
606 Ga0207651_10006261 3300025960 Bacteria 6205
607 Ga0207651_10648348 3300025960 Bacteria 927
608 Ga0207712_10859901 3300025961 Bacteria 800
609 Ga0207668_10190360 3300025972 Bacteria 1625
610 Ga0207668_10419443 3300025972 Bacteria 1136
611 Ga0207640_10032954 3300025981 Bacteria 3218
612 Ga0207640_10353060 3300025981 Bacteria 1182
613 Ga0207658_10003143 3300025986 Bacteria 11814
614 Ga0207658_10162165 3300025986 Bacteria 1833
615 Ga0207677_10001922 3300026023 Bacteria 10987
616 Ga0207677_10005418 3300026023 Bacteria 6927
617 Ga0207677_10029151 3300026023 Bacteria 3503
618 Ga0207677_10383589 3300026023 Bacteria 1187
619 Ga0207677_10421183 3300026023 Bacteria 1137
620 Ga0207677_10546724 3300026023 Bacteria 1009
621 Ga0207703_10002152 3300026035 Bacteria 17313
622 Ga0207703_10019182 3300026035 Bacteria 5342
623 Ga0207703_10105189 3300026035 Bacteria 2399
624 Ga0207703_10220216 3300026035 Bacteria 1696
625 Ga0207703_10735262 3300026035 Bacteria 940
626 Ga0207639_10043681 3300026041 Bacteria 3366
627 Ga0207639_10069404 3300026041 Bacteria 2749
628 Ga0207639_10179844 3300026041 Bacteria 1798
629 Ga0207639_10424226 3300026041 Bacteria 1203
630 Ga0207678_10035138 3300026067 Bacteria 4364
631 Ga0207678_10253242 3300026067 Bacteria 1508
632 Ga0207678_10468518 3300026067 Bacteria 1096
633 Ga0207678_10657450 3300026067 Bacteria 921
634 Ga0207702_10009730 3300026078 Bacteria 8073
635 Ga0207702_10029676 3300026078 Bacteria 4552
636 Ga0207641_10001478 3300026088 Bacteria 23038
637 Ga0207641_10039250 3300026088 Bacteria 3959
638 Ga0207641_10057522 3300026088 Bacteria 3307
639 Ga0207641_10137763 3300026088 Bacteria 2198
640 Ga0207641_10149917 3300026088 Bacteria 2111
641 Ga0207641_10164601 3300026088 Bacteria 2019
642 Ga0207641_10790446 3300026088 Bacteria 938
643 Ga0207641_10977797 3300026088 Bacteria 842
644 Ga0207648_10000115 3300026089 Bacteria 77967
645 Ga0207648_10002367 3300026089 Bacteria 20334
646 Ga0207648_10007133 3300026089 Bacteria 11021
647 Ga0207648_10034806 3300026089 Bacteria 4440
648 Ga0207648_10037225 3300026089 Bacteria 4285
649 Ga0207648_10105584 3300026089 Bacteria 2471
650 Ga0207648_10109236 3300026089 Bacteria 2428
651 Ga0207648_11104592 3300026089 Bacteria 744
652 Ga0207676_10005107 3300026095 Bacteria 9292
653 Ga0207676_10052821 3300026095 Bacteria 3178
654 Ga0207676_10361541 3300026095 Bacteria 1345
655 Ga0207676_10502718 3300026095 Bacteria 1151
656 Ga0207676_10727915 3300026095 Bacteria 963
657 Ga0207676_10821321 3300026095 Bacteria 908
658 Ga0207676_10980787 3300026095 Bacteria 832
659 Ga0207674_10014143 3300026116 Bacteria 8818
660 Ga0207674_10076121 3300026116 Bacteria 3365
661 Ga0207674_10351268 3300026116 Bacteria 1425
662 Ga0207674_10877099 3300026116 Bacteria 865
663 Ga0207675_100000595 3300026118 Bacteria 35352
664 Ga0207675_100000814 3300026118 Bacteria 31037
665 Ga0207675_100042538 3300026118 Bacteria 4243
666 Ga0207675_100160711 3300026118 Bacteria 2142
667 Ga0207683_10011209 3300026121 Bacteria 7641
668 Ga0207683_10017698 3300026121 Bacteria 6076
669 Ga0207683_10018267 3300026121 Bacteria 5982
670 Ga0207683_10130883 3300026121 Bacteria 2257
671 Ga0207683_10238197 3300026121 Bacteria 1660
672 Ga0207683_10262615 3300026121 Bacteria 1577
673 Ga0207683_10382435 3300026121 Bacteria 1294
674 Ga0207683_10636938 3300026121 Bacteria 987
675 Ga0207683_10726588 3300026121 Bacteria 921
676 Ga0207683_11117800 3300026121 Bacteria 731
677 Ga0207698_10016220 3300026142 Bacteria 5015
678 Ga0207698_10022258 3300026142 Bacteria 4400
679 Ga0207698_10070787 3300026142 Bacteria 2765
680 Ga0207698_10165630 3300026142 Bacteria 1939
681 Ga0207698_10311886 3300026142 Bacteria 1469
682 Ga0207698_10429733 3300026142 Bacteria 1269
683 Ga0209281_1000005 3300027111 Bacteria 1242284
684 Ga0209973_1015957 3300027252 Bacteria 953
685 Ga0209389_1015149 3300027296 Bacteria 7002
686 Ga0209282_1000221 3300027666 Bacteria 29591
687 Ga0209282_1130980 3300027666 Bacteria 1240
688 Ga0209974_10009563 3300027876 Bacteria 3291
689 Ga0209974_10026679 3300027876 Bacteria 1911
690 Ga0207428_10193228 3300027907 Bacteria 1534
691 Ga0268266_10020271 3300028379 Bacteria 5669
692 Ga0268265_10074199 3300028380 Bacteria 2660
693 Ga0268265_10121140 3300028380 Bacteria 2155
694 Ga0268265_10505451 3300028380 Bacteria 1140
695 Ga0268264_10067137 3300028381 Bacteria 3027
696 Ga0268264_10092983 3300028381 Bacteria 2604
697 Ga0268264_10197504 3300028381 Bacteria 1838
698 Ga0268264_10468657 3300028381 Bacteria 1223
699 Ga0265318_10095149 3300028577 Bacteria 1097
700 Ga0307517_10004912 3300028786 Bacteria 20370
701 Ga0307515_10000306 3300028794 Bacteria 121448
702 Ga0307515_10000652 3300028794 Bacteria 80185
703 Ga0307515_10001063 3300028794 Bacteria 62886
704 Ga0307515_10005560 3300028794 Bacteria 25507
705 Ga0307515_10005581 3300028794 Bacteria 25423
706 Ga0307515_10095345 3300028794 Bacteria 3663
707 Ga0307515_10209656 3300028794 Bacteria 1796
708 Ga0307515_10294695 3300028794 Bacteria 1314
709 Ga0307512_10036774 3300030522 Bacteria 4146
710 Ga0307512_10152045 3300030522 Bacteria 1381
711 Ga0316177_1105017 3300030731 Bacteria 5728
712 Ga0316176_1013009 3300030732 Bacteria 2964
713 Ga0314311_1155152 3300030733 Bacteria 3630
714 Ga0316178_1038440 3300030735 Bacteria 2166
715 Ga0316183_1039891 3300030742 Bacteria 7261
716 Ga0265330_10000344 3300031235 Bacteria 33165
717 Ga0265332_10000002 3300031238 Bacteria 709510
718 Ga0265332_10000094 3300031238 Bacteria 77636
719 Ga0265325_10010778 3300031241 Bacteria 5275
720 Ga0265327_10006203 3300031251 Bacteria 9642
721 Ga0265327_10079841 3300031251 Bacteria 1619
722 Ga0307513_10000019 3300031456 Bacteria 231194
723 Ga0307513_10000051 3300031456 Bacteria 149733
724 Ga0307513_10028964 3300031456 Bacteria 6322
725 Ga0307513_10109212 3300031456 Bacteria 2764
726 Ga0307513_10128037 3300031456 Bacteria 2490
727 Ga0307513_10138268 3300031456 Bacteria 2367
728 Ga0307513_10464070 3300031456 Bacteria 989
729 Ga0307509_10004147 3300031507 Bacteria 21173
730 Ga0307509_10004183 3300031507 Bacteria 21075
731 Ga0307509_10019347 3300031507 Bacteria 7768
732 Ga0307509_10101786 3300031507 Bacteria 2906
733 Ga0307509_10197700 3300031507 Bacteria 1852
734 Ga0307509_10316734 3300031507 Bacteria 1299
735 Ga0307408_100000048 3300031548 Bacteria 165579
736 Ga0307408_100006460 3300031548 Bacteria 7773
737 Ga0307408_100060094 3300031548 Bacteria 2769
738 Ga0307408_100087987 3300031548 Bacteria 2338
739 Ga0307408_100112074 3300031548 Bacteria 2097
740 Ga0307408_100167055 3300031548 Bacteria 1753
741 Ga0307408_100201438 3300031548 Bacteria 1611
742 Ga0307408_100537944 3300031548 Bacteria 1029
743 Ga0307408_100842451 3300031548 Bacteria 835
744 Ga0307408_100849166 3300031548 Bacteria 832
745 Ga0307508_10000163 3300031616 Bacteria 80086
746 Ga0307508_10000385 3300031616 Bacteria 53049
747 Ga0307508_10011794 3300031616 Bacteria 7987
748 Ga0307508_10329205 3300031616 Bacteria 1119
749 Ga0307514_10002111 3300031649 Bacteria 21455
750 Ga0307514_10048620 3300031649 Bacteria 3303
751 Ga0307514_10338710 3300031649 Bacteria 811
752 Ga0265314_10000012 3300031711 Bacteria 415184
753 Ga0265342_10137520 3300031712 Bacteria 1365
754 Ga0307516_10000381 3300031730 Bacteria 58016
755 Ga0307516_10009467 3300031730 Bacteria 10853
756 Ga0307405_10001524 3300031731 Bacteria 9813
757 Ga0307405_10019585 3300031731 Bacteria 3762
758 Ga0307405_10743538 3300031731 Bacteria 816
759 Ga0307413_10007656 3300031824 Bacteria 5039
760 Ga0307413_10225930 3300031824 Bacteria 1371
761 Ga0307410_10017440 3300031852 Bacteria 4312
762 Ga0307406_10000164 3300031901 Bacteria 39993
763 Ga0307406_10003567 3300031901 Bacteria 8482
764 Ga0307406_10140953 3300031901 Bacteria 1706
765 Ga0307406_10225625 3300031901 Bacteria 1395
766 Ga0307407_10128376 3300031903 Bacteria 1618
767 Ga0307407_10262684 3300031903 Bacteria 1188
768 Ga0307412_10010332 3300031911 Bacteria 5376
769 Ga0307412_10054105 3300031911 Bacteria 2663
770 Ga0307412_10172681 3300031911 Bacteria 1617
771 Ga0307412_10386146 3300031911 Bacteria 1135
772 Ga0307412_10595524 3300031911 Bacteria 935
773 Ga0307412_11053003 3300031911 Bacteria 721
774 Ga0307409_100002529 3300031995 Bacteria 9585
775 Ga0307409_100023723 3300031995 Bacteria 4260
776 Ga0307416_100043673 3300032002 Bacteria 3512
777 Ga0307416_100071544 3300032002 Bacteria 2882
778 Ga0307416_100357459 3300032002 Bacteria 1481
779 Ga0307411_10065958 3300032005 Bacteria 2430
780 Ga0307411_10210973 3300032005 Bacteria 1499
781 Ga0307411_10566325 3300032005 Bacteria 972
782 Ga0307415_100005787 3300032126 Bacteria 6600
783 Ga0307415_100056340 3300032126 Bacteria 2694
784 Ga0307415_100502849 3300032126 Bacteria 1060
785 Ga0307415_100503742 3300032126 Bacteria 1059
786 Ga0307507_10199264 3300033179 Bacteria 1389
787 Ga0307510_10056403 3300033180 Bacteria 4091
788 Ga0307510_10148812 3300033180 Bacteria 1966
789 Ga0373932_0171284 3300035112 Bacteria 757
790 Ga0373941_0027987 3300035115 Bacteria 1651
791 Ga0373943_0305806 3300035170 Bacteria 904
792 Ga0373955_0401646 3300035172 Bacteria 833
793 Ga0373931_0004194 3300035691 Bacteria 6562
794 Ga0373931_0023887 3300035691 Bacteria 3090
795 Ga0373937_0089892 3300036401 Bacteria 2844
796 Ga0373937_0112459 3300036401 Bacteria 2533
797 Ga0373925_0340305 3300037068 Bacteria 1217
798 Ga0395899_0023506 3300037312 Bacteria 4667
799 Ga0395900_0140666 3300037418 Bacteria 2471
800 Ga0395898_0010832 3300037466 Bacteria 9525
801 Ga0395905_0064674 3300037471 Bacteria 3423
802 Ga0395905_0092135 3300037471 Bacteria 2842
803 Ga0395901_0173441 3300038443 Bacteria 2262
804 Ga0436365_0618815 3300039437 Bacteria 2465
805 Ga0439436_0000212 3300041404 Bacteria 14029
806 Ga0439436_0023349 3300041404 Bacteria 1830
807 Ga0439439_0004076 3300041406 Bacteria 3265
808 Ga0439466_0013780 3300041411 Bacteria 2956
809 Ga0439466_0015553 3300041411 Bacteria 2763
810 Ga0439465_0001922 3300041413 Bacteria 6811
811 Ga0451791_0590277 3300041451 Bacteria 935
812 Ga0451795_0158714 3300041456 Bacteria 859
813 Ga0451802_1063573 3300041460 Bacteria 1467
814 Ga0451807_0895355 3300041486 Bacteria 932
815 Ga0451807_1169175 3300041486 Bacteria 916
816 Ga0451807_1843106 3300041486 Bacteria 866
817 Ga0451833_1094299 3300041491 Bacteria 935
818 Ga0451839_0734584 3300041496 Bacteria 999
819 Ga0451849_0341148 3300041505 Unclassified 715
820 Ga0451851_0387925 3300041507 Bacteria 1122
821 Ga0451843_1319765 3300041509 Bacteria 982
822 Ga0439431_0005958 3300041997 Bacteria 2689
823 Ga0439433_0000802 3300041999 Bacteria 6213
824 Ga0439442_017744 3300042002 Bacteria 1469
825 Ga0439432_005007 3300042006 Bacteria 4791
826 Ga0439432_072444 3300042006 Bacteria 1049
827 Ga0439449_0000162 3300042007 Bacteria 22807
828 Ga0439449_0003523 3300042007 Bacteria 6078
829 Ga0439449_0009856 3300042007 Bacteria 3615
830 Ga0439452_000749 3300042010 Bacteria 15562
831 Ga0439454_002859 3300042011 Bacteria 1867
832 Ga0439462_0004283 3300042015 Bacteria 3473
833 Ga0450911_000660 3300042115 Bacteria 10320
834 Ga0450919_001363 3300042121 Bacteria 3191
835 Ga0450919_012034 3300042121 Bacteria 981
836 Ga0450920_005006 3300042122 Bacteria 2347
837 Ga0450921_000292 3300042123 Bacteria 2192
838 Ga0450923_043732 3300042125 Bacteria 947
839 Ga0450898_004329 3300042134 Bacteria 2094
840 Ga0450899_003556 3300042135 Bacteria 1675
841 Ga0450902_026735 3300042137 Bacteria 966
842 Ga0450906_003932 3300042145 Bacteria 3148
843 Ga0450910_015468 3300042147 Bacteria 1123
844 Ga0439446_0025651 3300042156 Bacteria 1685
845 Ga0439434_0004431 3300042435 Bacteria 4105
846 Ga0439434_0016519 3300042435 Bacteria 2206
847 Ga0439459_0002941 3300042438 Bacteria 2668
848 Ga0439464_0047794 3300042439 Bacteria 1232
849 Ga0450918_000059 3300042531 Bacteria 22166
850 Ga0450918_001383 3300042531 Bacteria 4855
851 Ga0451577_0027133 3300042876 Bacteria 5183
852 Ga0451577_0104026 3300042876 Bacteria 2538
853 Ga0451577_0130548 3300042876 Bacteria 2253
854 Ga0451577_0219491 3300042876 Bacteria 1718
855 Ga0453683_0004191 3300044673 Bacteria 10312
856 Ga0466963_0023743 3300044694 Bacteria 3898
857 Ga0453684_0041347 3300044712 Bacteria 6237
858 Ga0453684_0228294 3300044712 Bacteria 2151
859 Ga0453684_0461575 3300044712 Bacteria 1412
860 Ga0451576_0007413 3300045051 Bacteria 13122
861 Ga0451576_0037564 3300045051 Bacteria 5130
862 Ga0451576_0280482 3300045051 Bacteria 1742
863 Ga0451576_0290193 3300045051 Bacteria 1710
864 Ga0495627_004409 3300046453 Bacteria 5896
865 Ga0495627_007076 3300046453 Bacteria 4344
866 Ga0495629_0092193 3300046459 Bacteria 2115
867 Ga0495580_0113853 3300046472 Bacteria 1879
868 Ga0495583_0128092 3300046506 Bacteria 1064
869 Ga0495610_0017946 3300046512 Bacteria 4014
870 Ga0495610_0023524 3300046512 Bacteria 3346
871 Ga0495610_0038244 3300046512 Bacteria 2437
872 Ga0495616_0001622 3300046513 Bacteria 15416
873 Ga0495618_0127517 3300046514 Bacteria 1629
874 Ga0495620_0097981 3300046515 Bacteria 1171
875 Ga0495620_0228861 3300046515 Bacteria 711
876 Ga0495630_0197903 3300046517 Bacteria 1533
877 Ga0495631_0003611 3300046518 Bacteria 8442
878 Ga0495632_0046600 3300046519 Bacteria 2153
879 Ga0495632_0119730 3300046519 Bacteria 1231
880 Ga0495637_0008897 3300046520 Bacteria 4914
881 Ga0495637_0022431 3300046520 Bacteria 2879
882 Ga0495643_0076794 3300046522 Bacteria 1746
883 Ga0495648_0063897 3300046524 Bacteria 2171
884 Ga0495654_0069440 3300046530 Bacteria 1673
885 Ga0495597_0000065 3300046542 Bacteria 90745
886 Ga0495633_0086478 3300046558 Bacteria 1458
887 Ga0495668_0068549 3300046616 Bacteria 1951
888 Ga0495625_0000057 3300046660 Bacteria 181623
889 Ga0495625_0002324 3300046660 Bacteria 20802
890 Ga0495625_0098618 3300046660 Bacteria 2010
891 Ga0495588_0032582 3300046674 Bacteria 2627
892 Ga0495647_0063978 3300046681 Bacteria 1458
893 Ga0495658_0016346 3300046683 Bacteria 3820
894 Ga0495658_0289786 3300046683 Bacteria 1034
895 Ga0495624_0027325 3300046690 Bacteria 3736
896 Ga0495670_0008089 3300046691 Bacteria 5168
897 Ga0495670_0156247 3300046691 Bacteria 1197
898 Ga0495671_0001783 3300046692 Bacteria 13918
899 Ga0495660_0107457 3300046810 Bacteria 1428
900 Ga0495676_0025847 3300047321 Bacteria 5061
901 Ga0495681_0165643 3300047470 Bacteria 918
902 Ga0495593_0024903 3300047673 Bacteria 3312
903 Ga0495593_0109881 3300047673 Bacteria 1408
904 Ga0495614_0028444 3300048089 Bacteria 2408
905 Ga0496100_0364902 3300048903 Bacteria 1094
906 Ga0496101_0012290 3300048904 Bacteria 5711
907 Ga0496101_0368503 3300048904 Bacteria 1129
908 Ga0496101_0877117 3300048904 Bacteria 707
909 Ga0496102_0004670 3300048905 Bacteria 11585
910 Ga0496102_0016461 3300048905 Bacteria 6461
911 Ga0496102_0063249 3300048905 Bacteria 3388
912 Ga0496104_0401427 3300048907 Bacteria 1283
913 Ga0496105_0683180 3300048908 Bacteria 789
914 Ga0496106_0002144 3300048909 Bacteria 14740
915 Ga0496106_0014626 3300048909 Bacteria 5799
916 Ga0496107_0101397 3300048910 Bacteria 2111
917 Ga0496107_0227846 3300048910 Bacteria 1386
918 Ga0496108_1057641 3300048911 Bacteria 691
919 Ga0496109_0072741 3300048912 Bacteria 3158
920 Ga0496110_0032378 3300048913 Bacteria 4514
921 Ga0496111_0464573 3300048914 Bacteria 933
922 Ga0496112_0082239 3300048915 Bacteria 3185
923 Ga0496113_0035270 3300048916 Bacteria 3657
924 Ga0496114_0032690 3300048917 Bacteria 4284
925 Ga0496114_0289600 3300048917 Bacteria 1445
926 Ga0496114_0626550 3300048917 Bacteria 947
927 Ga0496116_0025716 3300048919 Bacteria 4322
928 Ga0496116_0036615 3300048919 Bacteria 3431
929 Ga0496117_0028533 3300048920 Bacteria 4320
930 Ga0496117_0028546 3300048920 Bacteria 4319
931 Ga0496117_0072533 3300048920 Bacteria 2301
932 Ga0496117_0137384 3300048920 Bacteria 1470
933 Ga0496118_0016121 3300048921 Bacteria 6872
934 Ga0496118_0039128 3300048921 Bacteria 3788
935 Ga0496121_0042381 3300048924 Bacteria 3960
936 Ga0496121_0151260 3300048924 Bacteria 1707
937 Ga0496121_0227039 3300048924 Bacteria 1310
938 Ga0496121_0550840 3300048924 Bacteria 722
939 Ga0496122_0001985 3300048925 Bacteria 30535
940 Ga0496122_0040928 3300048925 Bacteria 3674
941 Ga0496122_0074474 3300048925 Bacteria 2402
942 Ga0496122_0112553 3300048925 Bacteria 1782
943 Ga0496122_0130642 3300048925 Bacteria 1597
944 Ga0496123_0000108 3300048926 Bacteria 166102
945 Ga0496123_0077439 3300048926 Bacteria 2042
946 Ga0496123_0090733 3300048926 Bacteria 1815
947 Ga0496123_0136522 3300048926 Bacteria 1349
948 Ga0496124_0008708 3300048927 Bacteria 10546
949 Ga0496124_0048959 3300048927 Bacteria 3607
950 Ga0496124_0278254 3300048927 Bacteria 1221
951 Ga0496125_0001110 3300048928 Bacteria 41331
952 Ga0496125_0001434 3300048928 Bacteria 34736
953 Ga0496125_0003201 3300048928 Bacteria 20211
954 Ga0496125_0008866 3300048928 Bacteria 10448
955 Ga0496125_0041445 3300048928 Bacteria 3935
956 Ga0496125_0083988 3300048928 Bacteria 2420
957 Ga0496125_0193121 3300048928 Bacteria 1342
958 Ga0496126_0105046 3300048929 Bacteria 2467
959 Ga0496126_0434354 3300048929 Bacteria 1059
960 Ga0501034_0090596 3300049571 Bacteria 3056
961 Ga0501038_0240902 3300049574 Bacteria 1436
962 Ga0501047_0344776 3300049581 Bacteria 1327
963 Ga0501262_004518 3300049759 Bacteria 1616
964 Ga0501035_0102509 3300049822 Bacteria 2510
965 Ga0501044_0090000 3300049823 Bacteria 3097
966 nmdc:mga03683_12585_c1 3300050489 Bacteria 3095
967 nmdc:mga03683_1803_c1 3300050489 Bacteria 6494
968 nmdc:mga03683_33853_c1 3300050489 Bacteria 2065
969 nmdc:mga03n38_133491_c1 3300050490 Bacteria 1233
970 nmdc:mga03n38_362939_c1 3300050490 Bacteria 790
971 nmdc:mga03n38_57895_c1 3300050490 Bacteria 1754
972 nmdc:mga03n38_70019_c1 3300050490 Bacteria 1621
973 nmdc:mga0yw44_174365_c1 3300050492 Bacteria 1413
974 nmdc:mga0yw44_73599_c1 3300050492 Bacteria 2126
975 nmdc:mga0k408_10715_c1 3300050493 Bacteria 4967
976 nmdc:mga0k408_16857_c1 3300050493 Bacteria 4061
977 nmdc:mga0k408_232697_c1 3300050493 Bacteria 1100
978 nmdc:mga0k408_262416_c1 3300050493 Bacteria 1031
979 nmdc:mga0k408_36648_c2 3300050493 Bacteria 2468
980 nmdc:mga0k408_56639_c1 3300050493 Bacteria 2275
981 nmdc:mga0k408_80720_c1 3300050493 Bacteria 1904
982 nmdc:mga06z11_119292_c1 3300050494 Bacteria 1470
983 nmdc:mga06z11_244083_c1 3300050494 Bacteria 1056
984 nmdc:mga07m45_15470_c1 3300050496 Bacteria 3641
985 nmdc:mga07m45_24262_c1 3300050496 Bacteria 3321
986 nmdc:mga07m45_353156_c1 3300050496 Bacteria 854
987 nmdc:mga07m45_48000_c1 3300050496 Bacteria 2401
988 nmdc:mga07m45_7705_c1 3300050496 Bacteria 5511
989 nmdc:mga07m45_9224_c1 3300050496 Bacteria 4460
990 nmdc:mga0rr50_132627_c1 3300050513 Bacteria 1996
991 Ga0500610_0002251 3300053079 Bacteria 6999
992 Ga0500610_0033483 3300053079 Bacteria 2622
993 Ga0500610_0075277 3300053079 Bacteria 1760
994 Ga0500643_004866 3300053087 Bacteria 5928
995 Ga0500583_0093618 3300053092 Bacteria 1465
996 Ga0500651_0000090 3300053093 Bacteria 58811
997 Ga0500651_0008417 3300053093 Bacteria 6068
998 Ga0500566_0031058 3300053094 Bacteria 3115
999 Ga0500566_0190057 3300053094 Bacteria 1046
1000 Ga0500641_0197200 3300053096 Bacteria 860
1001 Ga0500555_083218 3300053103 Bacteria 830
1002 Ga0500562_002544 3300053108 Bacteria 4546
1003 Ga0500571_000014 3300053110 Bacteria 67097
1004 Ga0500592_008465 3300053116 Bacteria 1632
1005 Ga0500593_001074 3300053117 Bacteria 9866
1006 Ga0500593_019315 3300053117 Bacteria 2978
1007 Ga0500594_0002517 3300053118 Bacteria 3984
1008 Ga0500607_000328 3300053121 Bacteria 44883
1009 Ga0500607_013009 3300053121 Bacteria 4870
1010 Ga0500608_003138 3300053122 Bacteria 6133
1011 Ga0500626_194385 3300053128 Bacteria 805
1012 Ga0500628_002038 3300053129 Bacteria 3395
1013 Ga0500655_001389 3300053133 Bacteria 4586
1014 Ga0500658_0000018 3300053134 Bacteria 141217
1015 Ga0500658_0000322 3300053134 Bacteria 21148
1016 Ga0500559_0010108 3300053136 Bacteria 4061
1017 Ga0500559_0012748 3300053136 Bacteria 3568
1018 Ga0500564_010061 3300053138 Bacteria 4139
1019 Ga0500574_003231 3300053141 Bacteria 2844
1020 Ga0500616_0007996 3300053153 Bacteria 6630
1021 Ga0500619_000022 3300053154 Bacteria 50600
1022 Ga0500619_063314 3300053154 Bacteria 1221
1023 Ga0500622_0002013 3300053156 Bacteria 15185
1024 Ga0500627_0001126 3300053158 Bacteria 7324
1025 Ga0500634_0037520 3300053161 Bacteria 2635
1026 Ga0500634_0068195 3300053161 Bacteria 1868
1027 Ga0500638_026886 3300053162 Bacteria 2758
1028 Ga0500636_0042892 3300053177 Bacteria 2673
1029 Ga0500645_000155 3300053730 Bacteria 53212
1030 Ga0500645_000840 3300053730 Bacteria 18167
1031 Ga0500645_028446 3300053730 Bacteria 1691

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2886848708 2886853789 170
2 3300025961 Ga0207712_10859901 Ga0207712_108599011 171
3 3300048904 Ga0496101_0877117 Ga0496101_0877117_15_530 171
4 3300014969 Ga0157376_10295298 Ga0157376_102952981 173
5 3300050490 nmdc:mga03n38_362939_c1 nmdc:mga03n38_362939_c1_26_589 177
6 3300046472 Ga0495580_0113853 Ga0495580_0113853_1231_1851 184
7 3300006195 Ga0075366_10180051 Ga0075366_101800512 188
8 3300050493 nmdc:mga0k408_16857_c1 nmdc:mga0k408_16857_c1_232_849 188
9 3300035170 Ga0373943_0305806 Ga0373943_0305806_77_697 189
10 3300046515 Ga0495620_0097981 Ga0495620_0097981_471_1082 190
11 3300046519 Ga0495632_0046600 Ga0495632_0046600_378_989 190
12 3300028794 Ga0307515_10005560 Ga0307515_1000556018 192
13 3300028794 Ga0307515_10294695 Ga0307515_102946952 192
14 3300046522 Ga0495643_0076794 Ga0495643_0076794_17_628 192
15 3300048905 Ga0496102_0016461 Ga0496102_0016461_3550_4128 192
16 3300053730 Ga0500645_000840 Ga0500645_000840_13_594 193
17 3300005344 Ga0070661_100287573 Ga0070661_1002875732 194
18 3300005539 Ga0068853_100555627 Ga0068853_1005556272 194
19 3300005616 Ga0068852_100188255 Ga0068852_1001882552 194
20 3300013104 Ga0157370_10138552 Ga0157370_101385522 194
21 3300013307 Ga0157372_10615863 Ga0157372_106158632 194
22 3300026041 Ga0207639_10424226 Ga0207639_104242262 195
23 3300005616 Ga0068852_101365473 Ga0068852_1013654732 197
24 3300005330 Ga0070690_100701688 Ga0070690_1007016881 198
25 3300005367 Ga0070667_100802064 Ga0070667_1008020641 198
26 3300005841 Ga0068863_100211047 Ga0068863_1002110472 198
27 3300006051 Ga0075364_10318497 Ga0075364_103184972 198
28 3300026088 Ga0207641_10164601 Ga0207641_101646012 198
29 3300031507 Ga0307509_10019347 Ga0307509_100193477 198
30 iso_pu_bacteria 2585428062 2587755034 199
31 iso_pu_bacteria 2831864461 2831869536 199
32 3300025939 Ga0207665_10580347 Ga0207665_105803472 200
33 3300049571 Ga0501034_0090596 Ga0501034_0090596_1044_1646 200
34 3300049581 Ga0501047_0344776 Ga0501047_0344776_297_899 200
35 3300005327 Ga0070658_10070127 Ga0070658_100701274 201
36 3300005338 Ga0068868_100194380 Ga0068868_1001943802 201
37 3300005339 Ga0070660_100018204 Ga0070660_1000182043 201
38 3300005341 Ga0070691_10063677 Ga0070691_100636772 201
39 3300005355 Ga0070671_100008753 Ga0070671_1000087534 201
40 3300005356 Ga0070674_100278944 Ga0070674_1002789442 201
41 3300005435 Ga0070714_100098982 Ga0070714_1000989824 201
42 3300005456 Ga0070678_100731769 Ga0070678_1007317692 201
43 3300005459 Ga0068867_100119176 Ga0068867_1001191763 201
44 3300005530 Ga0070679_100031430 Ga0070679_1000314304 201
45 3300005563 Ga0068855_100009342 Ga0068855_10000934210 201
46 3300005564 Ga0070664_100240264 Ga0070664_1002402641 201
47 3300005614 Ga0068856_100400526 Ga0068856_1004005261 201
48 3300005841 Ga0068863_100155102 Ga0068863_1001551023 201
49 3300005841 Ga0068863_100538207 Ga0068863_1005382072 201
50 3300005842 Ga0068858_100783692 Ga0068858_1007836922 201
51 3300006358 Ga0068871_100241436 Ga0068871_1002414362 201
52 3300006881 Ga0068865_100313365 Ga0068865_1003133652 201
53 3300009093 Ga0105240_10017248 Ga0105240_100172486 201
54 3300009177 Ga0105248_10073710 Ga0105248_100737102 201
55 3300009551 Ga0105238_10402474 Ga0105238_104024742 201
56 3300013296 Ga0157374_10474832 Ga0157374_104748322 201
57 3300013308 Ga0157375_10011944 Ga0157375_100119445 201
58 3300014325 Ga0163163_10079621 Ga0163163_100796212 201
59 3300025913 Ga0207695_10169856 Ga0207695_101698562 201
60 3300025919 Ga0207657_10035337 Ga0207657_100353377 201
61 3300025921 Ga0207652_10528384 Ga0207652_105283841 201
62 3300025924 Ga0207694_10312541 Ga0207694_103125412 201
63 3300025927 Ga0207687_10617927 Ga0207687_106179272 201
64 3300025929 Ga0207664_10568092 Ga0207664_105680922 201
65 3300025931 Ga0207644_10079055 Ga0207644_100790552 201
66 3300025933 Ga0207706_10313150 Ga0207706_103131502 201
67 3300025937 Ga0207669_10130945 Ga0207669_101309452 201
68 3300025940 Ga0207691_10034742 Ga0207691_100347426 201
69 3300025945 Ga0207679_10799971 Ga0207679_107999712 201
70 3300026023 Ga0207677_10383589 Ga0207677_103835892 201
71 3300026035 Ga0207703_10735262 Ga0207703_107352622 201
72 3300026088 Ga0207641_10057522 Ga0207641_100575222 201
73 3300026088 Ga0207641_10149917 Ga0207641_101499173 201
74 3300026089 Ga0207648_10109236 Ga0207648_101092362 201
75 3300026095 Ga0207676_10361541 Ga0207676_103615412 201
76 3300026121 Ga0207683_10636938 Ga0207683_106369382 201
77 3300028577 Ga0265318_10095149 Ga0265318_100951491 201
78 3300031235 Ga0265330_10000344 Ga0265330_1000034418 201
79 3300031238 Ga0265332_10000002 Ga0265332_10000002308 201
80 3300031241 Ga0265325_10010778 Ga0265325_100107784 201
81 3300031711 Ga0265314_10000012 Ga0265314_1000001277 201
82 3300031712 Ga0265342_10137520 Ga0265342_101375202 201
83 3300005841 Ga0068863_100047596 Ga0068863_1000475962 202
84 3300026088 Ga0207641_10137763 Ga0207641_101377632 202
85 3300031548 Ga0307408_100842451 Ga0307408_1008424512 202
86 3300031903 Ga0307407_10128376 Ga0307407_101283762 202
87 3300031911 Ga0307412_10172681 Ga0307412_101726812 202
88 3300031995 Ga0307409_100023723 Ga0307409_1000237232 202
89 3300032126 Ga0307415_100005787 Ga0307415_1000057876 202
90 3300037471 Ga0395905_0064674 Ga0395905_0064674_884_1528 202
91 3300003320 rootH2_10003527 rootH2_100035275 203
92 3300003322 rootL2_10001454 rootL2_1000145417 203
93 3300003323 rootH1_10003240 rootH1_1000324024 203
94 3300003323 rootH1_10074149 rootH1_100741493 203
95 3300003771 Ga0055526_1001415 Ga0055526_100141515 203
96 3300003775 Ga0055524_1000583 Ga0055524_100058318 203
97 3300003775 Ga0055524_1000632 Ga0055524_10006328 203
98 3300003775 Ga0055524_1005356 Ga0055524_10053565 203
99 3300003794 Ga0055531_10001279 Ga0055531_1000127918 203
100 3300003794 Ga0055531_10019645 Ga0055531_100196453 203
101 3300004625 Ga0055543_1004354 Ga0055543_10043543 203
102 3300005262 Ga0065165_1000024 Ga0065165_1000024108 203
103 3300005327 Ga0070658_10153359 Ga0070658_101533592 203
104 3300005328 Ga0070676_10032497 Ga0070676_100324974 203
105 3300005328 Ga0070676_10094772 Ga0070676_100947722 203
106 3300005328 Ga0070676_10458262 Ga0070676_104582621 203
107 3300005330 Ga0070690_100008484 Ga0070690_1000084843 203
108 3300005331 Ga0070670_100031821 Ga0070670_1000318212 203
109 3300005331 Ga0070670_100031847 Ga0070670_1000318474 203
110 3300005331 Ga0070670_100239530 Ga0070670_1002395302 203
111 3300005331 Ga0070670_100320268 Ga0070670_1003202682 203
112 3300005333 Ga0070677_10034580 Ga0070677_100345802 203
113 3300005333 Ga0070677_10314110 Ga0070677_103141101 203
114 3300005334 Ga0068869_100021031 Ga0068869_1000210312 203
115 3300005335 Ga0070666_10042499 Ga0070666_100424992 203
116 3300005335 Ga0070666_10066977 Ga0070666_100669772 203
117 3300005338 Ga0068868_100011186 Ga0068868_1000111865 203
118 3300005338 Ga0068868_100019427 Ga0068868_1000194276 203
119 3300005338 Ga0068868_101046668 Ga0068868_1010466681 203
120 3300005339 Ga0070660_100074568 Ga0070660_1000745682 203
121 3300005343 Ga0070687_100048247 Ga0070687_1000482472 203
122 3300005344 Ga0070661_100526676 Ga0070661_1005266762 203
123 3300005347 Ga0070668_100001397 Ga0070668_10000139719 203
124 3300005353 Ga0070669_100093615 Ga0070669_1000936152 203
125 3300005353 Ga0070669_100157673 Ga0070669_1001576731 203
126 3300005353 Ga0070669_100177198 Ga0070669_1001771981 203
127 3300005354 Ga0070675_100036414 Ga0070675_1000364142 203
128 3300005354 Ga0070675_100065666 Ga0070675_1000656663 203
129 3300005354 Ga0070675_100104680 Ga0070675_1001046802 203
130 3300005354 Ga0070675_100124967 Ga0070675_1001249673 203
131 3300005354 Ga0070675_100512785 Ga0070675_1005127852 203
132 3300005355 Ga0070671_100016332 Ga0070671_1000163326 203
133 3300005355 Ga0070671_100129532 Ga0070671_1001295322 203
134 3300005355 Ga0070671_100176614 Ga0070671_1001766142 203
135 3300005355 Ga0070671_100317007 Ga0070671_1003170072 203
136 3300005356 Ga0070674_100010482 Ga0070674_1000104826 203
137 3300005356 Ga0070674_100020727 Ga0070674_1000207272 203
138 3300005356 Ga0070674_100104530 Ga0070674_1001045302 203
139 3300005356 Ga0070674_100912887 Ga0070674_1009128872 203
140 3300005364 Ga0070673_100038766 Ga0070673_1000387662 203
141 3300005364 Ga0070673_100276447 Ga0070673_1002764472 203
142 3300005364 Ga0070673_100595761 Ga0070673_1005957612 203
143 3300005365 Ga0070688_100318854 Ga0070688_1003188542 203
144 3300005365 Ga0070688_100360287 Ga0070688_1003602871 203
145 3300005366 Ga0070659_100012819 Ga0070659_1000128194 203
146 3300005367 Ga0070667_100128762 Ga0070667_1001287622 203
147 3300005367 Ga0070667_100531451 Ga0070667_1005314512 203
148 3300005367 Ga0070667_100789883 Ga0070667_1007898832 203
149 3300005438 Ga0070701_10233997 Ga0070701_102339972 203
150 3300005455 Ga0070663_100403733 Ga0070663_1004037332 203
151 3300005455 Ga0070663_100447059 Ga0070663_1004470592 203
152 3300005456 Ga0070678_100051960 Ga0070678_1000519602 203
153 3300005456 Ga0070678_100137458 Ga0070678_1001374582 203
154 3300005456 Ga0070678_100498604 Ga0070678_1004986041 203
155 3300005456 Ga0070678_100545753 Ga0070678_1005457531 203
156 3300005457 Ga0070662_100004781 Ga0070662_1000047815 203
157 3300005457 Ga0070662_100440965 Ga0070662_1004409652 203
158 3300005459 Ga0068867_100001670 Ga0068867_10000167013 203
159 3300005459 Ga0068867_100013320 Ga0068867_1000133202 203
160 3300005459 Ga0068867_100027719 Ga0068867_1000277192 203
161 3300005459 Ga0068867_100440708 Ga0068867_1004407081 203
162 3300005467 Ga0070706_100000388 Ga0070706_1000003889 203
163 3300005539 Ga0068853_100020855 Ga0068853_1000208556 203
164 3300005539 Ga0068853_100561748 Ga0068853_1005617482 203
165 3300005543 Ga0070672_100012480 Ga0070672_1000124804 203
166 3300005543 Ga0070672_100019005 Ga0070672_1000190054 203
167 3300005543 Ga0070672_100033357 Ga0070672_1000333573 203
168 3300005543 Ga0070672_100102564 Ga0070672_1001025642 203
169 3300005544 Ga0070686_100740068 Ga0070686_1007400681 203
170 3300005564 Ga0070664_100211415 Ga0070664_1002114151 203
171 3300005564 Ga0070664_100426239 Ga0070664_1004262392 203
172 3300005577 Ga0068857_100112387 Ga0068857_1001123872 203
173 3300005578 Ga0068854_100075713 Ga0068854_1000757132 203
174 3300005578 Ga0068854_100206316 Ga0068854_1002063162 203
175 3300005614 Ga0068856_100088244 Ga0068856_1000882442 203
176 3300005615 Ga0070702_100038663 Ga0070702_1000386634 203
177 3300005616 Ga0068852_100002342 Ga0068852_1000023423 203
178 3300005616 Ga0068852_100013873 Ga0068852_1000138735 203
179 3300005616 Ga0068852_100021650 Ga0068852_1000216506 203
180 3300005618 Ga0068864_100538190 Ga0068864_1005381902 203
181 3300005718 Ga0068866_10006058 Ga0068866_100060582 203
182 3300005719 Ga0068861_100004282 Ga0068861_1000042827 203
183 3300005719 Ga0068861_100035769 Ga0068861_1000357694 203
184 3300005834 Ga0068851_10007641 Ga0068851_100076416 203
185 3300005840 Ga0068870_10059449 Ga0068870_100594492 203
186 3300005840 Ga0068870_10075153 Ga0068870_100751532 203
187 3300005841 Ga0068863_100033604 Ga0068863_1000336042 203
188 3300005841 Ga0068863_100162171 Ga0068863_1001621712 203
189 3300005841 Ga0068863_100654907 Ga0068863_1006549072 203
190 3300005842 Ga0068858_100006422 Ga0068858_1000064226 203
191 3300005842 Ga0068858_100046142 Ga0068858_1000461426 203
192 3300005842 Ga0068858_100047409 Ga0068858_1000474092 203
193 3300005843 Ga0068860_100020361 Ga0068860_1000203614 203
194 3300005843 Ga0068860_100038019 Ga0068860_1000380192 203
195 3300005844 Ga0068862_100087607 Ga0068862_1000876072 203
196 3300005844 Ga0068862_101175313 Ga0068862_1011753132 203
197 3300006042 Ga0075368_10109924 Ga0075368_101099242 203
198 3300006048 Ga0075363_100031855 Ga0075363_1000318552 203
199 3300006051 Ga0075364_10403967 Ga0075364_104039672 203
200 3300006178 Ga0075367_10071974 Ga0075367_100719742 203
201 3300006195 Ga0075366_10030863 Ga0075366_100308633 203
202 3300006195 Ga0075366_10061793 Ga0075366_100617932 203
203 3300006237 Ga0097621_100150780 Ga0097621_1001507802 203
204 3300006353 Ga0075370_10074619 Ga0075370_100746192 203
205 3300006358 Ga0068871_100069971 Ga0068871_1000699712 203
206 3300006871 Ga0075434_100427884 Ga0075434_1004278842 203
207 3300006881 Ga0068865_100015377 Ga0068865_1000153776 203
208 3300006881 Ga0068865_100235311 Ga0068865_1002353112 203
209 3300006944 Ga0099823_1003766 Ga0099823_100376615 203
210 3300007076 Ga0075435_100118395 Ga0075435_1001183952 203
211 3300009098 Ga0105245_10008645 Ga0105245_1000864510 203
212 3300009098 Ga0105245_10195835 Ga0105245_101958353 203
213 3300009148 Ga0105243_10085514 Ga0105243_100855142 203
214 3300009148 Ga0105243_10338670 Ga0105243_103386702 203
215 3300009148 Ga0105243_10929338 Ga0105243_109293382 203
216 3300009177 Ga0105248_10010384 Ga0105248_100103847 203
217 3300009177 Ga0105248_10223138 Ga0105248_102231382 203
218 3300009177 Ga0105248_10588206 Ga0105248_105882062 203
219 3300009551 Ga0105238_10018905 Ga0105238_100189056 203
220 3300009553 Ga0105249_11097357 Ga0105249_110973571 203
221 3300012497 Ga0157319_1000001 Ga0157319_10000014 203
222 3300013104 Ga0157370_10827754 Ga0157370_108277542 203
223 3300013105 Ga0157369_10315473 Ga0157369_103154732 203
224 3300013105 Ga0157369_11007943 Ga0157369_110079432 203
225 3300013297 Ga0157378_10225791 Ga0157378_102257912 203
226 3300013306 Ga0163162_10059244 Ga0163162_100592444 203
227 3300013306 Ga0163162_10266175 Ga0163162_102661752 203
228 3300013307 Ga0157372_10022443 Ga0157372_100224438 203
229 3300013308 Ga0157375_10088676 Ga0157375_100886762 203
230 3300013308 Ga0157375_10173858 Ga0157375_101738582 203
231 3300013308 Ga0157375_10193123 Ga0157375_101931232 203
232 3300013308 Ga0157375_10372738 Ga0157375_103727382 203
233 3300013308 Ga0157375_10716809 Ga0157375_107168092 203
234 3300014326 Ga0157380_10004553 Ga0157380_100045536 203
235 3300014326 Ga0157380_10011560 Ga0157380_100115606 203
236 3300014745 Ga0157377_10002433 Ga0157377_100024338 203
237 3300014968 Ga0157379_10025811 Ga0157379_100258112 203
238 3300014968 Ga0157379_10524262 Ga0157379_105242622 203
239 3300014969 Ga0157376_10005021 Ga0157376_1000502110 203
240 3300014969 Ga0157376_10358511 Ga0157376_103585112 203
241 3300017792 Ga0163161_10018036 Ga0163161_100180366 203
242 3300017792 Ga0163161_10055046 Ga0163161_100550462 203
243 3300017792 Ga0163161_10799671 Ga0163161_107996712 203
244 3300025273 Ga0209673_1007212 Ga0209673_10072125 203
245 3300025273 Ga0209673_1021856 Ga0209673_10218563 203
246 3300025295 Ga0209564_1000005 Ga0209564_1000005494 203
247 3300025299 Ga0209256_1000767 Ga0209256_100076724 203
248 3300025299 Ga0209256_1001313 Ga0209256_100131331 203
249 3300025299 Ga0209256_1039718 Ga0209256_10397182 203
250 3300025303 Ga0209051_1003662 Ga0209051_10036627 203
251 3300025304 Ga0209257_1000990 Ga0209257_100099023 203
252 3300025304 Ga0209257_1002294 Ga0209257_100229422 203
253 3300025315 Ga0207697_10216185 Ga0207697_102161852 203
254 3300025321 Ga0207656_10083798 Ga0207656_100837982 203
255 3300025893 Ga0207682_10028273 Ga0207682_100282732 203
256 3300025893 Ga0207682_10042718 Ga0207682_100427182 203
257 3300025893 Ga0207682_10061978 Ga0207682_100619782 203
258 3300025901 Ga0207688_10060902 Ga0207688_100609022 203
259 3300025901 Ga0207688_10074391 Ga0207688_100743912 203
260 3300025907 Ga0207645_10004843 Ga0207645_100048439 203
261 3300025907 Ga0207645_10028889 Ga0207645_100288894 203
262 3300025907 Ga0207645_10307889 Ga0207645_103078892 203
263 3300025908 Ga0207643_10035653 Ga0207643_100356533 203
264 3300025909 Ga0207705_10412283 Ga0207705_104122832 203
265 3300025918 Ga0207662_10054937 Ga0207662_100549372 203
266 3300025919 Ga0207657_10027817 Ga0207657_100278173 203
267 3300025919 Ga0207657_10154974 Ga0207657_101549741 203
268 3300025920 Ga0207649_10592056 Ga0207649_105920562 203
269 3300025923 Ga0207681_10003695 Ga0207681_100036959 203
270 3300025924 Ga0207694_10065979 Ga0207694_100659793 203
271 3300025925 Ga0207650_10066144 Ga0207650_100661442 203
272 3300025925 Ga0207650_10106487 Ga0207650_101064872 203
273 3300025925 Ga0207650_10221301 Ga0207650_102213012 203
274 3300025925 Ga0207650_10776745 Ga0207650_107767451 203
275 3300025926 Ga0207659_10013231 Ga0207659_100132316 203
276 3300025926 Ga0207659_10018641 Ga0207659_100186412 203
277 3300025926 Ga0207659_10032482 Ga0207659_100324824 203
278 3300025927 Ga0207687_10136113 Ga0207687_101361131 203
279 3300025931 Ga0207644_10046482 Ga0207644_100464823 203
280 3300025931 Ga0207644_10202541 Ga0207644_102025412 203
281 3300025931 Ga0207644_10344893 Ga0207644_103448932 203
282 3300025931 Ga0207644_10687902 Ga0207644_106879022 203
283 3300025931 Ga0207644_10731487 Ga0207644_107314872 203
284 3300025932 Ga0207690_10086195 Ga0207690_100861953 203
285 3300025933 Ga0207706_10012717 Ga0207706_100127178 203
286 3300025933 Ga0207706_10016241 Ga0207706_100162416 203
287 3300025935 Ga0207709_10001791 Ga0207709_100017916 203
288 3300025935 Ga0207709_10009056 Ga0207709_100090563 203
289 3300025935 Ga0207709_10197351 Ga0207709_101973512 203
290 3300025935 Ga0207709_10561338 Ga0207709_105613382 203
291 3300025937 Ga0207669_10006635 Ga0207669_100066352 203
292 3300025937 Ga0207669_10222460 Ga0207669_102224602 203
293 3300025937 Ga0207669_10401340 Ga0207669_104013402 203
294 3300025938 Ga0207704_10012471 Ga0207704_100124715 203
295 3300025938 Ga0207704_10198640 Ga0207704_101986402 203
296 3300025940 Ga0207691_10022193 Ga0207691_100221933 203
297 3300025940 Ga0207691_10023049 Ga0207691_100230495 203
298 3300025940 Ga0207691_10033193 Ga0207691_100331935 203
299 3300025940 Ga0207691_10033246 Ga0207691_100332462 203
300 3300025940 Ga0207691_10134082 Ga0207691_101340823 203
301 3300025940 Ga0207691_10134169 Ga0207691_101341692 203
302 3300025941 Ga0207711_10093160 Ga0207711_100931602 203
303 3300025941 Ga0207711_10109659 Ga0207711_101096592 203
304 3300025941 Ga0207711_10141921 Ga0207711_101419213 203
305 3300025942 Ga0207689_10001429 Ga0207689_100014296 203
306 3300025942 Ga0207689_10012424 Ga0207689_100124243 203
307 3300025945 Ga0207679_10112660 Ga0207679_101126602 203
308 3300025945 Ga0207679_11065686 Ga0207679_110656862 203
309 3300025949 Ga0207667_10050606 Ga0207667_100506062 203
310 3300025960 Ga0207651_10006261 Ga0207651_100062613 203
311 3300025960 Ga0207651_10648348 Ga0207651_106483482 203
312 3300025972 Ga0207668_10419443 Ga0207668_104194432 203
313 3300025981 Ga0207640_10032954 Ga0207640_100329542 203
314 3300025986 Ga0207658_10162165 Ga0207658_101621652 203
315 3300026023 Ga0207677_10029151 Ga0207677_100291513 203
316 3300026023 Ga0207677_10421183 Ga0207677_104211832 203
317 3300026035 Ga0207703_10019182 Ga0207703_100191826 203
318 3300026035 Ga0207703_10105189 Ga0207703_101051892 203
319 3300026035 Ga0207703_10220216 Ga0207703_102202162 203
320 3300026041 Ga0207639_10069404 Ga0207639_100694042 203
321 3300026041 Ga0207639_10179844 Ga0207639_101798442 203
322 3300026067 Ga0207678_10035138 Ga0207678_100351385 203
323 3300026067 Ga0207678_10253242 Ga0207678_102532422 203
324 3300026067 Ga0207678_10468518 Ga0207678_104685182 203
325 3300026067 Ga0207678_10657450 Ga0207678_106574502 203
326 3300026078 Ga0207702_10029676 Ga0207702_100296766 203
327 3300026088 Ga0207641_10039250 Ga0207641_100392502 203
328 3300026088 Ga0207641_10790446 Ga0207641_107904462 203
329 3300026088 Ga0207641_10977797 Ga0207641_109777972 203
330 3300026089 Ga0207648_10000115 Ga0207648_1000011554 203
331 3300026089 Ga0207648_10002367 Ga0207648_1000236714 203
332 3300026089 Ga0207648_10007133 Ga0207648_100071335 203
333 3300026089 Ga0207648_10037225 Ga0207648_100372253 203
334 3300026095 Ga0207676_10052821 Ga0207676_100528212 203
335 3300026095 Ga0207676_10502718 Ga0207676_105027182 203
336 3300026095 Ga0207676_10727915 Ga0207676_107279152 203
337 3300026095 Ga0207676_10821321 Ga0207676_108213212 203
338 3300026095 Ga0207676_10980787 Ga0207676_109807872 203
339 3300026116 Ga0207674_10014143 Ga0207674_100141432 203
340 3300026116 Ga0207674_10877099 Ga0207674_108770992 203
341 3300026118 Ga0207675_100000595 Ga0207675_1000005952 203
342 3300026118 Ga0207675_100000814 Ga0207675_10000081425 203
343 3300026121 Ga0207683_10017698 Ga0207683_100176985 203
344 3300026121 Ga0207683_10130883 Ga0207683_101308832 203
345 3300026121 Ga0207683_10238197 Ga0207683_102381972 203
346 3300026121 Ga0207683_10262615 Ga0207683_102626152 203
347 3300026121 Ga0207683_10382435 Ga0207683_103824351 203
348 3300026121 Ga0207683_11117800 Ga0207683_111178001 203
349 3300026142 Ga0207698_10016220 Ga0207698_100162203 203
350 3300026142 Ga0207698_10022258 Ga0207698_100222583 203
351 3300026142 Ga0207698_10165630 Ga0207698_101656302 203
352 3300026142 Ga0207698_10311886 Ga0207698_103118862 203
353 3300026142 Ga0207698_10429733 Ga0207698_104297332 203
354 3300027252 Ga0209973_1015957 Ga0209973_10159571 203
355 3300027296 Ga0209389_1015149 Ga0209389_10151492 203
356 3300027876 Ga0209974_10009563 Ga0209974_100095632 203
357 3300028380 Ga0268265_10074199 Ga0268265_100741992 203
358 3300028380 Ga0268265_10505451 Ga0268265_105054512 203
359 3300028381 Ga0268264_10092983 Ga0268264_100929832 203
360 3300028381 Ga0268264_10197504 Ga0268264_101975042 203
361 3300028381 Ga0268264_10468657 Ga0268264_104686572 203
362 3300028786 Ga0307517_10004912 Ga0307517_1000491214 203
363 3300028794 Ga0307515_10000652 Ga0307515_1000065245 203
364 3300028794 Ga0307515_10001063 Ga0307515_1000106324 203
365 3300028794 Ga0307515_10005581 Ga0307515_100055819 203
366 3300028794 Ga0307515_10095345 Ga0307515_100953453 203
367 3300028794 Ga0307515_10209656 Ga0307515_102096562 203
368 3300030522 Ga0307512_10036774 Ga0307512_100367745 203
369 3300031251 Ga0265327_10079841 Ga0265327_100798412 203
370 3300031456 Ga0307513_10028964 Ga0307513_100289644 203
371 3300031456 Ga0307513_10109212 Ga0307513_101092123 203
372 3300031456 Ga0307513_10128037 Ga0307513_101280373 203
373 3300031507 Ga0307509_10004147 Ga0307509_1000414712 203
374 3300031507 Ga0307509_10004183 Ga0307509_1000418316 203
375 3300031507 Ga0307509_10101786 Ga0307509_101017864 203
376 3300031507 Ga0307509_10197700 Ga0307509_101977002 203
377 3300031507 Ga0307509_10316734 Ga0307509_103167342 203
378 3300031548 Ga0307408_100201438 Ga0307408_1002014382 203
379 3300031548 Ga0307408_100537944 Ga0307408_1005379442 203
380 3300031616 Ga0307508_10000163 Ga0307508_100001634 203
381 3300031616 Ga0307508_10000385 Ga0307508_1000038525 203
382 3300031616 Ga0307508_10011794 Ga0307508_100117949 203
383 3300031616 Ga0307508_10329205 Ga0307508_103292052 203
384 3300031649 Ga0307514_10002111 Ga0307514_1000211118 203
385 3300031649 Ga0307514_10338710 Ga0307514_103387101 203
386 3300031730 Ga0307516_10000381 Ga0307516_1000038139 203
387 3300031731 Ga0307405_10019585 Ga0307405_100195855 203
388 3300031824 Ga0307413_10007656 Ga0307413_100076566 203
389 3300031852 Ga0307410_10017440 Ga0307410_100174405 203
390 3300031901 Ga0307406_10140953 Ga0307406_101409532 203
391 3300031903 Ga0307407_10262684 Ga0307407_102626842 203
392 3300031911 Ga0307412_10054105 Ga0307412_100541052 203
393 3300031995 Ga0307409_100002529 Ga0307409_1000025299 203
394 3300032002 Ga0307416_100071544 Ga0307416_1000715444 203
395 3300032002 Ga0307416_100357459 Ga0307416_1003574592 203
396 3300032126 Ga0307415_100056340 Ga0307415_1000563402 203
397 3300032126 Ga0307415_100502849 Ga0307415_1005028492 203
398 3300033179 Ga0307507_10199264 Ga0307507_101992642 203
399 3300033180 Ga0307510_10056403 Ga0307510_100564032 203
400 3300033180 Ga0307510_10148812 Ga0307510_101488122 203
401 3300035112 Ga0373932_0171284 Ga0373932_0171284_53_721 203
402 3300035115 Ga0373941_0027987 Ga0373941_0027987_122_742 203
403 3300035172 Ga0373955_0401646 Ga0373955_0401646_62_682 203
404 3300035691 Ga0373931_0004194 Ga0373931_0004194_1276_1896 203
405 3300035691 Ga0373931_0023887 Ga0373931_0023887_167_778 203
406 3300036401 Ga0373937_0089892 Ga0373937_0089892_617_1228 203
407 3300036401 Ga0373937_0112459 Ga0373937_0112459_342_962 203
408 3300039437 Ga0436365_0618815 Ga0436365_0618815_1773_2393 203
409 3300041451 Ga0451791_0590277 Ga0451791_0590277_45_656 203
410 3300041456 Ga0451795_0158714 Ga0451795_0158714_86_697 203
411 3300041460 Ga0451802_1063573 Ga0451802_1063573_535_1146 203
412 3300041486 Ga0451807_0895355 Ga0451807_0895355_222_833 203
413 3300041486 Ga0451807_1169175 Ga0451807_1169175_119_730 203
414 3300041496 Ga0451839_0734584 Ga0451839_0734584_356_967 203
415 3300041507 Ga0451851_0387925 Ga0451851_0387925_411_1022 203
416 3300042011 Ga0439454_002859 Ga0439454_002859_580_1191 203
417 3300042121 Ga0450919_001363 Ga0450919_001363_2165_2776 203
418 3300042125 Ga0450923_043732 Ga0450923_043732_276_887 203
419 3300042438 Ga0439459_0002941 Ga0439459_0002941_1467_2078 203
420 3300042531 Ga0450918_000059 Ga0450918_000059_6382_6993 203
421 3300042876 Ga0451577_0104026 Ga0451577_0104026_1023_1634 203
422 3300044694 Ga0466963_0023743 Ga0466963_0023743_370_981 203
423 3300044712 Ga0453684_0228294 Ga0453684_0228294_53_664 203
424 3300045051 Ga0451576_0037564 Ga0451576_0037564_3293_3913 203
425 3300046512 Ga0495610_0017946 Ga0495610_0017946_123_734 203
426 3300046514 Ga0495618_0127517 Ga0495618_0127517_172_783 203
427 3300046517 Ga0495630_0197903 Ga0495630_0197903_388_999 203
428 3300046519 Ga0495632_0119730 Ga0495632_0119730_171_782 203
429 3300046524 Ga0495648_0063897 Ga0495648_0063897_565_1176 203
430 3300046660 Ga0495625_0002324 Ga0495625_0002324_11739_12350 203
431 3300046660 Ga0495625_0098618 Ga0495625_0098618_753_1364 203
432 3300046683 Ga0495658_0016346 Ga0495658_0016346_1158_1772 203
433 3300046683 Ga0495658_0289786 Ga0495658_0289786_150_770 203
434 3300046690 Ga0495624_0027325 Ga0495624_0027325_1263_1874 203
435 3300046691 Ga0495670_0008089 Ga0495670_0008089_646_1257 203
436 3300047321 Ga0495676_0025847 Ga0495676_0025847_2509_3120 203
437 3300047470 Ga0495681_0165643 Ga0495681_0165643_121_741 203
438 3300047673 Ga0495593_0024903 Ga0495593_0024903_2169_2780 203
439 3300048904 Ga0496101_0012290 Ga0496101_0012290_2909_3529 203
440 3300048905 Ga0496102_0004670 Ga0496102_0004670_5406_6017 203
441 3300048905 Ga0496102_0063249 Ga0496102_0063249_192_812 203
442 3300048908 Ga0496105_0683180 Ga0496105_0683180_61_681 203
443 3300048909 Ga0496106_0002144 Ga0496106_0002144_10745_11356 203
444 3300048909 Ga0496106_0014626 Ga0496106_0014626_2831_3451 203
445 3300048910 Ga0496107_0227846 Ga0496107_0227846_324_944 203
446 3300048912 Ga0496109_0072741 Ga0496109_0072741_2098_2718 203
447 3300048913 Ga0496110_0032378 Ga0496110_0032378_142_762 203
448 3300048914 Ga0496111_0464573 Ga0496111_0464573_190_810 203
449 3300048915 Ga0496112_0082239 Ga0496112_0082239_445_1065 203
450 3300048916 Ga0496113_0035270 Ga0496113_0035270_749_1369 203
451 3300048917 Ga0496114_0032690 Ga0496114_0032690_3335_3955 203
452 3300048917 Ga0496114_0626550 Ga0496114_0626550_47_667 203
453 3300048924 Ga0496121_0550840 Ga0496121_0550840_48_659 203
454 3300048929 Ga0496126_0105046 Ga0496126_0105046_1489_2100 203
455 3300050490 nmdc:mga03n38_70019_c1 nmdc:mga03n38_70019_c1_178_789 203
456 3300050493 nmdc:mga0k408_232697_c1 nmdc:mga0k408_232697_c1_46_681 203
457 3300050493 nmdc:mga0k408_56639_c1 nmdc:mga0k408_56639_c1_118_735 203
458 3300050494 nmdc:mga06z11_244083_c1 nmdc:mga06z11_244083_c1_117_728 203
459 3300050496 nmdc:mga07m45_15470_c1 nmdc:mga07m45_15470_c1_472_1083 203
460 3300050513 nmdc:mga0rr50_132627_c1 nmdc:mga0rr50_132627_c1_946_1566 203
461 3300053092 Ga0500583_0093618 Ga0500583_0093618_271_885 203
462 3300053154 Ga0500619_000022 Ga0500619_000022_44073_44684 203
463 3300053156 Ga0500622_0002013 Ga0500622_0002013_13297_13908 203
464 3300005330 Ga0070690_100015438 Ga0070690_1000154383 204
465 3300005331 Ga0070670_100016508 Ga0070670_1000165085 204
466 3300005331 Ga0070670_100138098 Ga0070670_1001380982 204
467 3300005333 Ga0070677_10005552 Ga0070677_100055525 204
468 3300005334 Ga0068869_100010437 Ga0068869_1000104373 204
469 3300005335 Ga0070666_10004785 Ga0070666_100047856 204
470 3300005335 Ga0070666_10139135 Ga0070666_101391352 204
471 3300005338 Ga0068868_100021348 Ga0068868_1000213485 204
472 3300005340 Ga0070689_100033724 Ga0070689_1000337243 204
473 3300005344 Ga0070661_100054069 Ga0070661_1000540694 204
474 3300005347 Ga0070668_100050633 Ga0070668_1000506332 204
475 3300005354 Ga0070675_100001074 Ga0070675_10000107415 204
476 3300005354 Ga0070675_100040906 Ga0070675_1000409062 204
477 3300005355 Ga0070671_100012181 Ga0070671_1000121812 204
478 3300005356 Ga0070674_100646059 Ga0070674_1006460591 204
479 3300005364 Ga0070673_100003123 Ga0070673_1000031237 204
480 3300005365 Ga0070688_100029186 Ga0070688_1000291862 204
481 3300005367 Ga0070667_100002896 Ga0070667_1000028965 204
482 3300005456 Ga0070678_100005243 Ga0070678_1000052436 204
483 3300005456 Ga0070678_100457609 Ga0070678_1004576092 204
484 3300005457 Ga0070662_100139249 Ga0070662_1001392492 204
485 3300005459 Ga0068867_100050623 Ga0068867_1000506234 204
486 3300005459 Ga0068867_100199674 Ga0068867_1001996742 204
487 3300005543 Ga0070672_100050430 Ga0070672_1000504305 204
488 3300005543 Ga0070672_100503673 Ga0070672_1005036732 204
489 3300005544 Ga0070686_100133155 Ga0070686_1001331552 204
490 3300005564 Ga0070664_100229315 Ga0070664_1002293152 204
491 3300005564 Ga0070664_100561621 Ga0070664_1005616212 204
492 3300005614 Ga0068856_100007479 Ga0068856_1000074794 204
493 3300005617 Ga0068859_100008331 Ga0068859_1000083317 204
494 3300005618 Ga0068864_100005602 Ga0068864_1000056027 204
495 3300005719 Ga0068861_100476271 Ga0068861_1004762712 204
496 3300005834 Ga0068851_10137676 Ga0068851_101376762 204
497 3300005840 Ga0068870_10173291 Ga0068870_101732912 204
498 3300005840 Ga0068870_10465951 Ga0068870_104659512 204
499 3300005841 Ga0068863_100011592 Ga0068863_1000115927 204
500 3300005842 Ga0068858_100002455 Ga0068858_10000245515 204
501 3300005843 Ga0068860_100065038 Ga0068860_1000650383 204
502 3300005844 Ga0068862_100153731 Ga0068862_1001537312 204
503 3300006353 Ga0075370_10242268 Ga0075370_102422682 204
504 3300006358 Ga0068871_100008050 Ga0068871_1000080507 204
505 3300006358 Ga0068871_100201166 Ga0068871_1002011662 204
506 3300006881 Ga0068865_100038189 Ga0068865_1000381893 204
507 3300006931 Ga0097620_100008331 Ga0097620_1000083317 204
508 3300009176 Ga0105242_10191510 Ga0105242_101915102 204
509 3300009553 Ga0105249_10246893 Ga0105249_102468932 204
510 3300013296 Ga0157374_10037506 Ga0157374_100375063 204
511 3300013306 Ga0163162_10017073 Ga0163162_100170736 204
512 3300013306 Ga0163162_10521408 Ga0163162_105214082 204
513 3300013308 Ga0157375_10087312 Ga0157375_100873122 204
514 3300013308 Ga0157375_10540579 Ga0157375_105405792 204
515 3300014325 Ga0163163_10007006 Ga0163163_100070063 204
516 3300014326 Ga0157380_10123026 Ga0157380_101230262 204
517 3300014968 Ga0157379_10059469 Ga0157379_100594692 204
518 3300025321 Ga0207656_10062707 Ga0207656_100627072 204
519 3300025893 Ga0207682_10275181 Ga0207682_102751812 204
520 3300025903 Ga0207680_10003607 Ga0207680_100036074 204
521 3300025908 Ga0207643_10174656 Ga0207643_101746562 204
522 3300025918 Ga0207662_10208347 Ga0207662_102083472 204
523 3300025923 Ga0207681_10049975 Ga0207681_100499753 204
524 3300025925 Ga0207650_10020396 Ga0207650_100203962 204
525 3300025925 Ga0207650_10043137 Ga0207650_100431373 204
526 3300025925 Ga0207650_10518117 Ga0207650_105181171 204
527 3300025926 Ga0207659_10010349 Ga0207659_100103492 204
528 3300025931 Ga0207644_10017836 Ga0207644_100178362 204
529 3300025933 Ga0207706_10087115 Ga0207706_100871154 204
530 3300025934 Ga0207686_10192865 Ga0207686_101928652 204
531 3300025936 Ga0207670_10022243 Ga0207670_100222434 204
532 3300025937 Ga0207669_10103034 Ga0207669_101030342 204
533 3300025937 Ga0207669_10276161 Ga0207669_102761612 204
534 3300025940 Ga0207691_10043476 Ga0207691_100434762 204
535 3300025940 Ga0207691_10131329 Ga0207691_101313293 204
536 3300025940 Ga0207691_10184828 Ga0207691_101848282 204
537 3300025941 Ga0207711_10167418 Ga0207711_101674183 204
538 3300025942 Ga0207689_10048915 Ga0207689_100489153 204
539 3300025945 Ga0207679_10086588 Ga0207679_100865882 204
540 3300025945 Ga0207679_10528849 Ga0207679_105288492 204
541 3300025972 Ga0207668_10190360 Ga0207668_101903602 204
542 3300025981 Ga0207640_10353060 Ga0207640_103530602 204
543 3300025986 Ga0207658_10003143 Ga0207658_1000314310 204
544 3300026023 Ga0207677_10001922 Ga0207677_100019229 204
545 3300026035 Ga0207703_10002152 Ga0207703_1000215212 204
546 3300026078 Ga0207702_10009730 Ga0207702_100097302 204
547 3300026088 Ga0207641_10001478 Ga0207641_100014787 204
548 3300026089 Ga0207648_10034806 Ga0207648_100348062 204
549 3300026089 Ga0207648_10105584 Ga0207648_101055843 204
550 3300026095 Ga0207676_10005107 Ga0207676_100051077 204
551 3300026118 Ga0207675_100042538 Ga0207675_1000425383 204
552 3300026118 Ga0207675_100160711 Ga0207675_1001607112 204
553 3300026121 Ga0207683_10011209 Ga0207683_100112095 204
554 3300026142 Ga0207698_10070787 Ga0207698_100707872 204
555 3300028381 Ga0268264_10067137 Ga0268264_100671373 204
556 3300037068 Ga0373925_0340305 Ga0373925_0340305_409_1023 204
557 3300041505 Ga0451849_0341148 Ga0451849_0341148_39_677 204
558 3300046681 Ga0495647_0063978 Ga0495647_0063978_91_705 204
559 3300048903 Ga0496100_0364902 Ga0496100_0364902_334_948 204
560 3300048907 Ga0496104_0401427 Ga0496104_0401427_329_943 204
561 3300048911 Ga0496108_1057641 Ga0496108_1057641_58_672 204
562 3300048917 Ga0496114_0289600 Ga0496114_0289600_671_1285 204
563 3300042876 Ga0451577_0027133 Ga0451577_0027133_2549_3175 205
564 iso_pu_bacteria 2885192300 2885192570 206
565 iso_pu_bacteria 2842747753 2842751525 207
566 iso_pu_bacteria 2945909444 2945912121 207
567 iso_pu_bacteria 2945984333 2945985594 207
568 iso_pu_bacteria 2954767861 2954772138 207
569 iso_pu_bacteria 2513020051 2513226420 208
570 iso_pu_bacteria 2643221628 2644163325 208
571 iso_pu_bacteria 2643221658 2644327814 208
572 iso_pu_bacteria 2643221672 2644400509 208
573 iso_pu_bacteria 2818991446 2819597454 208
574 iso_pu_bacteria 2831265667 2831266632 208
575 iso_pu_bacteria 2838054893 2838057289 208
576 iso_pu_bacteria 2842677519 2842679570 208
577 iso_pu_bacteria 2899924645 2899924964 208
578 iso_pu_bacteria 2904449895 2904455669 208
579 iso_pu_bacteria 2904456579 2904462821 208
580 iso_pu_bacteria 2904479285 2904482564 208
581 iso_pu_bacteria 2919462493 2919467334 208
582 iso_pu_bacteria 2928037797 2928038912 208
583 iso_pu_bacteria 2928044640 2928045483 208
584 iso_pu_bacteria 2928051484 2928058380 208
585 iso_pu_bacteria 2928064002 2928064039 208
586 iso_pu_bacteria 2928084124 2928084647 208
587 iso_pu_bacteria 2929520902 2929522657 208
588 iso_pu_bacteria 2945972063 2945977337 208
589 3300005577 Ga0068857_100298797 Ga0068857_1002987972 209
590 3300014497 Ga0182008_10121730 Ga0182008_101217302 209
591 3300026116 Ga0207674_10351268 Ga0207674_103512682 209
592 iso_pu_bacteria 2842733646 2842734861 209
593 3300003320 rootH2_10072340 rootH2_100723402 210
594 3300005844 Ga0068862_100064391 Ga0068862_1000643912 210
595 3300028380 Ga0268265_10121140 Ga0268265_101211402 210
596 3300031251 Ga0265327_10006203 Ga0265327_100062035 210
597 3300031456 Ga0307513_10464070 Ga0307513_104640702 210
598 3300042006 Ga0439432_072444 Ga0439432_072444_304_945 210
599 3300042007 Ga0439449_0003523 Ga0439449_0003523_2695_3336 210
600 3300050492 nmdc:mga0yw44_174365_c1 nmdc:mga0yw44_174365_c1_280_912 210
601 3300053079 Ga0500610_0075277 Ga0500610_0075277_853_1497 210
602 iso_pu_bacteria 2885198086 2885201345 210
603 iso_pu_bacteria 2885211737 2885214973 210
604 3300005327 Ga0070658_10020838 Ga0070658_100208385 211
605 3300005353 Ga0070669_100045955 Ga0070669_1000459552 211
606 3300006177 Ga0075362_10089147 Ga0075362_100891472 211
607 3300013104 Ga0157370_10453641 Ga0157370_104536412 211
608 3300017792 Ga0163161_10000578 Ga0163161_1000057818 211
609 3300025909 Ga0207705_10067743 Ga0207705_100677432 211
610 3300025923 Ga0207681_10064872 Ga0207681_100648722 211
611 3300026121 Ga0207683_10726588 Ga0207683_107265881 211
612 3300030522 Ga0307512_10152045 Ga0307512_101520452 211
613 3300031238 Ga0265332_10000094 Ga0265332_1000009424 211
614 3300031456 Ga0307513_10138268 Ga0307513_101382682 211
615 3300031548 Ga0307408_100849166 Ga0307408_1008491661 211
616 3300031911 Ga0307412_10010332 Ga0307412_100103328 211
617 3300041404 Ga0439436_0000212 Ga0439436_0000212_10554_11195 211
618 3300041406 Ga0439439_0004076 Ga0439439_0004076_2205_2846 211
619 3300041411 Ga0439466_0015553 Ga0439466_0015553_379_1020 211
620 3300041413 Ga0439465_0001922 Ga0439465_0001922_2603_3244 211
621 3300041997 Ga0439431_0005958 Ga0439431_0005958_1527_2168 211
622 3300041999 Ga0439433_0000802 Ga0439433_0000802_1282_1923 211
623 3300042006 Ga0439432_005007 Ga0439432_005007_1499_2140 211
624 3300042007 Ga0439449_0000162 Ga0439449_0000162_6163_6804 211
625 3300042010 Ga0439452_000749 Ga0439452_000749_2775_3416 211
626 3300042015 Ga0439462_0004283 Ga0439462_0004283_177_818 211
627 3300042156 Ga0439446_0025651 Ga0439446_0025651_251_892 211
628 3300042435 Ga0439434_0004431 Ga0439434_0004431_2979_3620 211
629 3300046453 Ga0495627_007076 Ga0495627_007076_1326_1985 211
630 3300046512 Ga0495610_0038244 Ga0495610_0038244_1216_1875 211
631 3300046520 Ga0495637_0008897 Ga0495637_0008897_2107_2766 211
632 3300046530 Ga0495654_0069440 Ga0495654_0069440_403_1062 211
633 3300046558 Ga0495633_0086478 Ga0495633_0086478_474_1133 211
634 3300046674 Ga0495588_0032582 Ga0495588_0032582_1273_1932 211
635 3300046691 Ga0495670_0156247 Ga0495670_0156247_22_681 211
636 3300046692 Ga0495671_0001783 Ga0495671_0001783_11243_11902 211
637 3300046810 Ga0495660_0107457 Ga0495660_0107457_499_1158 211
638 3300048927 Ga0496124_0278254 Ga0496124_0278254_458_1093 211
639 3300048929 Ga0496126_0434354 Ga0496126_0434354_278_913 211
640 3300053079 Ga0500610_0002251 Ga0500610_0002251_5361_6020 211
641 3300053079 Ga0500610_0033483 Ga0500610_0033483_980_1639 211
642 3300053096 Ga0500641_0197200 Ga0500641_0197200_177_836 211
643 3300053117 Ga0500593_019315 Ga0500593_019315_557_1216 211
644 3300053121 Ga0500607_000328 Ga0500607_000328_18060_18719 211
645 3300053158 Ga0500627_0001126 Ga0500627_0001126_2234_2893 211
646 iso_pu_bacteria 2547132374 2548500950 211
647 iso_pu_bacteria 2599185214 2599626500 211
648 iso_pu_bacteria 2599185226 2599675564 211
649 iso_pu_bacteria 2599185227 2599684037 211
650 iso_pu_bacteria 2599185229 2599696051 211
651 iso_pu_bacteria 2643221570 2643865578 211
652 iso_pu_bacteria 2643221596 2643993410 211
653 iso_pu_bacteria 2643221652 2644294539 211
654 iso_pu_bacteria 2643221717 2644646202 211
655 iso_pu_bacteria 2904541872 2904544910 211
656 iso_pu_bacteria 2928070936 2928071412 211
657 iso_pu_bacteria 2929160207 2929163420 211
658 iso_pu_bacteria 2945945610 2945947818 211
659 iso_pu_bacteria 2990710928 2990712646 211
660 3300002774 JGI25150J39212_1000384 JGI25150J39212_10003842 212
661 3300002987 JGI25159J45721_1000103 JGI25159J45721_100010340 212
662 3300002987 JGI25159J45721_1004784 JGI25159J45721_10047845 212
663 3300003187 JGI25151J46595_10015382 JGI25151J46595_100153822 212
664 3300003215 JGI25153J46596_10013918 JGI25153J46596_100139182 212
665 3300003354 JGI25160J50197_1000255 JGI25160J50197_10002552 212
666 3300003354 JGI25160J50197_1006714 JGI25160J50197_10067142 212
667 3300003374 JGI25161J50226_1000393 JGI25161J50226_10003932 212
668 3300003374 JGI25161J50226_1004942 JGI25161J50226_10049422 212
669 3300003761 Ga0055535_1000305 Ga0055535_100030538 212
670 3300003762 Ga0055542_1000021 Ga0055542_1000021113 212
671 3300003771 Ga0055526_1013837 Ga0055526_10138372 212
672 3300003773 Ga0055537_1000036 Ga0055537_100003673 212
673 3300003773 Ga0055537_1003375 Ga0055537_10033754 212
674 3300003775 Ga0055524_1011877 Ga0055524_10118772 212
675 3300003775 Ga0055524_1011918 Ga0055524_10119182 212
676 3300003781 Ga0055536_1000396 Ga0055536_100039636 212
677 3300003781 Ga0055536_1002959 Ga0055536_10029597 212
678 3300003781 Ga0055536_1012104 Ga0055536_10121043 212
679 3300003784 Ga0055534_1000018 Ga0055534_100001811 212
680 3300003784 Ga0055534_1002944 Ga0055534_10029445 212
681 3300003784 Ga0055534_1005504 Ga0055534_10055042 212
682 3300003790 Ga0055528_1000903 Ga0055528_100090316 212
683 3300003790 Ga0055528_1007234 Ga0055528_10072344 212
684 3300003791 Ga0055530_10000086 Ga0055530_1000008637 212
685 3300003791 Ga0055530_10000991 Ga0055530_100009917 212
686 3300003792 Ga0055540_1000405 Ga0055540_100040510 212
687 3300003792 Ga0055540_1004907 Ga0055540_10049074 212
688 3300003792 Ga0055540_1009436 Ga0055540_10094362 212
689 3300003794 Ga0055531_10000515 Ga0055531_1000051510 212
690 3300003794 Ga0055531_10015372 Ga0055531_100153722 212
691 3300003794 Ga0055531_10015402 Ga0055531_100154022 212
692 3300004625 Ga0055543_1000262 Ga0055543_10002622 212
693 3300004625 Ga0055543_1005364 Ga0055543_10053643 212
694 3300005262 Ga0065165_1000494 Ga0065165_10004942 212
695 3300005288 Ga0065714_10097146 Ga0065714_100971462 212
696 3300005344 Ga0070661_100122320 Ga0070661_1001223202 212
697 3300005457 Ga0070662_100024236 Ga0070662_1000242365 212
698 3300005539 Ga0068853_100018345 Ga0068853_1000183453 212
699 3300005563 Ga0068855_101050171 Ga0068855_1010501712 212
700 3300005564 Ga0070664_100165367 Ga0070664_1001653672 212
701 3300005577 Ga0068857_100228885 Ga0068857_1002288852 212
702 3300005614 Ga0068856_100527512 Ga0068856_1005275122 212
703 3300006042 Ga0075368_10061326 Ga0075368_100613262 212
704 3300006048 Ga0075363_100027660 Ga0075363_1000276602 212
705 3300006048 Ga0075363_100069601 Ga0075363_1000696012 212
706 3300006177 Ga0075362_10032725 Ga0075362_100327252 212
707 3300006195 Ga0075366_10030192 Ga0075366_100301923 212
708 3300006353 Ga0075370_10006928 Ga0075370_100069287 212
709 3300006353 Ga0075370_10050158 Ga0075370_100501582 212
710 3300006353 Ga0075370_10066053 Ga0075370_100660532 212
711 3300006353 Ga0075370_10283321 Ga0075370_102833212 212
712 3300006948 Ga0099826_10003330 Ga0099826_100033307 212
713 3300006948 Ga0099826_10072148 Ga0099826_100721482 212
714 3300006948 Ga0099826_10275303 Ga0099826_102753032 212
715 3300009036 Ga0105244_10006079 Ga0105244_100060796 212
716 3300009148 Ga0105243_10016483 Ga0105243_100164832 212
717 3300009148 Ga0105243_10365387 Ga0105243_103653872 212
718 3300011119 Ga0105246_10170572 Ga0105246_101705722 212
719 3300011119 Ga0105246_10240635 Ga0105246_102406352 212
720 3300013100 Ga0157373_10497492 Ga0157373_104974922 212
721 3300013102 Ga0157371_10189039 Ga0157371_101890392 212
722 3300013104 Ga0157370_10292047 Ga0157370_102920472 212
723 3300013104 Ga0157370_10561572 Ga0157370_105615722 212
724 3300014497 Ga0182008_10002841 Ga0182008_100028413 212
725 3300014497 Ga0182008_10004507 Ga0182008_100045072 212
726 3300015261 Ga0182006_1002817 Ga0182006_10028175 212
727 3300015261 Ga0182006_1059750 Ga0182006_10597502 212
728 3300015262 Ga0182007_10000727 Ga0182007_100007272 212
729 3300017792 Ga0163161_10229392 Ga0163161_102293922 212
730 3300025208 Ga0209436_104755 Ga0209436_1047552 212
731 3300025208 Ga0209436_107635 Ga0209436_1076352 212
732 3300025228 Ga0209672_105495 Ga0209672_1054952 212
733 3300025229 Ga0209147_100716 Ga0209147_1007162 212
734 3300025242 Ga0209258_100058 Ga0209258_100058113 212
735 3300025245 Ga0207425_1000087 Ga0207425_100008760 212
736 3300025254 Ga0209148_1000071 Ga0209148_1000071113 212
737 3300025258 Ga0209129_1000007 Ga0209129_1000007700 212
738 3300025258 Ga0209129_1001475 Ga0209129_100147510 212
739 3300025263 Ga0209565_1000038 Ga0209565_100003898 212
740 3300025263 Ga0209565_1000075 Ga0209565_1000075146 212
741 3300025263 Ga0209565_1001142 Ga0209565_10011425 212
742 3300025273 Ga0209673_1000066 Ga0209673_100006654 212
743 3300025273 Ga0209673_1000080 Ga0209673_1000080162 212
744 3300025273 Ga0209673_1002015 Ga0209673_10020158 212
745 3300025273 Ga0209673_1003648 Ga0209673_10036484 212
746 3300025284 Ga0209130_1000131 Ga0209130_100013190 212
747 3300025284 Ga0209130_1000137 Ga0209130_100013761 212
748 3300025291 Ga0209675_1000074 Ga0209675_1000074146 212
749 3300025291 Ga0209675_1000102 Ga0209675_100010247 212
750 3300025291 Ga0209675_1001838 Ga0209675_10018387 212
751 3300025292 Ga0209676_1000005 Ga0209676_1000005915 212
752 3300025292 Ga0209676_1000186 Ga0209676_1000186101 212
753 3300025292 Ga0209676_1000703 Ga0209676_100070340 212
754 3300025292 Ga0209676_1001078 Ga0209676_100107820 212
755 3300025292 Ga0209676_1062212 Ga0209676_10622122 212
756 3300025294 Ga0209025_1000056 Ga0209025_1000056186 212
757 3300025294 Ga0209025_1008022 Ga0209025_10080225 212
758 3300025295 Ga0209564_1000073 Ga0209564_1000073222 212
759 3300025295 Ga0209564_1000090 Ga0209564_100009037 212
760 3300025297 Ga0209758_1000044 Ga0209758_1000044173 212
761 3300025298 Ga0209050_1000007 Ga0209050_1000007182 212
762 3300025298 Ga0209050_1000250 Ga0209050_100025063 212
763 3300025299 Ga0209256_1000020 Ga0209256_1000020176 212
764 3300025299 Ga0209256_1000022 Ga0209256_1000022255 212
765 3300025302 Ga0207426_1000001 Ga0207426_1000001811 212
766 3300025302 Ga0207426_1000031 Ga0207426_1000031412 212
767 3300025303 Ga0209051_1000036 Ga0209051_1000036266 212
768 3300025303 Ga0209051_1000160 Ga0209051_100016071 212
769 3300025303 Ga0209051_1000213 Ga0209051_100021310 212
770 3300025303 Ga0209051_1011578 Ga0209051_10115785 212
771 3300025304 Ga0209257_1000011 Ga0209257_1000011889 212
772 3300025304 Ga0209257_1000116 Ga0209257_100011652 212
773 3300025304 Ga0209257_1000222 Ga0209257_1000222112 212
774 3300025728 Ga0207655_1005759 Ga0207655_10057599 212
775 3300025911 Ga0207654_10658557 Ga0207654_106585571 212
776 3300025919 Ga0207657_10168000 Ga0207657_101680002 212
777 3300025920 Ga0207649_10076912 Ga0207649_100769122 212
778 3300025933 Ga0207706_10122025 Ga0207706_101220252 212
779 3300025935 Ga0207709_10002968 Ga0207709_100029688 212
780 3300025935 Ga0207709_10325830 Ga0207709_103258302 212
781 3300025945 Ga0207679_10218174 Ga0207679_102181742 212
782 3300026041 Ga0207639_10043681 Ga0207639_100436813 212
783 3300026089 Ga0207648_11104592 Ga0207648_111045921 212
784 3300026116 Ga0207674_10076121 Ga0207674_100761213 212
785 3300027666 Ga0209282_1000221 Ga0209282_100022123 212
786 3300027666 Ga0209282_1130980 Ga0209282_11309802 212
787 3300028794 Ga0307515_10000306 Ga0307515_10000306111 212
788 3300030731 Ga0316177_1105017 Ga0316177_11050176 212
789 3300030732 Ga0316176_1013009 Ga0316176_10130092 212
790 3300030733 Ga0314311_1155152 Ga0314311_11551525 212
791 3300030735 Ga0316178_1038440 Ga0316178_10384402 212
792 3300030742 Ga0316183_1039891 Ga0316183_10398916 212
793 3300031548 Ga0307408_100087987 Ga0307408_1000879872 212
794 3300031548 Ga0307408_100167055 Ga0307408_1001670552 212
795 3300031649 Ga0307514_10048620 Ga0307514_100486204 212
796 3300031731 Ga0307405_10743538 Ga0307405_107435381 212
797 3300031901 Ga0307406_10225625 Ga0307406_102256252 212
798 3300031911 Ga0307412_10386146 Ga0307412_103861462 212
799 3300031911 Ga0307412_10595524 Ga0307412_105955242 212
800 3300031911 Ga0307412_11053003 Ga0307412_110530031 212
801 3300032002 Ga0307416_100043673 Ga0307416_1000436731 212
802 3300032126 Ga0307415_100503742 Ga0307415_1005037422 212
803 3300041404 Ga0439436_0023349 Ga0439436_0023349_685_1344 212
804 3300041411 Ga0439466_0013780 Ga0439466_0013780_2048_2707 212
805 3300042002 Ga0439442_017744 Ga0439442_017744_262_921 212
806 3300042007 Ga0439449_0009856 Ga0439449_0009856_98_757 212
807 3300042121 Ga0450919_012034 Ga0450919_012034_35_694 212
808 3300042122 Ga0450920_005006 Ga0450920_005006_921_1580 212
809 3300042123 Ga0450921_000292 Ga0450921_000292_83_742 212
810 3300042134 Ga0450898_004329 Ga0450898_004329_223_882 212
811 3300042135 Ga0450899_003556 Ga0450899_003556_935_1594 212
812 3300042145 Ga0450906_003932 Ga0450906_003932_1769_2428 212
813 3300042147 Ga0450910_015468 Ga0450910_015468_83_742 212
814 3300042531 Ga0450918_001383 Ga0450918_001383_583_1242 212
815 3300046459 Ga0495629_0092193 Ga0495629_0092193_1402_2058 212
816 3300046506 Ga0495583_0128092 Ga0495583_0128092_311_967 212
817 3300046512 Ga0495610_0023524 Ga0495610_0023524_1837_2493 212
818 3300046513 Ga0495616_0001622 Ga0495616_0001622_11828_12484 212
819 3300046515 Ga0495620_0228861 Ga0495620_0228861_10_666 212
820 3300046518 Ga0495631_0003611 Ga0495631_0003611_1191_1847 212
821 3300046520 Ga0495637_0022431 Ga0495637_0022431_1101_1757 212
822 3300046616 Ga0495668_0068549 Ga0495668_0068549_450_1106 212
823 3300046660 Ga0495625_0000057 Ga0495625_0000057_163539_164198 212
824 3300047673 Ga0495593_0109881 Ga0495593_0109881_377_1033 212
825 3300048089 Ga0495614_0028444 Ga0495614_0028444_941_1597 212
826 3300048910 Ga0496107_0101397 Ga0496107_0101397_1161_1817 212
827 3300048919 Ga0496116_0025716 Ga0496116_0025716_13_669 212
828 3300048920 Ga0496117_0028533 Ga0496117_0028533_556_1212 212
829 3300048920 Ga0496117_0028546 Ga0496117_0028546_849_1502 212
830 3300048920 Ga0496117_0072533 Ga0496117_0072533_26_682 212
831 3300048921 Ga0496118_0016121 Ga0496118_0016121_3110_3763 212
832 3300048921 Ga0496118_0039128 Ga0496118_0039128_2484_3140 212
833 3300048924 Ga0496121_0042381 Ga0496121_0042381_1141_1797 212
834 3300048924 Ga0496121_0151260 Ga0496121_0151260_771_1427 212
835 3300048925 Ga0496122_0074474 Ga0496122_0074474_1132_1788 212
836 3300048926 Ga0496123_0136522 Ga0496123_0136522_48_704 212
837 3300048927 Ga0496124_0008708 Ga0496124_0008708_7359_8015 212
838 3300048928 Ga0496125_0008866 Ga0496125_0008866_6711_7364 212
839 3300048928 Ga0496125_0041445 Ga0496125_0041445_2157_2813 212
840 3300048928 Ga0496125_0193121 Ga0496125_0193121_111_767 212
841 3300049759 Ga0501262_004518 Ga0501262_004518_531_1190 212
842 3300050489 nmdc:mga03683_1803_c1 nmdc:mga03683_1803_c1_2521_3180 212
843 3300050489 nmdc:mga03683_33853_c1 nmdc:mga03683_33853_c1_134_793 212
844 3300050490 nmdc:mga03n38_133491_c1 nmdc:mga03n38_133491_c1_214_873 212
845 3300050490 nmdc:mga03n38_57895_c1 nmdc:mga03n38_57895_c1_634_1272 212
846 3300050493 nmdc:mga0k408_10715_c1 nmdc:mga0k408_10715_c1_3300_3938 212
847 3300050496 nmdc:mga07m45_24262_c1 nmdc:mga07m45_24262_c1_1688_2347 212
848 3300050496 nmdc:mga07m45_48000_c1 nmdc:mga07m45_48000_c1_1027_1665 212
849 3300050496 nmdc:mga07m45_9224_c1 nmdc:mga07m45_9224_c1_3310_3966 212
850 3300053087 Ga0500643_004866 Ga0500643_004866_5106_5762 212
851 3300053093 Ga0500651_0000090 Ga0500651_0000090_40437_41093 212
852 3300053094 Ga0500566_0031058 Ga0500566_0031058_156_812 212
853 3300053108 Ga0500562_002544 Ga0500562_002544_193_849 212
854 3300053110 Ga0500571_000014 Ga0500571_000014_10076_10732 212
855 3300053116 Ga0500592_008465 Ga0500592_008465_845_1501 212
856 3300053118 Ga0500594_0002517 Ga0500594_0002517_52_708 212
857 3300053122 Ga0500608_003138 Ga0500608_003138_1872_2531 212
858 3300053128 Ga0500626_194385 Ga0500626_194385_65_721 212
859 3300053133 Ga0500655_001389 Ga0500655_001389_730_1386 212
860 3300053134 Ga0500658_0000018 Ga0500658_0000018_66469_67125 212
861 3300053134 Ga0500658_0000322 Ga0500658_0000322_13180_13836 212
862 3300053136 Ga0500559_0010108 Ga0500559_0010108_3258_3914 212
863 3300053136 Ga0500559_0012748 Ga0500559_0012748_1210_1848 212
864 3300053138 Ga0500564_010061 Ga0500564_010061_2049_2705 212
865 3300053141 Ga0500574_003231 Ga0500574_003231_2033_2689 212
866 3300053153 Ga0500616_0007996 Ga0500616_0007996_5696_6352 212
867 3300053154 Ga0500619_063314 Ga0500619_063314_156_812 212
868 3300053161 Ga0500634_0068195 Ga0500634_0068195_996_1652 212
869 3300053162 Ga0500638_026886 Ga0500638_026886_255_911 212
870 3300053177 Ga0500636_0042892 Ga0500636_0042892_749_1405 212
871 iso_pu_bacteria 2738541277 2738717925 212
872 iso_pu_bacteria 2738543019 2739278611 212
873 iso_pu_bacteria 2928115317 2928118615 212
874 3300003187 JGI25151J46595_10001581 JGI25151J46595_1000158110 213
875 3300006177 Ga0075362_10014387 Ga0075362_100143873 213
876 3300006177 Ga0075362_10080360 Ga0075362_100803602 213
877 3300006353 Ga0075370_10012797 Ga0075370_100127972 213
878 3300006353 Ga0075370_10273630 Ga0075370_102736302 213
879 3300009148 Ga0105243_10074640 Ga0105243_100746402 213
880 3300013100 Ga0157373_10048353 Ga0157373_100483532 213
881 3300014497 Ga0182008_10116407 Ga0182008_101164072 213
882 3300015261 Ga0182006_1090141 Ga0182006_10901412 213
883 3300025258 Ga0209129_1002386 Ga0209129_10023867 213
884 3300025294 Ga0209025_1000104 Ga0209025_100010419 213
885 3300025935 Ga0207709_10141454 Ga0207709_101414542 213
886 3300031548 Ga0307408_100060094 Ga0307408_1000600942 213
887 3300031901 Ga0307406_10003567 Ga0307406_100035672 213
888 3300037312 Ga0395899_0023506 Ga0395899_0023506_2269_2910 213
889 3300037418 Ga0395900_0140666 Ga0395900_0140666_1447_2088 213
890 3300037466 Ga0395898_0010832 Ga0395898_0010832_8574_9215 213
891 3300037471 Ga0395905_0092135 Ga0395905_0092135_862_1503 213
892 3300038443 Ga0395901_0173441 Ga0395901_0173441_834_1475 213
893 3300042137 Ga0450902_026735 Ga0450902_026735_99_740 213
894 3300042435 Ga0439434_0016519 Ga0439434_0016519_47_688 213
895 3300042439 Ga0439464_0047794 Ga0439464_0047794_262_903 213
896 3300048925 Ga0496122_0001985 Ga0496122_0001985_7238_7879 213
897 3300048926 Ga0496123_0000108 Ga0496123_0000108_15487_16128 213
898 3300049574 Ga0501038_0240902 Ga0501038_0240902_456_1109 213
899 3300049822 Ga0501035_0102509 Ga0501035_0102509_225_878 213
900 3300049823 Ga0501044_0090000 Ga0501044_0090000_2237_2890 213
901 3300050493 nmdc:mga0k408_36648_c2 nmdc:mga0k408_36648_c2_296_949 213
902 3300050496 nmdc:mga07m45_353156_c1 nmdc:mga07m45_353156_c1_21_683 213
903 3300050496 nmdc:mga07m45_7705_c1 nmdc:mga07m45_7705_c1_884_1537 213
904 3300053161 Ga0500634_0037520 Ga0500634_0037520_269_916 213
905 iso_pu_bacteria 2643221609 2644062740 213
906 iso_pu_bacteria 2643221611 2644076766 213
907 iso_pu_bacteria 2738543012 2739244586 213
908 iso_pu_bacteria 2816332133 2816475210 213
909 3300003187 JGI25151J46595_10056542 JGI25151J46595_100565422 214
910 3300005353 Ga0070669_100185260 Ga0070669_1001852602 214
911 3300005365 Ga0070688_100518057 Ga0070688_1005180571 214
912 3300005617 Ga0068859_100382016 Ga0068859_1003820162 214
913 3300006038 Ga0075365_10046079 Ga0075365_100460792 214
914 3300006038 Ga0075365_10101422 Ga0075365_101014222 214
915 3300006042 Ga0075368_10003959 Ga0075368_100039595 214
916 3300006048 Ga0075363_100006375 Ga0075363_1000063755 214
917 3300006051 Ga0075364_10022128 Ga0075364_100221284 214
918 3300006178 Ga0075367_10071104 Ga0075367_100711043 214
919 3300006195 Ga0075366_10049031 Ga0075366_100490312 214
920 3300006195 Ga0075366_10104372 Ga0075366_101043722 214
921 3300006931 Ga0097620_100382037 Ga0097620_1003820372 214
922 3300009098 Ga0105245_10236879 Ga0105245_102368792 214
923 3300025291 Ga0209675_1017338 Ga0209675_10173382 214
924 3300025294 Ga0209025_1032944 Ga0209025_10329442 214
925 3300025298 Ga0209050_1005618 Ga0209050_10056183 214
926 3300025923 Ga0207681_10355541 Ga0207681_103555412 214
927 3300032005 Ga0307411_10566325 Ga0307411_105663252 214
928 3300045051 Ga0451576_0280482 Ga0451576_0280482_594_1238 214
929 3300048919 Ga0496116_0036615 Ga0496116_0036615_1530_2192 214
930 3300048920 Ga0496117_0137384 Ga0496117_0137384_496_1158 214
931 3300048924 Ga0496121_0227039 Ga0496121_0227039_291_953 214
932 3300048925 Ga0496122_0130642 Ga0496122_0130642_15_677 214
933 3300048926 Ga0496123_0077439 Ga0496123_0077439_1109_1771 214
934 3300048928 Ga0496125_0083988 Ga0496125_0083988_684_1346 214
935 3300050489 nmdc:mga03683_12585_c1 nmdc:mga03683_12585_c1_642_1310 214
936 3300050492 nmdc:mga0yw44_73599_c1 nmdc:mga0yw44_73599_c1_1280_1948 214
937 3300050493 nmdc:mga0k408_262416_c1 nmdc:mga0k408_262416_c1_325_999 214
938 3300050493 nmdc:mga0k408_80720_c1 nmdc:mga0k408_80720_c1_259_927 214
939 3300050494 nmdc:mga06z11_119292_c1 nmdc:mga06z11_119292_c1_397_1071 214
940 3300053121 Ga0500607_013009 Ga0500607_013009_214_876 214
941 iso_pu_bacteria 2721755523 2722884027 214
942 3300003187 JGI25151J46595_10011766 JGI25151J46595_100117663 215
943 3300005330 Ga0070690_100433523 Ga0070690_1004335231 215
944 3300005334 Ga0068869_100498911 Ga0068869_1004989112 215
945 3300005338 Ga0068868_100087945 Ga0068868_1000879452 215
946 3300005338 Ga0068868_100325397 Ga0068868_1003253972 215
947 3300005563 Ga0068855_100094764 Ga0068855_1000947642 215
948 3300005563 Ga0068855_101023342 Ga0068855_1010233422 215
949 3300006353 Ga0075370_10117330 Ga0075370_101173302 215
950 3300013297 Ga0157378_10550468 Ga0157378_105504681 215
951 3300014969 Ga0157376_10002446 Ga0157376_1000244610 215
952 3300017792 Ga0163161_10010469 Ga0163161_100104696 215
953 3300025294 Ga0209025_1000088 Ga0209025_1000088145 215
954 3300025942 Ga0207689_10260474 Ga0207689_102604742 215
955 3300025949 Ga0207667_10181107 Ga0207667_101811073 215
956 3300026023 Ga0207677_10005418 Ga0207677_100054186 215
957 3300026023 Ga0207677_10546724 Ga0207677_105467242 215
958 3300027876 Ga0209974_10026679 Ga0209974_100266792 215
959 3300031548 Ga0307408_100000048 Ga0307408_10000004896 215
960 3300031548 Ga0307408_100112074 Ga0307408_1001120742 215
961 3300031901 Ga0307406_10000164 Ga0307406_1000016425 215
962 3300032005 Ga0307411_10210973 Ga0307411_102109732 215
963 3300042876 Ga0451577_0130548 Ga0451577_0130548_376_1023 215
964 3300042876 Ga0451577_0219491 Ga0451577_0219491_121_783 215
965 3300044673 Ga0453683_0004191 Ga0453683_0004191_998_1645 215
966 3300044712 Ga0453684_0041347 Ga0453684_0041347_914_1561 215
967 3300044712 Ga0453684_0461575 Ga0453684_0461575_12_674 215
968 3300045051 Ga0451576_0007413 Ga0451576_0007413_8105_8752 215
969 3300045051 Ga0451576_0290193 Ga0451576_0290193_83_745 215
970 3300046542 Ga0495597_0000065 Ga0495597_0000065_37682_38356 215
971 iso_pu_bacteria 2643221683 2644468391 215
972 iso_pu_bacteria 2738541307 2738879582 215
973 3300003781 Ga0055536_1004300 Ga0055536_10043001 216
974 3300003792 Ga0055540_1001568 Ga0055540_10015684 216
975 3300005548 Ga0070665_100040895 Ga0070665_1000408953 216
976 3300005563 Ga0068855_100153746 Ga0068855_1001537463 216
977 3300005578 Ga0068854_100055556 Ga0068854_1000555562 216
978 3300009093 Ga0105240_10093187 Ga0105240_100931874 216
979 3300009148 Ga0105243_10000481 Ga0105243_1000048117 216
980 3300009545 Ga0105237_10022949 Ga0105237_100229495 216
981 3300010375 Ga0105239_10399593 Ga0105239_103995932 216
982 3300013100 Ga0157373_10059627 Ga0157373_100596272 216
983 3300025292 Ga0209676_1000139 Ga0209676_100013951 216
984 3300025303 Ga0209051_1000257 Ga0209051_100025780 216
985 3300025304 Ga0209257_1003620 Ga0209257_10036208 216
986 3300025935 Ga0207709_10000292 Ga0207709_100002923 216
987 3300025949 Ga0207667_10140675 Ga0207667_101406752 216
988 3300026121 Ga0207683_10018267 Ga0207683_100182676 216
989 3300028379 Ga0268266_10020271 Ga0268266_100202714 216
990 3300031731 Ga0307405_10001524 Ga0307405_100015247 216
991 3300032005 Ga0307411_10065958 Ga0307411_100659583 216
992 3300041509 Ga0451843_1319765 Ga0451843_1319765_75_731 216
993 3300042115 Ga0450911_000660 Ga0450911_000660_6425_7105 216
994 3300048904 Ga0496101_0368503 Ga0496101_0368503_23_691 216
995 3300048925 Ga0496122_0112553 Ga0496122_0112553_731_1411 216
996 3300048927 Ga0496124_0048959 Ga0496124_0048959_2659_3330 216
997 3300048928 Ga0496125_0001110 Ga0496125_0001110_2885_3565 216
998 3300048928 Ga0496125_0003201 Ga0496125_0003201_18599_19279 216
999 3300041486 Ga0451807_1843106 Ga0451807_1843106_26_694 217
1000 3300048925 Ga0496122_0040928 Ga0496122_0040928_511_1206 217
1001 3300048926 Ga0496123_0090733 Ga0496123_0090733_879_1574 217
1002 3300048928 Ga0496125_0001434 Ga0496125_0001434_17275_17970 217
1003 3300006946 Ga0079104_1000011 Ga0079104_1000011186 218
1004 3300009092 Ga0105250_10052315 Ga0105250_100523152 218
1005 3300009148 Ga0105243_10015811 Ga0105243_100158114 218
1006 3300025711 Ga0207696_1032993 Ga0207696_10329932 218
1007 3300025935 Ga0207709_10000074 Ga0207709_1000007472 218
1008 3300027111 Ga0209281_1000005 Ga0209281_1000005754 218
1009 3300041491 Ga0451833_1094299 Ga0451833_1094299_19_705 218
1010 3300046453 Ga0495627_004409 Ga0495627_004409_2238_2921 219
1011 3300005467 Ga0070706_100431629 Ga0070706_1004316292 225
1012 3300005468 Ga0070707_100356958 Ga0070707_1003569581 225
1013 3300025294 Ga0209025_1027766 Ga0209025_10277664 225
1014 3300025910 Ga0207684_10328499 Ga0207684_103284992 225
1015 3300031456 Ga0307513_10000019 Ga0307513_10000019116 226
1016 3300031730 Ga0307516_10009467 Ga0307516_100094672 226
1017 3300031824 Ga0307413_10225930 Ga0307413_102259302 226
1018 iso_pu_bacteria 2511231002 2511247001 226
1019 3300006058 Ga0075432_10020439 Ga0075432_100204393 229
1020 3300006946 Ga0079104_1016024 Ga0079104_10160243 229
1021 3300027907 Ga0207428_10193228 Ga0207428_101932282 229
1022 3300053093 Ga0500651_0008417 Ga0500651_0008417_3424_4113 229
1023 3300002987 JGI25159J45721_1003535 JGI25159J45721_10035356 230
1024 3300003187 JGI25151J46595_10038775 JGI25151J46595_100387752 230
1025 3300003771 Ga0055526_1002303 Ga0055526_100230311 230
1026 3300003773 Ga0055537_1000043 Ga0055537_100004328 230
1027 3300003775 Ga0055524_1000012 Ga0055524_1000012141 230
1028 3300003784 Ga0055534_1005797 Ga0055534_10057972 230
1029 3300003790 Ga0055528_1000647 Ga0055528_100064715 230
1030 3300003791 Ga0055530_10000015 Ga0055530_10000015100 230
1031 3300003792 Ga0055540_1000039 Ga0055540_100003942 230
1032 3300003794 Ga0055531_10007067 Ga0055531_100070675 230
1033 3300003794 Ga0055531_10008849 Ga0055531_100088492 230
1034 3300005262 Ga0065165_1035867 Ga0065165_10358672 230
1035 3300025245 Ga0207425_1000861 Ga0207425_10008618 230
1036 3300025258 Ga0209129_1021579 Ga0209129_10215792 230
1037 3300025263 Ga0209565_1000004 Ga0209565_1000004494 230
1038 3300025273 Ga0209673_1000357 Ga0209673_100035754 230
1039 3300025284 Ga0209130_1000082 Ga0209130_100008224 230
1040 3300025291 Ga0209675_1000061 Ga0209675_100006194 230
1041 3300025292 Ga0209676_1000029 Ga0209676_1000029409 230
1042 3300025294 Ga0209025_1003318 Ga0209025_10033182 230
1043 3300025295 Ga0209564_1000969 Ga0209564_100096911 230
1044 3300025298 Ga0209050_1000003 Ga0209050_1000003471 230
1045 3300025298 Ga0209050_1030793 Ga0209050_10307932 230
1046 3300025299 Ga0209256_1000001 Ga0209256_1000001473 230
1047 3300025302 Ga0207426_1004459 Ga0207426_10044593 230
1048 3300025303 Ga0209051_1000003 Ga0209051_1000003471 230
1049 3300025304 Ga0209257_1000018 Ga0209257_1000018471 230
1050 3300053094 Ga0500566_0190057 Ga0500566_0190057_181_876 230
1051 3300053103 Ga0500555_083218 Ga0500555_083218_121_813 230
1052 3300053117 Ga0500593_001074 Ga0500593_001074_1316_2008 230
1053 3300053129 Ga0500628_002038 Ga0500628_002038_1734_2426 230
1054 3300053730 Ga0500645_000155 Ga0500645_000155_16713_17405 230
1055 3300053730 Ga0500645_028446 Ga0500645_028446_750_1442 230
1056 3300002704 JGI25155J39150_1000036 JGI25155J39150_100003685 231
1057 3300002705 JGI25156J39149_1000047 JGI25156J39149_10000473 231
1058 3300002738 JGI25154J39366_1000068 JGI25154J39366_10000683 231
1059 3300002741 JGI25157J39369_1000066 JGI25157J39369_10000663 231
1060 3300002774 JGI25150J39212_1012834 JGI25150J39212_10128341 231
1061 3300002987 JGI25159J45721_1001201 JGI25159J45721_100120111 231
1062 3300003187 JGI25151J46595_10010059 JGI25151J46595_100100591 231
1063 3300003187 JGI25151J46595_10019969 JGI25151J46595_100199693 231
1064 3300003354 JGI25160J50197_1000145 JGI25160J50197_100014545 231
1065 3300003374 JGI25161J50226_1000032 JGI25161J50226_1000032128 231
1066 3300003374 JGI25161J50226_1000064 JGI25161J50226_100006437 231
1067 3300003771 Ga0055526_1031591 Ga0055526_10315913 231
1068 3300003771 Ga0055526_1038852 Ga0055526_10388522 231
1069 3300004625 Ga0055543_1003819 Ga0055543_10038192 231
1070 3300005262 Ga0065165_1005649 Ga0065165_10056492 231
1071 3300005262 Ga0065165_1006329 Ga0065165_10063292 231
1072 3300006353 Ga0075370_10435859 Ga0075370_104358591 231
1073 3300025206 Ga0209435_100001 Ga0209435_100001717 231
1074 3300025245 Ga0207425_1002867 Ga0207425_10028676 231
1075 3300025246 Ga0209646_1000001 Ga0209646_10000011086 231
1076 3300025250 Ga0209026_1000003 Ga0209026_1000003717 231
1077 3300025256 Ga0209759_1000001 Ga0209759_1000001717 231
1078 3300025263 Ga0209565_1000407 Ga0209565_100040718 231
1079 3300025284 Ga0209130_1000094 Ga0209130_100009476 231
1080 3300025294 Ga0209025_1001422 Ga0209025_100142223 231
1081 3300025295 Ga0209564_1001231 Ga0209564_100123119 231
1082 3300025297 Ga0209758_1037697 Ga0209758_10376972 231
1083 3300025298 Ga0209050_1003639 Ga0209050_10036395 231
1084 3300025299 Ga0209256_1029187 Ga0209256_10291872 231
1085 3300025302 Ga0207426_1000025 Ga0207426_1000025483 231
1086 3300031456 Ga0307513_10000051 Ga0307513_1000005123 231
1087 3300031548 Ga0307408_100006460 Ga0307408_1000064604 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02223

Thymidylate_kin

Thymidylate kinase

15

137

0.97

PF02223

Thymidylate_kin

Thymidylate kinase

141

221

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hjn-assembly1.cif.gz_B crystal structure of thymidylate kinase in complex with dtdp and adp from thermotoga maritima 0.9553 10 222
3uwo-assembly3.cif.gz_A structure guided development of novel thymidine mimetics targeting pseudomonas aeruginosa thymidylate kinase: from hit to lead generation 0.9534 10 227
3uwk-assembly3.cif.gz_A structure guided development of novel thymidine mimetics targeting pseudomonas aeruginosa thymidylate kinase: from hit to lead generation 0.9512 10 227
4e5u-assembly1.cif.gz_A the crystal structure of thymidylate kinase from pseudomonas aeruginosa pao1 in complex with thymidine monophosphate. 0.9482 9 227
4gmd-assembly2.cif.gz_B the crystal structure of thymidylate kinase from pseudomonas aeruginosa pao1 in complex with azt monophosphate 0.9477 9 227
ID Description Score Start End Superfamily
2z0hB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9456 11 222 3.40.50.300
3uwoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9391 10 227 3.40.50.300
2z0hB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9352 11 222 3.40.50.300
5x7jB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9349 9 227 3.40.50.300
3lv8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9234 9 227 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2S5R3B2-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9833 9 226 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A5C6Z5B3-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9811 9 199 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A3S2U673-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.981 9 228 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A5C7NYF5-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9809 8 226 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A3D0W5B2-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9787 9 227 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235

Feature Viewer

pLDDT pTM Quality
88.14 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map