F489751

General Info

Members Datasets Scaffolds Average Seq Length
1084 321 1084 156

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0101941|Ga0501036_0101941_447_1019
Length 190
Sequence MAVAAAVAVIGDELMADTYYNHWFENRHDHQGDASMSVEVGAKAPDFTLPNQDREPVSLSEQLKSGPVVLAFFPAAFSGTCQKEMCTFRDSASTLNSVKAKVLGISVDTFFALKAWGDENKLNFPLLSDFNKDVIAKYGVVNPDMIGLKNIAKRSVFVIDKGGVVRHREVLEDARNEPNYEKITQTLASL

Samples

Sample ID Description Type Environment
1 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
208 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
209 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
210 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
211 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
212 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
213 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
214 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
215 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
216 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
217 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
218 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
223 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
224 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
225 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
226 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
230 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
231 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
232 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
233 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
234 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
235 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
236 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
237 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
238 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
239 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
240 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
243 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
250 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
251 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
252 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
253 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
256 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
267 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
270 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
271 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
274 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
284 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
294 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
295 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
296 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
297 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
298 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
299 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
300 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
301 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
302 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
310 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
311 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
312 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
313 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
314 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
315 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
316 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
317 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
318 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
319 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
320 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
321 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.09
Nodule 0
Rhizoplane 1.85
Rhizosphere 97.79
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARSoilOldRDRAFT_c005815 3300000044 Bacteria 1037
2 JGI24746J21847_1000635 3300001977 Bacteria 5368
3 JGI24751J29686_10024321 3300002459 Bacteria 1256
4 JGI25406J46586_10037792 3300003203 Unclassified 1737
5 rootH2_10206308 3300003320 Bacteria 1125
6 Ga0058859_11634508 3300004798 Unclassified 819
7 Ga0058860_12130943 3300004801 Bacteria 687
8 Ga0065714_10021748 3300005288 Bacteria 1694
9 Ga0065704_10014277 3300005289 Bacteria 2056
10 Ga0065712_10000373 3300005290 Bacteria 15174
11 Ga0065712_10008353 3300005290 Unclassified 4460
12 Ga0065712_10080010 3300005290 Bacteria 3144
13 Ga0065712_10086798 3300005290 Bacteria 2615
14 Ga0065712_10119676 3300005290 Bacteria 1688
15 Ga0065712_10251049 3300005290 Bacteria 960
16 Ga0065712_10369363 3300005290 Unclassified 763
17 Ga0065712_10636686 3300005290 Unclassified 573
18 Ga0065715_10089661 3300005293 Bacteria 9036
19 Ga0065715_10094316 3300005293 Unclassified 4371
20 Ga0065715_10137491 3300005293 Bacteria 1906
21 Ga0065715_10283272 3300005293 Bacteria 1067
22 Ga0065715_10639614 3300005293 Unclassified 683
23 Ga0065707_10107323 3300005295 Unclassified 2559
24 Ga0065707_10107853 3300005295 Bacteria 2536
25 Ga0065707_10195881 3300005295 Bacteria 1336
26 Ga0065707_10342578 3300005295 Bacteria 931
27 Ga0065707_10524797 3300005295 Unclassified 739
28 Ga0065707_10847730 3300005295 Unclassified 583
29 Ga0070676_10115721 3300005328 Bacteria 1676
30 Ga0070676_10169845 3300005328 Bacteria 1410
31 Ga0070676_10277072 3300005328 Unclassified 1129
32 Ga0070676_11239471 3300005328 Unclassified 568
33 Ga0070683_100085861 3300005329 Bacteria 2951
34 Ga0070690_100047569 3300005330 Bacteria 2729
35 Ga0070690_100071050 3300005330 Bacteria 2261
36 Ga0070690_100085097 3300005330 Bacteria 2074
37 Ga0070690_100194594 3300005330 Bacteria 1408
38 Ga0070690_100243194 3300005330 Bacteria 1270
39 Ga0070690_100647491 3300005330 Bacteria 807
40 Ga0070690_100655740 3300005330 Bacteria 802
41 Ga0070690_100803169 3300005330 Unclassified 730
42 Ga0070670_100068895 3300005331 Unclassified 3037
43 Ga0070670_100073656 3300005331 Bacteria 2933
44 Ga0070670_100190877 3300005331 Bacteria 1779
45 Ga0070670_100387010 3300005331 Bacteria 1233
46 Ga0070677_10004638 3300005333 Bacteria 4496
47 Ga0070677_10071396 3300005333 Bacteria 1461
48 Ga0070677_10105968 3300005333 Bacteria 1247
49 Ga0070677_10213751 3300005333 Unclassified 938
50 Ga0070677_10407443 3300005333 Bacteria 718
51 Ga0068869_100005548 3300005334 Bacteria 7941
52 Ga0068869_100008204 3300005334 Bacteria 6719
53 Ga0068869_100096572 3300005334 Bacteria 2231
54 Ga0068869_100358631 3300005334 Bacteria 1190
55 Ga0070666_10039433 3300005335 Bacteria 3148
56 Ga0070666_10332421 3300005335 Bacteria 1085
57 Ga0070666_10575274 3300005335 Bacteria 821
58 Ga0070680_100307806 3300005336 Unclassified 1344
59 Ga0070680_100906617 3300005336 Bacteria 761
60 Ga0070680_100982075 3300005336 Unclassified 729
61 Ga0070680_101036432 3300005336 Bacteria 709
62 Ga0070680_101818216 3300005336 Bacteria 528
63 Ga0070682_101458129 3300005337 Bacteria 587
64 Ga0068868_100188517 3300005338 Bacteria 1714
65 Ga0068868_100390635 3300005338 Bacteria 1199
66 Ga0068868_100630411 3300005338 Bacteria 953
67 Ga0068868_101039303 3300005338 Unclassified 751
68 Ga0068868_102197568 3300005338 Bacteria 526
69 Ga0070660_100082029 3300005339 Bacteria 2532
70 Ga0070660_100154283 3300005339 Unclassified 1848
71 Ga0070660_100361684 3300005339 Bacteria 1196
72 Ga0070660_101052490 3300005339 Unclassified 688
73 Ga0070660_101324747 3300005339 Unclassified 611
74 Ga0070689_100092599 3300005340 Bacteria 2384
75 Ga0070689_100211104 3300005340 Unclassified 1589
76 Ga0070689_100357903 3300005340 Bacteria 1226
77 Ga0070689_100368543 3300005340 Bacteria 1208
78 Ga0070689_100453063 3300005340 Bacteria 1092
79 Ga0070689_100723052 3300005340 Bacteria 871
80 Ga0070691_10271224 3300005341 Bacteria 917
81 Ga0070691_10330129 3300005341 Unclassified 841
82 Ga0070687_100003556 3300005343 Bacteria 6067
83 Ga0070687_100008554 3300005343 Bacteria 4343
84 Ga0070661_100027569 3300005344 Bacteria 4091
85 Ga0070661_100276763 3300005344 Bacteria 1301
86 Ga0070661_100414795 3300005344 Bacteria 1066
87 Ga0070661_101115107 3300005344 Bacteria 658
88 Ga0070692_10070524 3300005345 Bacteria 1861
89 Ga0070668_100100000 3300005347 Bacteria 2297
90 Ga0070668_100148140 3300005347 Bacteria 1896
91 Ga0070668_100177775 3300005347 Bacteria 1737
92 Ga0070668_100252156 3300005347 Bacteria 1465
93 Ga0070668_101486300 3300005347 Bacteria 619
94 Ga0070668_102072717 3300005347 Bacteria 525
95 Ga0070669_100004321 3300005353 Bacteria 10266
96 Ga0070669_100005329 3300005353 Bacteria 9286
97 Ga0070669_100042667 3300005353 Bacteria 3301
98 Ga0070669_100097062 3300005353 Bacteria 2218
99 Ga0070669_100146488 3300005353 Bacteria 1825
100 Ga0070669_100192345 3300005353 Unclassified 1601
101 Ga0070669_100202752 3300005353 Bacteria 1561
102 Ga0070669_100304132 3300005353 Bacteria 1283
103 Ga0070669_100897182 3300005353 Bacteria 757
104 Ga0070669_100917146 3300005353 Bacteria 749
105 Ga0070669_101147984 3300005353 Bacteria 670
106 Ga0070669_101373106 3300005353 Bacteria 613
107 Ga0070675_100011134 3300005354 Bacteria 7038
108 Ga0070675_100015561 3300005354 Bacteria 6017
109 Ga0070675_100075989 3300005354 Bacteria 2793
110 Ga0070675_100104614 3300005354 Bacteria 2388
111 Ga0070675_100141512 3300005354 Unclassified 2057
112 Ga0070675_100245149 3300005354 Bacteria 1566
113 Ga0070675_100259780 3300005354 Unclassified 1522
114 Ga0070675_100281889 3300005354 Bacteria 1460
115 Ga0070675_100854273 3300005354 Bacteria 833
116 Ga0070675_100999716 3300005354 Unclassified 768
117 Ga0070671_100242860 3300005355 Bacteria 1529
118 Ga0070674_100001261 3300005356 Bacteria 13303
119 Ga0070674_100003472 3300005356 Bacteria 8854
120 Ga0070674_100021751 3300005356 Bacteria 4125
121 Ga0070674_100047443 3300005356 Bacteria 2944
122 Ga0070674_100110747 3300005356 Unclassified 2015
123 Ga0070674_100647594 3300005356 Bacteria 898
124 Ga0070674_100843913 3300005356 Unclassified 794
125 Ga0070674_101630815 3300005356 Bacteria 582
126 Ga0070674_101822367 3300005356 Bacteria 552
127 Ga0070673_100006876 3300005364 Bacteria 7440
128 Ga0070673_100179758 3300005364 Bacteria 1810
129 Ga0070673_100241893 3300005364 Unclassified 1569
130 Ga0070673_100348781 3300005364 Bacteria 1313
131 Ga0070673_100373137 3300005364 Bacteria 1270
132 Ga0070673_100425224 3300005364 Bacteria 1191
133 Ga0070673_100863626 3300005364 Bacteria 838
134 Ga0070688_100048853 3300005365 Bacteria 2630
135 Ga0070688_100069819 3300005365 Bacteria 2244
136 Ga0070688_100071597 3300005365 Bacteria 2220
137 Ga0070688_100073223 3300005365 Bacteria 2197
138 Ga0070688_100108645 3300005365 Unclassified 1841
139 Ga0070688_100162799 3300005365 Unclassified 1534
140 Ga0070688_100325846 3300005365 Bacteria 1117
141 Ga0070688_100353396 3300005365 Bacteria 1076
142 Ga0070688_100356709 3300005365 Unclassified 1072
143 Ga0070688_100796916 3300005365 Archaea 739
144 Ga0070659_100355655 3300005366 Bacteria 1229
145 Ga0070667_100028388 3300005367 Bacteria 4658
146 Ga0070667_100091938 3300005367 Bacteria 2610
147 Ga0070667_100329936 3300005367 Bacteria 1378
148 Ga0070667_100430202 3300005367 Unclassified 1204
149 Ga0070667_100560199 3300005367 Unclassified 1051
150 Ga0070703_10367038 3300005406 Bacteria 618
151 Ga0070714_100017981 3300005435 Bacteria 5732
152 Ga0070713_100406918 3300005436 Bacteria 1272
153 Ga0070701_10006936 3300005438 Bacteria 4802
154 Ga0070701_10015284 3300005438 Bacteria 3540
155 Ga0070701_10040039 3300005438 Bacteria 2380
156 Ga0070701_10045069 3300005438 Bacteria 2262
157 Ga0070701_10120202 3300005438 Bacteria 1479
158 Ga0070701_10345288 3300005438 Unclassified 928
159 Ga0070705_100057678 3300005440 Unclassified 2292
160 Ga0070705_100653574 3300005440 Bacteria 820
161 Ga0070700_100002184 3300005441 Bacteria 9939
162 Ga0070700_100007571 3300005441 Bacteria 5871
163 Ga0070700_100015844 3300005441 Bacteria 4283
164 Ga0070700_100040187 3300005441 Bacteria 2862
165 Ga0070700_100047841 3300005441 Bacteria 2649
166 Ga0070700_100048842 3300005441 Bacteria 2624
167 Ga0070700_100060756 3300005441 Bacteria 2382
168 Ga0070700_100106558 3300005441 Bacteria 1856
169 Ga0070700_100519330 3300005441 Unclassified 920
170 Ga0070700_100827293 3300005441 Bacteria 748
171 Ga0070694_100373610 3300005444 Bacteria 1110
172 Ga0070694_100482708 3300005444 Bacteria 984
173 Ga0070694_100822174 3300005444 Unclassified 763
174 Ga0070694_100909293 3300005444 Bacteria 727
175 Ga0070694_101102079 3300005444 Unclassified 662
176 Ga0070708_100211381 3300005445 Bacteria 1818
177 Ga0070708_100303668 3300005445 Bacteria 1503
178 Ga0070708_101977453 3300005445 Bacteria 540
179 Ga0070663_100120008 3300005455 Bacteria 1985
180 Ga0070663_100129798 3300005455 Bacteria 1913
181 Ga0070663_100579498 3300005455 Unclassified 941
182 Ga0070663_100680321 3300005455 Bacteria 873
183 Ga0070663_101891555 3300005455 Unclassified 536
184 Ga0070678_100028346 3300005456 Bacteria 3818
185 Ga0070678_100561889 3300005456 Bacteria 1014
186 Ga0070678_102356987 3300005456 Unclassified 505
187 Ga0070662_100028176 3300005457 Bacteria 3906
188 Ga0070662_100148813 3300005457 Bacteria 1821
189 Ga0070662_100180495 3300005457 Bacteria 1664
190 Ga0070662_100268608 3300005457 Bacteria 1376
191 Ga0070681_10014561 3300005458 Bacteria 7827
192 Ga0068867_100003165 3300005459 Bacteria 11608
193 Ga0068867_100082617 3300005459 Bacteria 2424
194 Ga0068867_100102642 3300005459 Unclassified 2186
195 Ga0068867_100210346 3300005459 Bacteria 1562
196 Ga0068867_100410134 3300005459 Bacteria 1145
197 Ga0068867_100650980 3300005459 Bacteria 924
198 Ga0068867_100867712 3300005459 Bacteria 810
199 Ga0068867_101540035 3300005459 Bacteria 620
200 Ga0070685_10068966 3300005466 Unclassified 2090
201 Ga0070685_10085415 3300005466 Bacteria 1900
202 Ga0070685_10221116 3300005466 Unclassified 1241
203 Ga0070685_10363763 3300005466 Bacteria 992
204 Ga0070685_10815907 3300005466 Unclassified 689
205 Ga0070685_10842732 3300005466 Bacteria 679
206 Ga0070707_100035611 3300005468 Bacteria 4749
207 Ga0070707_100609032 3300005468 Bacteria 1055
208 Ga0070707_100916855 3300005468 Bacteria 841
209 Ga0070698_100129199 3300005471 Bacteria 2483
210 Ga0070698_100493055 3300005471 Bacteria 1163
211 Ga0070698_100601505 3300005471 Unclassified 1040
212 Ga0070699_100002012 3300005518 Bacteria 18361
213 Ga0070699_100705653 3300005518 Bacteria 922
214 Ga0070699_101091497 3300005518 Unclassified 732
215 Ga0070679_100040461 3300005530 Bacteria 4637
216 Ga0070679_100049935 3300005530 Bacteria 4167
217 Ga0070679_101868748 3300005530 Unclassified 549
218 Ga0070684_100187598 3300005535 Bacteria 1881
219 Ga0070697_100170580 3300005536 Bacteria 1841
220 Ga0070697_100327541 3300005536 Bacteria 1320
221 Ga0068853_100196465 3300005539 Bacteria 1835
222 Ga0070672_100043187 3300005543 Bacteria 3475
223 Ga0070672_100063994 3300005543 Bacteria 2905
224 Ga0070672_100084274 3300005543 Bacteria 2552
225 Ga0070672_100199170 3300005543 Bacteria 1674
226 Ga0070672_100784755 3300005543 Unclassified 838
227 Ga0070672_100790618 3300005543 Unclassified 834
228 Ga0070686_100031463 3300005544 Bacteria 3244
229 Ga0070686_100057146 3300005544 Bacteria 2505
230 Ga0070686_100085056 3300005544 Bacteria 2103
231 Ga0070686_100130902 3300005544 Unclassified 1735
232 Ga0070686_100220726 3300005544 Bacteria 1370
233 Ga0070686_100705965 3300005544 Bacteria 805
234 Ga0070686_100737860 3300005544 Bacteria 789
235 Ga0070686_101056086 3300005544 Bacteria 669
236 Ga0070695_100002468 3300005545 Bacteria 10652
237 Ga0070695_100016243 3300005545 Bacteria 4504
238 Ga0070695_100022402 3300005545 Bacteria 3874
239 Ga0070695_100337306 3300005545 Bacteria 1125
240 Ga0070695_100961961 3300005545 Bacteria 693
241 Ga0070696_100016233 3300005546 Bacteria 5011
242 Ga0070696_100036951 3300005546 Bacteria 3369
243 Ga0070696_100160329 3300005546 Bacteria 1657
244 Ga0070665_100322689 3300005548 Bacteria 1548
245 Ga0070704_100009365 3300005549 Bacteria 5912
246 Ga0070704_100119305 3300005549 Bacteria 2023
247 Ga0070704_100222089 3300005549 Bacteria 1537
248 Ga0070704_100255264 3300005549 Bacteria 1442
249 Ga0070704_100287858 3300005549 Bacteria 1364
250 Ga0070704_100526392 3300005549 Bacteria 1030
251 Ga0070704_100654531 3300005549 Unclassified 928
252 Ga0070704_101049520 3300005549 Unclassified 739
253 Ga0068855_100020797 3300005563 Bacteria 7868
254 Ga0070664_100024009 3300005564 Bacteria 5039
255 Ga0070664_100118928 3300005564 Unclassified 2312
256 Ga0070664_100134973 3300005564 Bacteria 2169
257 Ga0070664_100152090 3300005564 Bacteria 2043
258 Ga0070664_100269325 3300005564 Bacteria 1534
259 Ga0068857_100102707 3300005577 Bacteria 2566
260 Ga0068857_100120998 3300005577 Bacteria 2357
261 Ga0068857_100510647 3300005577 Bacteria 1129
262 Ga0068857_100558327 3300005577 Bacteria 1079
263 Ga0068857_100978243 3300005577 Bacteria 814
264 Ga0068854_100022971 3300005578 Bacteria 4256
265 Ga0068854_100054657 3300005578 Bacteria 2872
266 Ga0068856_101662602 3300005614 Unclassified 651
267 Ga0070702_100148269 3300005615 Unclassified 1503
268 Ga0070702_100431735 3300005615 Bacteria 951
269 Ga0070702_100434359 3300005615 Unclassified 948
270 Ga0068852_100166490 3300005616 Bacteria 2063
271 Ga0068852_100761296 3300005616 Bacteria 981
272 Ga0068859_100002669 3300005617 Bacteria 18110
273 Ga0068859_100128259 3300005617 Bacteria 2607
274 Ga0068859_100160182 3300005617 Bacteria 2329
275 Ga0068859_100307837 3300005617 Bacteria 1678
276 Ga0068859_100420487 3300005617 Bacteria 1433
277 Ga0068859_100982350 3300005617 Unclassified 927
278 Ga0068859_101774045 3300005617 Unclassified 682
279 Ga0068864_100040716 3300005618 Bacteria 3974
280 Ga0068864_100167280 3300005618 Bacteria 2002
281 Ga0068864_100320508 3300005618 Bacteria 1456
282 Ga0068864_100804435 3300005618 Bacteria 924
283 Ga0068864_100892196 3300005618 Bacteria 878
284 Ga0068866_10028362 3300005718 Bacteria 2667
285 Ga0068866_10039065 3300005718 Unclassified 2342
286 Ga0068866_10160996 3300005718 Bacteria 1309
287 Ga0068866_10731106 3300005718 Bacteria 682
288 Ga0068861_100023735 3300005719 Bacteria 4428
289 Ga0068861_100038017 3300005719 Bacteria 3580
290 Ga0068861_100204237 3300005719 Bacteria 1660
291 Ga0068861_100410940 3300005719 Bacteria 1203
292 Ga0068861_100743154 3300005719 Bacteria 916
293 Ga0068861_100842988 3300005719 Bacteria 863
294 Ga0068861_101302462 3300005719 Bacteria 706
295 Ga0068861_101750132 3300005719 Bacteria 616
296 Ga0068861_101831395 3300005719 Bacteria 602
297 Ga0068851_10324873 3300005834 Unclassified 890
298 Ga0068870_10397874 3300005840 Unclassified 896
299 Ga0068863_100040460 3300005841 Bacteria 4432
300 Ga0068863_100227413 3300005841 Unclassified 1799
301 Ga0068863_100343678 3300005841 Bacteria 1452
302 Ga0068863_100616346 3300005841 Unclassified 1075
303 Ga0068858_100006376 3300005842 Bacteria 11491
304 Ga0068858_100008903 3300005842 Bacteria 9623
305 Ga0068858_100097573 3300005842 Bacteria 2739
306 Ga0068858_100159796 3300005842 Bacteria 2122
307 Ga0068858_100392959 3300005842 Bacteria 1332
308 Ga0068858_100482562 3300005842 Bacteria 1196
309 Ga0068858_100728342 3300005842 Bacteria 966
310 Ga0068858_101318240 3300005842 Bacteria 711
311 Ga0068860_100137960 3300005843 Bacteria 2343
312 Ga0068860_100351429 3300005843 Unclassified 1451
313 Ga0068860_100440932 3300005843 Bacteria 1293
314 Ga0068860_100764109 3300005843 Bacteria 979
315 Ga0068860_101159720 3300005843 Bacteria 793
316 Ga0068860_101219834 3300005843 Bacteria 773
317 Ga0068860_101751843 3300005843 Bacteria 643
318 Ga0068862_100007706 3300005844 Bacteria 8906
319 Ga0068862_100023168 3300005844 Bacteria 5199
320 Ga0068862_100050972 3300005844 Bacteria 3539
321 Ga0068862_100135111 3300005844 Bacteria 2185
322 Ga0068862_100167788 3300005844 Bacteria 1963
323 Ga0068862_100415906 3300005844 Bacteria 1260
324 Ga0068862_100599307 3300005844 Bacteria 1057
325 Ga0068862_100963408 3300005844 Bacteria 842
326 Ga0068862_101190193 3300005844 Bacteria 760
327 Ga0068862_101281063 3300005844 Bacteria 734
328 Ga0081455_10337282 3300005937 Bacteria 1068
329 Ga0081539_10006423 3300005985 Bacteria 11288
330 Ga0081539_10059806 3300005985 Bacteria 2095
331 Ga0081539_10100662 3300005985 Unclassified 1474
332 Ga0070716_100041497 3300006173 Bacteria 2564
333 Ga0070716_100093604 3300006173 Bacteria 1825
334 Ga0070716_101371777 3300006173 Bacteria 574
335 Ga0070712_100096486 3300006175 Unclassified 2177
336 Ga0070712_100273531 3300006175 Bacteria 1358
337 Ga0097621_100000491 3300006237 Bacteria 27694
338 Ga0097621_100003090 3300006237 Bacteria 11416
339 Ga0097621_100020345 3300006237 Bacteria 5113
340 Ga0097621_100201459 3300006237 Bacteria 1728
341 Ga0097621_100276077 3300006237 Bacteria 1478
342 Ga0097621_101280509 3300006237 Archaea 692
343 Ga0068871_100001107 3300006358 Bacteria 18079
344 Ga0068871_100010512 3300006358 Bacteria 6759
345 Ga0068871_100089251 3300006358 Bacteria 2566
346 Ga0068871_100242880 3300006358 Unclassified 1566
347 Ga0068871_100291792 3300006358 Bacteria 1429
348 Ga0068871_100400444 3300006358 Bacteria 1222
349 Ga0068871_100538957 3300006358 Bacteria 1056
350 Ga0075428_100003764 3300006844 Bacteria 16622
351 Ga0075428_100008503 3300006844 Bacteria 11385
352 Ga0075428_100029789 3300006844 Bacteria 6038
353 Ga0075428_100070369 3300006844 Bacteria 3825
354 Ga0075428_100081829 3300006844 Bacteria 3523
355 Ga0075428_100117167 3300006844 Bacteria 2901
356 Ga0075428_100698484 3300006844 Unclassified 1081
357 Ga0075428_100926372 3300006844 Unclassified 924
358 Ga0075428_101725272 3300006844 Bacteria 653
359 Ga0075430_100002827 3300006846 Bacteria 14521
360 Ga0075430_100009055 3300006846 Bacteria 8414
361 Ga0075430_100025724 3300006846 Bacteria 5008
362 Ga0075430_100168996 3300006846 Bacteria 1819
363 Ga0075430_100423544 3300006846 Unclassified 1099
364 Ga0075430_100535947 3300006846 Bacteria 965
365 Ga0075430_101643218 3300006846 Bacteria 527
366 Ga0075431_100002521 3300006847 Bacteria 17661
367 Ga0075431_100043740 3300006847 Bacteria 4620
368 Ga0075431_100203614 3300006847 Bacteria 2024
369 Ga0075431_100390085 3300006847 Bacteria 1395
370 Ga0075431_100399090 3300006847 Unclassified 1376
371 Ga0075431_101340746 3300006847 Bacteria 676
372 Ga0075433_10000719 3300006852 Bacteria 22669
373 Ga0075433_10003035 3300006852 Bacteria 12898
374 Ga0075433_10046914 3300006852 Bacteria 3758
375 Ga0075433_10344894 3300006852 Bacteria 1316
376 Ga0075433_11372447 3300006852 Unclassified 612
377 Ga0075434_100009384 3300006871 Bacteria 9118
378 Ga0075434_100011803 3300006871 Bacteria 8253
379 Ga0075434_100014191 3300006871 Bacteria 7611
380 Ga0075434_100019206 3300006871 Bacteria 6612
381 Ga0075434_100042252 3300006871 Bacteria 4519
382 Ga0075434_100091844 3300006871 Bacteria 3038
383 Ga0075434_100101935 3300006871 Bacteria 2878
384 Ga0075434_100485330 3300006871 Bacteria 1257
385 Ga0075434_100588711 3300006871 Bacteria 1132
386 Ga0075434_101053817 3300006871 Bacteria 827
387 Ga0075429_100003842 3300006880 Bacteria 12830
388 Ga0075429_100005497 3300006880 Bacteria 10909
389 Ga0075429_100184095 3300006880 Bacteria 1830
390 Ga0075429_100493860 3300006880 Bacteria 1072
391 Ga0075429_100680130 3300006880 Bacteria 902
392 Ga0075429_101696492 3300006880 Bacteria 549
393 Ga0068865_100022104 3300006881 Bacteria 4143
394 Ga0068865_100033189 3300006881 Bacteria 3454
395 Ga0068865_100294951 3300006881 Unclassified 1296
396 Ga0068865_100383542 3300006881 Bacteria 1147
397 Ga0075436_100014387 3300006914 Bacteria 5416
398 Ga0075436_100017806 3300006914 Bacteria 4865
399 Ga0075436_100081102 3300006914 Archaea 2249
400 Ga0075436_100085555 3300006914 Bacteria 2189
401 Ga0075436_100261237 3300006914 Unclassified 1235
402 Ga0097620_100002669 3300006931 Bacteria 18110
403 Ga0097620_100128263 3300006931 Bacteria 2607
404 Ga0097620_100160182 3300006931 Bacteria 2329
405 Ga0097620_100307833 3300006931 Bacteria 1678
406 Ga0097620_100420494 3300006931 Bacteria 1433
407 Ga0097620_100982294 3300006931 Unclassified 927
408 Ga0097620_101774014 3300006931 Unclassified 682
409 Ga0075435_100007120 3300007076 Bacteria 7944
410 Ga0075435_100024515 3300007076 Bacteria 4684
411 Ga0075435_100025018 3300007076 Bacteria 4642
412 Ga0075435_100035427 3300007076 Bacteria 3961
413 Ga0075435_100060351 3300007076 Bacteria 3075
414 Ga0075435_100420801 3300007076 Bacteria 1150
415 Ga0099794_10064534 3300007265 Bacteria 1784
416 Ga0105240_10011543 3300009093 Bacteria 12296
417 Ga0105240_10130144 3300009093 Bacteria 3020
418 Ga0111539_10001096 3300009094 Bacteria 35773
419 Ga0111539_10001535 3300009094 Bacteria 30735
420 Ga0111539_10002877 3300009094 Bacteria 22849
421 Ga0111539_10004585 3300009094 Bacteria 18059
422 Ga0111539_10007218 3300009094 Bacteria 14240
423 Ga0111539_10021062 3300009094 Bacteria 8030
424 Ga0111539_10021248 3300009094 Bacteria 7992
425 Ga0111539_10040375 3300009094 Bacteria 5618
426 Ga0111539_10223930 3300009094 Bacteria 2191
427 Ga0111539_10464300 3300009094 Bacteria 1474
428 Ga0111539_10635646 3300009094 Bacteria 1243
429 Ga0111539_11087557 3300009094 Bacteria 929
430 Ga0111539_11087991 3300009094 Bacteria 929
431 Ga0111539_11236344 3300009094 Bacteria 867
432 Ga0111539_11252228 3300009094 Unclassified 861
433 Ga0105245_10408947 3300009098 Bacteria 1358
434 Ga0105245_10513788 3300009098 Bacteria 1215
435 Ga0105245_11813368 3300009098 Bacteria 663
436 Ga0105247_10003746 3300009101 Bacteria 9860
437 Ga0105247_11147469 3300009101 Bacteria 616
438 Ga0105247_11323955 3300009101 Unclassified 579
439 Ga0114129_10003005 3300009147 Bacteria 23633
440 Ga0114129_10009590 3300009147 Bacteria 13809
441 Ga0114129_10034096 3300009147 Bacteria 7191
442 Ga0114129_10044082 3300009147 Bacteria 6275
443 Ga0114129_10196868 3300009147 Unclassified 2732
444 Ga0114129_10255349 3300009147 Bacteria 2352
445 Ga0114129_10341284 3300009147 Bacteria 1987
446 Ga0114129_10373398 3300009147 Bacteria 1884
447 Ga0114129_10633000 3300009147 Unclassified 1382
448 Ga0114129_10765889 3300009147 Unclassified 1234
449 Ga0114129_10876055 3300009147 Bacteria 1139
450 Ga0114129_11368504 3300009147 Unclassified 875
451 Ga0114129_11563707 3300009147 Bacteria 808
452 Ga0105243_10005747 3300009148 Bacteria 9634
453 Ga0105243_10521592 3300009148 Unclassified 1130
454 Ga0105243_10632245 3300009148 Bacteria 1035
455 Ga0105243_10768920 3300009148 Bacteria 946
456 Ga0105241_10016789 3300009174 Bacteria 5373
457 Ga0105241_10854544 3300009174 Bacteria 842
458 Ga0105241_11263399 3300009174 Unclassified 702
459 Ga0105242_10014745 3300009176 Bacteria 6053
460 Ga0105242_10049063 3300009176 Bacteria 3434
461 Ga0105242_10178766 3300009176 Bacteria 1871
462 Ga0105242_11163647 3300009176 Bacteria 789
463 Ga0105242_12412189 3300009176 Bacteria 573
464 Ga0105248_10025874 3300009177 Bacteria 6528
465 Ga0105248_10051241 3300009177 Bacteria 4632
466 Ga0105248_10058517 3300009177 Bacteria 4328
467 Ga0105248_10065729 3300009177 Bacteria 4072
468 Ga0105248_10662131 3300009177 Bacteria 1178
469 Ga0105248_11382836 3300009177 Bacteria 796
470 Ga0105248_11562907 3300009177 Unclassified 747
471 Ga0105248_11688599 3300009177 Bacteria 718
472 Ga0105237_11681099 3300009545 Unclassified 642
473 Ga0105238_10012691 3300009551 Bacteria 8503
474 Ga0105238_10724325 3300009551 Bacteria 1007
475 Ga0105249_10056160 3300009553 Bacteria 3604
476 Ga0105249_10064382 3300009553 Unclassified 3370
477 Ga0105249_10234697 3300009553 Bacteria 1810
478 Ga0105249_10655349 3300009553 Unclassified 1108
479 Ga0105249_10950119 3300009553 Bacteria 927
480 Ga0105249_11615739 3300009553 Unclassified 721
481 Ga0105249_11674273 3300009553 Unclassified 709
482 Ga0105249_12884872 3300009553 Bacteria 552
483 Ga0105249_12992665 3300009553 Bacteria 543
484 Ga0105239_11456264 3300010375 Bacteria 791
485 Ga0105246_10360153 3300011119 Bacteria 1195
486 Ga0105246_10424975 3300011119 Bacteria 1110
487 Ga0157315_1020076 3300012508 Unclassified 698
488 Ga0157370_10403321 3300013104 Unclassified 1258
489 Ga0157369_11541658 3300013105 Unclassified 676
490 Ga0157374_10275837 3300013296 Bacteria 1659
491 Ga0157374_10367168 3300013296 Bacteria 1432
492 Ga0157378_12002953 3300013297 Bacteria 629
493 Ga0163162_10034885 3300013306 Bacteria 5008
494 Ga0163162_10173920 3300013306 Bacteria 2278
495 Ga0163162_10869929 3300013306 Bacteria 1016
496 Ga0163162_11148816 3300013306 Bacteria 881
497 Ga0157372_10190407 3300013307 Bacteria 2376
498 Ga0157375_10066455 3300013308 Bacteria 3600
499 Ga0157375_10070818 3300013308 Bacteria 3498
500 Ga0157375_10136534 3300013308 Bacteria 2577
501 Ga0157375_10500098 3300013308 Unclassified 1380
502 Ga0157375_10740713 3300013308 Bacteria 1135
503 Ga0157375_11099477 3300013308 Bacteria 930
504 Ga0157375_11348247 3300013308 Unclassified 840
505 Ga0163163_10049669 3300014325 Bacteria 4128
506 Ga0163163_10213898 3300014325 Bacteria 1977
507 Ga0163163_10261905 3300014325 Bacteria 1780
508 Ga0163163_11444192 3300014325 Bacteria 749
509 Ga0157380_10007481 3300014326 Bacteria 7754
510 Ga0157380_10013472 3300014326 Bacteria 5962
511 Ga0157380_10086536 3300014326 Bacteria 2575
512 Ga0157380_10092262 3300014326 Bacteria 2502
513 Ga0157380_10095680 3300014326 Bacteria 2461
514 Ga0157380_10353092 3300014326 Bacteria 1377
515 Ga0157380_10605065 3300014326 Unclassified 1085
516 Ga0157380_10709760 3300014326 Bacteria 1012
517 Ga0157380_10763339 3300014326 Bacteria 980
518 Ga0157380_10777990 3300014326 Bacteria 972
519 Ga0157380_11430781 3300014326 Unclassified 742
520 Ga0157380_12140741 3300014326 Bacteria 623
521 Ga0157377_10011536 3300014745 Bacteria 4414
522 Ga0157377_10031760 3300014745 Bacteria 2872
523 Ga0157377_10220772 3300014745 Bacteria 1213
524 Ga0157377_10319348 3300014745 Bacteria 1031
525 Ga0157377_10328638 3300014745 Bacteria 1018
526 Ga0157377_10340699 3300014745 Unclassified 1002
527 Ga0157379_10005722 3300014968 Bacteria 10693
528 Ga0157379_10048906 3300014968 Bacteria 3775
529 Ga0157379_10067766 3300014968 Bacteria 3190
530 Ga0157379_10116343 3300014968 Bacteria 2404
531 Ga0157379_10500991 3300014968 Archaea 1126
532 Ga0157379_10971797 3300014968 Bacteria 808
533 Ga0157376_10140572 3300014969 Unclassified 2165
534 Ga0157376_10154267 3300014969 Bacteria 2074
535 Ga0157376_10693536 3300014969 Unclassified 1023
536 Ga0157376_12272039 3300014969 Bacteria 581
537 Ga0182005_1245895 3300015265 Bacteria 552
538 Ga0163161_10054592 3300017792 Unclassified 2899
539 Ga0163161_10558140 3300017792 Bacteria 939
540 Ga0207673_1004444 3300025290 Bacteria 1678
541 Ga0207697_10006229 3300025315 Bacteria 5424
542 Ga0207697_10014857 3300025315 Bacteria 3225
543 Ga0207697_10057159 3300025315 Unclassified 1619
544 Ga0207697_10062782 3300025315 Bacteria 1548
545 Ga0207697_10100761 3300025315 Bacteria 1231
546 Ga0207697_10110133 3300025315 Bacteria 1179
547 Ga0207653_10042479 3300025885 Bacteria 1496
548 Ga0207682_10025689 3300025893 Bacteria 2336
549 Ga0207682_10044666 3300025893 Bacteria 1817
550 Ga0207682_10084505 3300025893 Bacteria 1366
551 Ga0207682_10100194 3300025893 Unclassified 1266
552 Ga0207682_10586084 3300025893 Unclassified 526
553 Ga0207642_10015048 3300025899 Bacteria 2872
554 Ga0207642_10084503 3300025899 Bacteria 1550
555 Ga0207642_10193415 3300025899 Bacteria 1118
556 Ga0207642_10420664 3300025899 Unclassified 804
557 Ga0207710_10005377 3300025900 Bacteria 5525
558 Ga0207710_10012471 3300025900 Bacteria 3576
559 Ga0207688_10001167 3300025901 Bacteria 13553
560 Ga0207688_10197285 3300025901 Unclassified 1206
561 Ga0207688_10331306 3300025901 Unclassified 935
562 Ga0207688_10922933 3300025901 Bacteria 553
563 Ga0207680_10136487 3300025903 Bacteria 1622
564 Ga0207680_10200845 3300025903 Bacteria 1358
565 Ga0207680_10575620 3300025903 Bacteria 805
566 Ga0207645_10006799 3300025907 Bacteria 8164
567 Ga0207645_10011628 3300025907 Bacteria 6003
568 Ga0207645_10035884 3300025907 Unclassified 3183
569 Ga0207645_10147272 3300025907 Bacteria 1536
570 Ga0207645_10262055 3300025907 Bacteria 1145
571 Ga0207645_10270858 3300025907 Unclassified 1126
572 Ga0207643_10000421 3300025908 Bacteria 28011
573 Ga0207643_10003973 3300025908 Bacteria 7961
574 Ga0207643_10031908 3300025908 Bacteria 2939
575 Ga0207643_10062430 3300025908 Bacteria 2129
576 Ga0207643_10137132 3300025908 Bacteria 1459
577 Ga0207643_10225562 3300025908 Bacteria 1148
578 Ga0207643_10974830 3300025908 Bacteria 549
579 Ga0207705_10116108 3300025909 Bacteria 1982
580 Ga0207684_10086680 3300025910 Bacteria 2667
581 Ga0207684_10231337 3300025910 Bacteria 1595
582 Ga0207684_10355065 3300025910 Bacteria 1262
583 Ga0207684_10518406 3300025910 Bacteria 1021
584 Ga0207654_10018539 3300025911 Bacteria 3654
585 Ga0207654_10427680 3300025911 Bacteria 925
586 Ga0207654_10811664 3300025911 Unclassified 676
587 Ga0207707_10069371 3300025912 Bacteria 3072
588 Ga0207695_10035464 3300025913 Bacteria 5409
589 Ga0207695_10073089 3300025913 Bacteria 3495
590 Ga0207695_10385596 3300025913 Bacteria 1286
591 Ga0207693_10176989 3300025915 Bacteria 1678
592 Ga0207693_10199072 3300025915 Bacteria 1575
593 Ga0207660_10045755 3300025917 Bacteria 3084
594 Ga0207660_10402687 3300025917 Bacteria 1102
595 Ga0207662_10008088 3300025918 Bacteria 5743
596 Ga0207662_10085309 3300025918 Bacteria 1934
597 Ga0207662_10576440 3300025918 Bacteria 781
598 Ga0207662_10596891 3300025918 Bacteria 768
599 Ga0207657_10000448 3300025919 Bacteria 43812
600 Ga0207657_10622168 3300025919 Bacteria 842
601 Ga0207649_10034873 3300025920 Bacteria 3018
602 Ga0207649_10690565 3300025920 Unclassified 791
603 Ga0207649_10808486 3300025920 Unclassified 732
604 Ga0207649_10818863 3300025920 Bacteria 727
605 Ga0207649_11101091 3300025920 Bacteria 627
606 Ga0207652_10074593 3300025921 Bacteria 2954
607 Ga0207652_10147531 3300025921 Bacteria 2106
608 Ga0207646_10063922 3300025922 Bacteria 3285
609 Ga0207646_10402679 3300025922 Bacteria 1236
610 Ga0207681_10014493 3300025923 Bacteria 4900
611 Ga0207681_10014583 3300025923 Bacteria 4889
612 Ga0207681_10022470 3300025923 Bacteria 4023
613 Ga0207681_10027511 3300025923 Bacteria 3678
614 Ga0207681_10055231 3300025923 Bacteria 2704
615 Ga0207681_10187241 3300025923 Unclassified 1581
616 Ga0207681_10267567 3300025923 Bacteria 1340
617 Ga0207681_10526870 3300025923 Bacteria 970
618 Ga0207681_10574473 3300025923 Bacteria 929
619 Ga0207681_10883352 3300025923 Unclassified 748
620 Ga0207681_11226757 3300025923 Bacteria 630
621 Ga0207681_11234983 3300025923 Unclassified 628
622 Ga0207694_10075167 3300025924 Bacteria 2644
623 Ga0207694_11103807 3300025924 Bacteria 671
624 Ga0207650_10023131 3300025925 Unclassified 4406
625 Ga0207650_10110013 3300025925 Bacteria 2131
626 Ga0207650_10218521 3300025925 Unclassified 1533
627 Ga0207650_10535292 3300025925 Bacteria 981
628 Ga0207659_10014101 3300025926 Bacteria 5146
629 Ga0207659_10082191 3300025926 Bacteria 2384
630 Ga0207659_10107886 3300025926 Unclassified 2111
631 Ga0207659_10117411 3300025926 Bacteria 2033
632 Ga0207659_10249523 3300025926 Unclassified 1439
633 Ga0207659_10279966 3300025926 Bacteria 1363
634 Ga0207659_10299663 3300025926 Bacteria 1320
635 Ga0207687_10180945 3300025927 Bacteria 1633
636 Ga0207687_10727635 3300025927 Bacteria 843
637 Ga0207687_10850048 3300025927 Bacteria 780
638 Ga0207644_10890390 3300025931 Bacteria 746
639 Ga0207690_10073740 3300025932 Unclassified 2362
640 Ga0207706_10013947 3300025933 Bacteria 7287
641 Ga0207706_10016745 3300025933 Bacteria 6617
642 Ga0207706_10078833 3300025933 Unclassified 2897
643 Ga0207706_10094059 3300025933 Bacteria 2636
644 Ga0207686_10008837 3300025934 Bacteria 5447
645 Ga0207686_10019187 3300025934 Bacteria 3884
646 Ga0207709_10108784 3300025935 Unclassified 1849
647 Ga0207709_10148014 3300025935 Bacteria 1623
648 Ga0207709_10197562 3300025935 Bacteria 1434
649 Ga0207709_10736745 3300025935 Bacteria 791
650 Ga0207670_10093496 3300025936 Bacteria 2131
651 Ga0207670_10098961 3300025936 Unclassified 2079
652 Ga0207670_10167320 3300025936 Unclassified 1645
653 Ga0207670_10216198 3300025936 Bacteria 1464
654 Ga0207670_10270448 3300025936 Unclassified 1321
655 Ga0207670_10440253 3300025936 Bacteria 1049
656 Ga0207669_10004678 3300025937 Bacteria 6053
657 Ga0207669_10063861 3300025937 Unclassified 2275
658 Ga0207669_10075630 3300025937 Bacteria 2134
659 Ga0207669_10118812 3300025937 Bacteria 1790
660 Ga0207669_10163537 3300025937 Unclassified 1575
661 Ga0207669_10377140 3300025937 Unclassified 1104
662 Ga0207669_11131837 3300025937 Unclassified 661
663 Ga0207704_10001915 3300025938 Bacteria 9328
664 Ga0207704_10046592 3300025938 Bacteria 2585
665 Ga0207704_10052554 3300025938 Bacteria 2471
666 Ga0207704_10599289 3300025938 Bacteria 902
667 Ga0207704_10773359 3300025938 Bacteria 800
668 Ga0207665_10059331 3300025939 Bacteria 2589
669 Ga0207665_10123932 3300025939 Bacteria 1828
670 Ga0207691_10011048 3300025940 Bacteria 8665
671 Ga0207691_10037771 3300025940 Bacteria 4470
672 Ga0207691_10052143 3300025940 Bacteria 3737
673 Ga0207691_10058452 3300025940 Bacteria 3507
674 Ga0207691_10101756 3300025940 Bacteria 2563
675 Ga0207691_10192560 3300025940 Bacteria 1778
676 Ga0207691_10220937 3300025940 Bacteria 1643
677 Ga0207691_10232816 3300025940 Unclassified 1595
678 Ga0207691_10265102 3300025940 Unclassified 1480
679 Ga0207691_10920530 3300025940 Bacteria 731
680 Ga0207711_10026694 3300025941 Bacteria 4848
681 Ga0207711_10171150 3300025941 Bacteria 1971
682 Ga0207711_10212815 3300025941 Bacteria 1766
683 Ga0207711_10248831 3300025941 Bacteria 1632
684 Ga0207711_11329138 3300025941 Unclassified 661
685 Ga0207689_10009631 3300025942 Bacteria 8328
686 Ga0207689_10012411 3300025942 Bacteria 7285
687 Ga0207689_10032193 3300025942 Bacteria 4362
688 Ga0207689_10365702 3300025942 Bacteria 1200
689 Ga0207689_10426007 3300025942 Unclassified 1108
690 Ga0207661_10098762 3300025944 Bacteria 2447
691 Ga0207679_10007458 3300025945 Bacteria 6940
692 Ga0207679_10021997 3300025945 Bacteria 4335
693 Ga0207679_10106162 3300025945 Unclassified 2207
694 Ga0207679_10196205 3300025945 Unclassified 1683
695 Ga0207679_10306941 3300025945 Unclassified 1370
696 Ga0207679_10594375 3300025945 Unclassified 997
697 Ga0207679_10710492 3300025945 Unclassified 912
698 Ga0207667_10131023 3300025949 Bacteria 2583
699 Ga0207667_10519938 3300025949 Unclassified 1206
700 Ga0207667_11983907 3300025949 Unclassified 542
701 Ga0207651_10026837 3300025960 Bacteria 3606
702 Ga0207651_10045179 3300025960 Bacteria 2953
703 Ga0207651_10048143 3300025960 Bacteria 2880
704 Ga0207651_10196938 3300025960 Bacteria 1611
705 Ga0207651_10359114 3300025960 Bacteria 1229
706 Ga0207651_10566373 3300025960 Bacteria 989
707 Ga0207712_10727976 3300025961 Bacteria 868
708 Ga0207712_11686813 3300025961 Bacteria 568
709 Ga0207712_11863022 3300025961 Bacteria 539
710 Ga0207668_10039855 3300025972 Bacteria 3166
711 Ga0207668_10123390 3300025972 Bacteria 1965
712 Ga0207668_10177611 3300025972 Bacteria 1676
713 Ga0207668_10179344 3300025972 Unclassified 1669
714 Ga0207668_10372496 3300025972 Bacteria 1200
715 Ga0207668_10669683 3300025972 Bacteria 910
716 Ga0207640_10009623 3300025981 Bacteria 5419
717 Ga0207640_10485473 3300025981 Unclassified 1026
718 Ga0207640_10536156 3300025981 Bacteria 981
719 Ga0207640_10880173 3300025981 Bacteria 781
720 Ga0207640_11902215 3300025981 Bacteria 538
721 Ga0207658_10520492 3300025986 Unclassified 1061
722 Ga0207658_10554222 3300025986 Bacteria 1029
723 Ga0207658_10714620 3300025986 Unclassified 906
724 Ga0207658_10824651 3300025986 Archaea 843
725 Ga0207658_11066660 3300025986 Unclassified 738
726 Ga0207677_10118776 3300026023 Bacteria 1984
727 Ga0207677_11499156 3300026023 Unclassified 623
728 Ga0207703_10085378 3300026035 Bacteria 2641
729 Ga0207703_10157010 3300026035 Bacteria 1989
730 Ga0207703_10419059 3300026035 Bacteria 1245
731 Ga0207703_10788649 3300026035 Bacteria 907
732 Ga0207703_10813619 3300026035 Bacteria 892
733 Ga0207639_10161244 3300026041 Bacteria 1890
734 Ga0207639_11013193 3300026041 Unclassified 778
735 Ga0207678_10073614 3300026067 Bacteria 2928
736 Ga0207678_10089975 3300026067 Bacteria 2623
737 Ga0207678_10441441 3300026067 Unclassified 1130
738 Ga0207678_10496826 3300026067 Unclassified 1063
739 Ga0207708_10004076 3300026075 Bacteria 10744
740 Ga0207708_10013130 3300026075 Bacteria 6182
741 Ga0207708_10039098 3300026075 Bacteria 3614
742 Ga0207708_10066324 3300026075 Bacteria 2760
743 Ga0207708_10179488 3300026075 Bacteria 1681
744 Ga0207708_10186032 3300026075 Unclassified 1651
745 Ga0207708_10705813 3300026075 Bacteria 863
746 Ga0207708_11408974 3300026075 Unclassified 612
747 Ga0207641_10142894 3300026088 Bacteria 2161
748 Ga0207641_10437360 3300026088 Bacteria 1262
749 Ga0207641_10546006 3300026088 Unclassified 1130
750 Ga0207648_10000802 3300026089 Bacteria 35458
751 Ga0207648_10017964 3300026089 Bacteria 6414
752 Ga0207648_10073765 3300026089 Bacteria 2974
753 Ga0207648_10142645 3300026089 Unclassified 2112
754 Ga0207648_10160602 3300026089 Bacteria 1985
755 Ga0207648_10307167 3300026089 Bacteria 1423
756 Ga0207648_10351353 3300026089 Bacteria 1329
757 Ga0207648_10503879 3300026089 Bacteria 1108
758 Ga0207648_10624495 3300026089 Unclassified 995
759 Ga0207648_10742489 3300026089 Bacteria 911
760 Ga0207648_10833728 3300026089 Bacteria 859
761 Ga0207648_10931739 3300026089 Unclassified 812
762 Ga0207676_10097975 3300026095 Bacteria 2423
763 Ga0207676_10172785 3300026095 Bacteria 1884
764 Ga0207676_10181467 3300026095 Bacteria 1843
765 Ga0207676_10782536 3300026095 Unclassified 930
766 Ga0207676_10849720 3300026095 Bacteria 893
767 Ga0207674_10076334 3300026116 Bacteria 3359
768 Ga0207674_10172945 3300026116 Unclassified 2113
769 Ga0207674_11073421 3300026116 Bacteria 774
770 Ga0207674_12099102 3300026116 Bacteria 529
771 Ga0207675_100003438 3300026118 Bacteria 15481
772 Ga0207675_100008037 3300026118 Bacteria 9940
773 Ga0207675_100026637 3300026118 Bacteria 5382
774 Ga0207675_100030876 3300026118 Bacteria 4990
775 Ga0207675_100039233 3300026118 Bacteria 4420
776 Ga0207675_100082000 3300026118 Bacteria 3024
777 Ga0207675_100295147 3300026118 Bacteria 1577
778 Ga0207675_100297167 3300026118 Bacteria 1572
779 Ga0207675_100308482 3300026118 Unclassified 1543
780 Ga0207675_100453834 3300026118 Bacteria 1270
781 Ga0207675_101009548 3300026118 Bacteria 850
782 Ga0207683_10042430 3300026121 Bacteria 3973
783 Ga0207683_10051914 3300026121 Unclassified 3593
784 Ga0207683_10153964 3300026121 Unclassified 2076
785 Ga0207683_10532556 3300026121 Unclassified 1086
786 Ga0207698_10088151 3300026142 Unclassified 2530
787 Ga0209971_1078061 3300027682 Bacteria 805
788 Ga0209998_10055051 3300027717 Bacteria 928
789 Ga0209974_10059230 3300027876 Archaea 1295
790 Ga0209974_10062413 3300027876 Bacteria 1262
791 Ga0207428_10000515 3300027907 Bacteria 46261
792 Ga0207428_10002311 3300027907 Bacteria 19090
793 Ga0207428_10006882 3300027907 Bacteria 10421
794 Ga0207428_10008383 3300027907 Bacteria 9335
795 Ga0207428_10058793 3300027907 Bacteria 3050
796 Ga0207428_10327876 3300027907 Bacteria 1129
797 Ga0207428_10752096 3300027907 Bacteria 695
798 Ga0207428_10942401 3300027907 Bacteria 609
799 Ga0268266_10054105 3300028379 Bacteria 3449
800 Ga0268266_10400147 3300028379 Bacteria 1298
801 Ga0268266_10797775 3300028379 Bacteria 912
802 Ga0268265_10004006 3300028380 Bacteria 10369
803 Ga0268265_10030648 3300028380 Bacteria 3876
804 Ga0268265_10154862 3300028380 Bacteria 1938
805 Ga0268265_10188184 3300028380 Unclassified 1780
806 Ga0268265_10195042 3300028380 Bacteria 1752
807 Ga0268265_10234290 3300028380 Bacteria 1616
808 Ga0268265_10258420 3300028380 Bacteria 1547
809 Ga0268265_10352745 3300028380 Bacteria 1344
810 Ga0268265_10389729 3300028380 Bacteria 1284
811 Ga0268265_10664087 3300028380 Unclassified 1003
812 Ga0268265_10749026 3300028380 Bacteria 948
813 Ga0268265_11165060 3300028380 Bacteria 767
814 Ga0268264_10128495 3300028381 Bacteria 2243
815 Ga0268264_10142874 3300028381 Unclassified 2136
816 Ga0268264_10168656 3300028381 Bacteria 1978
817 Ga0268264_10775511 3300028381 Bacteria 956
818 Ga0268264_11184763 3300028381 Bacteria 773
819 Ga0268264_11202200 3300028381 Bacteria 767
820 Ga0268264_11987719 3300028381 Bacteria 591
821 Ga0268264_12128022 3300028381 Bacteria 569
822 Ga0265316_10282318 3300031344 Bacteria 1213
823 Ga0307408_100086674 3300031548 Bacteria 2354
824 Ga0307408_100460014 3300031548 Bacteria 1106
825 Ga0307408_100634881 3300031548 Unclassified 953
826 Ga0265314_10120161 3300031711 Bacteria 1655
827 Ga0307405_10004821 3300031731 Bacteria 6435
828 Ga0307405_10551294 3300031731 Unclassified 933
829 Ga0307413_10126311 3300031824 Bacteria 1742
830 Ga0307413_11005855 3300031824 Unclassified 715
831 Ga0307410_10008571 3300031852 Bacteria 5678
832 Ga0307410_10907490 3300031852 Unclassified 755
833 Ga0307406_10068985 3300031901 Bacteria 2310
834 Ga0307407_10003751 3300031903 Bacteria 6311
835 Ga0307407_10253003 3300031903 Unclassified 1208
836 Ga0307407_10266700 3300031903 Bacteria 1180
837 Ga0307412_10027611 3300031911 Bacteria 3541
838 Ga0307412_10574164 3300031911 Bacteria 951
839 Ga0307412_11397689 3300031911 Unclassified 633
840 Ga0307412_11605491 3300031911 Bacteria 594
841 Ga0307409_100062413 3300031995 Bacteria 2917
842 Ga0307409_101109911 3300031995 Unclassified 812
843 Ga0307416_100097463 3300032002 Unclassified 2546
844 Ga0307416_101080945 3300032002 Unclassified 906
845 Ga0307411_10015044 3300032005 Bacteria 4329
846 Ga0307411_10127862 3300032005 Bacteria 1851
847 Ga0307411_10445419 3300032005 Bacteria 1082
848 Ga0307411_10819585 3300032005 Bacteria 821
849 Ga0307411_11917682 3300032005 Bacteria 552
850 Ga0307415_100024282 3300032126 Bacteria 3781
851 Ga0373948_0006326 3300034817 Bacteria 1953
852 Ga0373938_0152264 3300034957 Bacteria 616
853 Ga0373928_0007511 3300035084 Bacteria 2104
854 Ga0373940_0271815 3300035088 Bacteria 576
855 Ga0373944_0149309 3300035089 Unclassified 823
856 Ga0373949_0002163 3300035090 Bacteria 5149
857 Ga0373951_0007755 3300035091 Bacteria 2436
858 Ga0373952_0003771 3300035092 Bacteria 2740
859 Ga0373932_0006339 3300035112 Bacteria 2796
860 Ga0373932_0111103 3300035112 Bacteria 903
861 Ga0373932_0167821 3300035112 Bacteria 763
862 Ga0373939_0015830 3300035114 Bacteria 1979
863 Ga0373941_0000343 3300035115 Bacteria 9134
864 Ga0373941_0266422 3300035115 Bacteria 673
865 Ga0373954_0046367 3300035118 Bacteria 2032
866 Ga0373956_0223500 3300035119 Bacteria 894
867 Ga0373960_0001256 3300035121 Bacteria 5572
868 Ga0373960_0025199 3300035121 Bacteria 1615
869 Ga0373943_0124050 3300035170 Bacteria 1375
870 Ga0373946_0069755 3300035171 Bacteria 1515
871 Ga0373955_0463325 3300035172 Bacteria 773
872 Ga0373955_0665361 3300035172 Bacteria 639
873 Ga0373961_0022626 3300035241 Bacteria 1683
874 Ga0373961_0062944 3300035241 Bacteria 1130
875 Ga0373962_0001870 3300035242 Bacteria 5016
876 Ga0373931_0001339 3300035691 Bacteria 10529
877 Ga0373931_0082457 3300035691 Bacteria 1778
878 Ga0373931_0120135 3300035691 Bacteria 1501
879 Ga0373937_0159180 3300036401 Bacteria 2117
880 Ga0373925_0241361 3300037068 Bacteria 1447
881 Ga0373925_0496367 3300037068 Bacteria 1002
882 Ga0439453_0022459 3300041408 Unclassified 1144
883 Ga0451800_1621613 3300041459 Bacteria 589
884 Ga0439433_0027879 3300041999 Archaea 1283
885 Ga0439454_100652 3300042011 Unclassified 543
886 Ga0439462_0199881 3300042015 Archaea 569
887 Ga0450914_046764 3300042118 Unclassified 561
888 Ga0439446_0042916 3300042156 Unclassified 1336
889 Ga0439446_0099084 3300042156 Bacteria 920
890 Ga0439434_0057687 3300042435 Bacteria 1211
891 Ga0439435_0092311 3300042436 Bacteria 921
892 Ga0439464_0093384 3300042439 Unclassified 909
893 Ga0439464_0122213 3300042439 Unclassified 802
894 Ga0450916_024858 3300042530 Bacteria 843
895 Ga0439440_0032645 3300042993 Bacteria 1237
896 Ga0439440_0104953 3300042993 Unclassified 772
897 Ga0451576_0010882 3300045051 Bacteria 10408
898 Ga0451576_0679933 3300045051 Unclassified 1081
899 Ga0495592_0322612 3300046454 Archaea 998
900 Ga0495603_0063471 3300046455 Bacteria 2179
901 Ga0495580_0073772 3300046472 Bacteria 2382
902 Ga0495582_0118102 3300046473 Bacteria 1493
903 Ga0495662_0505033 3300046476 Bacteria 593
904 Ga0495664_0695675 3300046477 Archaea 601
905 Ga0495594_0062966 3300046499 Archaea 2055
906 Ga0495583_0160906 3300046506 Unclassified 926
907 Ga0495630_0117208 3300046517 Bacteria 2019
908 Ga0495630_0177025 3300046517 Bacteria 1626
909 Ga0495663_0265200 3300046525 Bacteria 613
910 Ga0495666_0322956 3300046526 Archaea 697
911 Ga0495640_0054769 3300046533 Bacteria 2731
912 Ga0495586_0074839 3300046535 Bacteria 1854
913 Ga0495586_0569150 3300046535 Bacteria 654
914 Ga0495598_0179138 3300046537 Bacteria 755
915 Ga0495621_0054794 3300046539 Bacteria 1434
916 Ga0495621_0097697 3300046539 Unclassified 1114
917 Ga0495645_0011107 3300046543 Bacteria 6332
918 Ga0495633_0143241 3300046558 Bacteria 1105
919 Ga0495634_0423410 3300046642 Bacteria 788
920 Ga0495635_0197813 3300046663 Bacteria 1364
921 Ga0495635_0200578 3300046663 Bacteria 1353
922 Ga0495659_0488488 3300046664 Bacteria 539
923 Ga0495588_0254220 3300046674 Bacteria 926
924 Ga0495599_0366166 3300046678 Bacteria 862
925 Ga0495647_0058426 3300046681 Bacteria 1516
926 Ga0495647_0096855 3300046681 Bacteria 1217
927 Ga0495647_0115562 3300046681 Unclassified 1124
928 Ga0495647_0299780 3300046681 Bacteria 724
929 Ga0495658_0039106 3300046683 Bacteria 2630
930 Ga0495658_0058218 3300046683 Bacteria 2210
931 Ga0495669_0207481 3300046684 Unclassified 938
932 Ga0495636_0064540 3300047318 Unclassified 1554
933 Ga0495674_0106880 3300047319 Bacteria 2376
934 Ga0495674_0186479 3300047319 Bacteria 1726
935 Ga0495680_0126574 3300047322 Bacteria 1881
936 Ga0495680_0943251 3300047322 Bacteria 555
937 Ga0495684_0086028 3300047471 Bacteria 2383
938 Ga0495684_0160441 3300047471 Bacteria 1677
939 Ga0495602_0600681 3300048088 Bacteria 757
940 Ga0496101_1106349 3300048904 Bacteria 622
941 Ga0496102_0067969 3300048905 Bacteria 3269
942 Ga0496102_0091619 3300048905 Bacteria 2814
943 Ga0496102_1415078 3300048905 Unclassified 614
944 Ga0496103_0316398 3300048906 Bacteria 1004
945 Ga0496103_0750067 3300048906 Unclassified 617
946 Ga0496104_1590651 3300048907 Unclassified 556
947 Ga0496106_0485290 3300048909 Bacteria 993
948 Ga0496106_0776202 3300048909 Bacteria 761
949 Ga0496106_1183616 3300048909 Bacteria 597
950 Ga0496108_0025003 3300048911 Bacteria 4919
951 Ga0496109_0331752 3300048912 Bacteria 1436
952 Ga0496109_1098377 3300048912 Unclassified 732
953 Ga0496110_0171743 3300048913 Bacteria 1967
954 Ga0496110_0680971 3300048913 Bacteria 929
955 Ga0496112_0037423 3300048915 Bacteria 4737
956 Ga0496113_0177816 3300048916 Bacteria 1686
957 Ga0496113_0354640 3300048916 Bacteria 1177
958 Ga0496114_0041782 3300048917 Bacteria 3800
959 Ga0501298_030201 3300049521 Unclassified 1059
960 Ga0501033_0720816 3300049570 Unclassified 678
961 Ga0501036_0101941 3300049572 Bacteria 2428
962 Ga0501036_0119187 3300049572 Bacteria 2229
963 Ga0501037_0372352 3300049573 Bacteria 983
964 Ga0501039_0056023 3300049575 Bacteria 3054
965 Ga0501039_0069299 3300049575 Bacteria 2739
966 Ga0501040_0018432 3300049576 Unclassified 4634
967 Ga0501040_0086204 3300049576 Bacteria 2180
968 Ga0501040_0964412 3300049576 Bacteria 618
969 Ga0501041_0064651 3300049577 Bacteria 2240
970 Ga0501041_0189559 3300049577 Bacteria 1288
971 Ga0501042_0025948 3300049578 Bacteria 4118
972 Ga0501042_0062804 3300049578 Bacteria 2654
973 Ga0501046_0001085 3300049580 Bacteria 26670
974 Ga0501048_0063991 3300049582 Bacteria 2601
975 Ga0501048_0088906 3300049582 Bacteria 2179
976 Ga0501067_0625052 3300049583 Bacteria 604
977 Ga0501071_0037006 3300049587 Bacteria 3482
978 Ga0501071_0156786 3300049587 Bacteria 1700
979 Ga0501071_0313238 3300049587 Unclassified 1191
980 Ga0501074_0658231 3300049590 Unclassified 740
981 Ga0501074_1172151 3300049590 Unclassified 539
982 Ga0501075_0003591 3300049591 Bacteria 10393
983 Ga0501075_0077467 3300049591 Bacteria 2516
984 Ga0501075_0276180 3300049591 Bacteria 1280
985 Ga0501075_0480718 3300049591 Bacteria 948
986 Ga0501075_0592558 3300049591 Unclassified 846
987 Ga0501076_0024232 3300049592 Bacteria 4688
988 Ga0501076_0461218 3300049592 Archaea 1046
989 Ga0501076_0854306 3300049592 Bacteria 751
990 Ga0501076_1162535 3300049592 Unclassified 635
991 Ga0501077_0015002 3300049593 Unclassified 4871
992 Ga0501077_0711413 3300049593 Unclassified 645
993 Ga0501249_010075 3300049679 Bacteria 1970
994 Ga0501079_0209458 3300049741 Bacteria 1523
995 Ga0501081_0030039 3300049743 Bacteria 3676
996 Ga0501081_0046932 3300049743 Bacteria 2970
997 Ga0501083_0218121 3300049744 Bacteria 1243
998 Ga0501083_0493680 3300049744 Bacteria 797
999 Ga0501044_1174262 3300049823 Unclassified 636
1000 Ga0501045_0056520 3300049824 Bacteria 2870
1001 nmdc:mga05p37_1035000_c1 3300050507 Bacteria 868
1002 nmdc:mga05p37_11228_c1 3300050507 Bacteria 10650
1003 nmdc:mga05p37_1363605_c1 3300050507 Bacteria 717
1004 nmdc:mga05p37_156059_c1 3300050507 Archaea 2789
1005 nmdc:mga05p37_174100_c1 3300050507 Unclassified 2623
1006 nmdc:mga05p37_299257_c1 3300050507 Bacteria 1912
1007 nmdc:mga05p37_32801_c1 3300050507 Bacteria 6354
1008 nmdc:mga05p37_386041_c1 3300050507 Bacteria 1639
1009 nmdc:mga05p37_406896_c1 3300050507 Unclassified 1587
1010 nmdc:mga05p37_43511_c1 3300050507 Bacteria 5525
1011 nmdc:mga05p37_47284_c1 3300050507 Bacteria 5292
1012 nmdc:mga05p37_81153_c2 3300050507 Bacteria 2482
1013 nmdc:mga05p37_822700_c1 3300050507 Unclassified 1013
1014 nmdc:mga09592_2456_c1 3300050508 Bacteria 14958
1015 nmdc:mga09592_290133_c1 3300050508 Bacteria 1418
1016 nmdc:mga09592_3877_c1 3300050508 Bacteria 12047
1017 nmdc:mga09592_514254_c1 3300050508 Bacteria 1030
1018 nmdc:mga09592_54046_c1 3300050508 Bacteria 3393
1019 nmdc:mga09592_76446_c1 3300050508 Bacteria 2847
1020 nmdc:mga0qj67_1191813_c1 3300050509 Bacteria 593
1021 nmdc:mga0qj67_15050_c1 3300050509 Bacteria 5853
1022 nmdc:mga0qj67_2494_c1 3300050509 Bacteria 13126
1023 nmdc:mga0qj67_49253_c1 3300050509 Bacteria 3330
1024 nmdc:mga0qj67_585652_c1 3300050509 Unclassified 893
1025 nmdc:mga06r32_263642_c1 3300050510 Bacteria 1711
1026 nmdc:mga06r32_31910_c1 3300050510 Bacteria 4951
1027 nmdc:mga06r32_337151_c1 3300050510 Bacteria 1493
1028 nmdc:mga06r32_41442_c1 3300050510 Bacteria 4375
1029 nmdc:mga06r32_6589_c1 3300050510 Bacteria 10431
1030 nmdc:mga08y16_1241992_c1 3300050511 Bacteria 714
1031 nmdc:mga08y16_1271719_c1 3300050511 Bacteria 704
1032 nmdc:mga08y16_168554_c1 3300050511 Bacteria 2275
1033 nmdc:mga08y16_19092_c1 3300050511 Bacteria 7223
1034 nmdc:mga08y16_3326_c2 3300050511 Bacteria 5737
1035 nmdc:mga08y16_37298_c1 3300050511 Bacteria 5105
1036 nmdc:mga08y16_43724_c1 3300050511 Bacteria 4695
1037 nmdc:mga08y16_48345_c1 3300050511 Bacteria 4452
1038 nmdc:mga08y16_526993_c1 3300050511 Unclassified 1198
1039 nmdc:mga08y16_5474_c1 3300050511 Bacteria 13280
1040 nmdc:mga08y16_683_c1 3300050511 Bacteria 32086
1041 nmdc:mga08y16_79251_c1 3300050511 Bacteria 3424
1042 nmdc:mga08y16_800102_c1 3300050511 Bacteria 936
1043 nmdc:mga08y16_976_c1 3300050511 Bacteria 27870
1044 nmdc:mga0n895_1176576_c1 3300050512 Unclassified 741
1045 nmdc:mga0n895_16886_c1 3300050512 Bacteria 6711
1046 nmdc:mga0n895_184334_c1 3300050512 Bacteria 2119
1047 nmdc:mga0n895_357886_c1 3300050512 Bacteria 1478
1048 nmdc:mga0n895_42983_c1 3300050512 Bacteria 4400
1049 nmdc:mga0n895_454300_c1 3300050512 Bacteria 1293
1050 nmdc:mga0n895_632267_c1 3300050512 Bacteria 1070
1051 nmdc:mga0n895_71935_c1 3300050512 Bacteria 3430
1052 nmdc:mga0n895_77894_c1 3300050512 Unclassified 3298
1053 nmdc:mga0n895_8913_c1 3300050512 Bacteria 8740
1054 nmdc:mga0rr50_10783_c1 3300050513 Bacteria 5824
1055 nmdc:mga0rr50_118939_c1 3300050513 Bacteria 2100
1056 nmdc:mga0rr50_1258634_c1 3300050513 Unclassified 628
1057 nmdc:mga0rr50_270267_c1 3300050513 Bacteria 1417
1058 nmdc:mga0rr50_321957_c1 3300050513 Bacteria 1296
1059 nmdc:mga0rr50_373910_c1 3300050513 Bacteria 1201
1060 nmdc:mga0rr50_49091_c1 3300050513 Bacteria 3123
1061 nmdc:mga0rr50_690846_c1 3300050513 Bacteria 871
1062 nmdc:mga08x19_1161462_c1 3300050514 Unclassified 548
1063 nmdc:mga08x19_150702_c1 3300050514 Bacteria 1575
1064 nmdc:mga08x19_245572_c1 3300050514 Unclassified 1235
1065 nmdc:mga08x19_422416_c1 3300050514 Bacteria 936
1066 nmdc:mga08x19_8172_c1 3300050514 Bacteria 6218
1067 nmdc:mga08x19_88202_c1 3300050514 Bacteria 2045
1068 nmdc:mga0a205_1005171_c1 3300050515 Bacteria 681
1069 nmdc:mga0a205_11262_c1 3300050515 Bacteria 8232
1070 nmdc:mga0a205_154044_c1 3300050515 Bacteria 2197
1071 nmdc:mga0a205_200440_c1 3300050515 Unclassified 1886
1072 nmdc:mga0a205_5674_c1 3300050515 Bacteria 11245
1073 nmdc:mga0a205_818286_c1 3300050515 Unclassified 779
1074 nmdc:mga0a205_894_c1 3300050515 Bacteria 23641
1075 Ga0495601_0498053 3300053077 Archaea 786
1076 Ga0495619_0008562 3300053085 Bacteria 6474
1077 Ga0500566_0226009 3300053094 Bacteria 927
1078 Ga0501084_0004609 3300054114 Bacteria 11259
1079 Ga0501084_0073686 3300054114 Bacteria 2859
1080 Ga0590075_045219 3300059424 Unclassified 1128
1081 Ga0590077_091703 3300059426 Archaea 705
1082 Ga0501082_0014744 3300060353 Bacteria 6729
1083 Ga0530510_0032284 3300061734 Bacteria 3766
1084 Ga0530510_1262851 3300061734 Unclassified 566

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049592 Ga0501076_0461218 Ga0501076_0461218_616_1026 131
2 3300048904 Ga0496101_1106349 Ga0496101_1106349_194_595 133
3 3300035118 Ga0373954_0046367 Ga0373954_0046367_550_966 138
4 3300006852 Ga0075433_10344894 Ga0075433_103448941 152
5 3300006871 Ga0075434_100011803 Ga0075434_1000118033 152
6 3300006914 Ga0075436_100017806 Ga0075436_1000178063 152
7 3300007076 Ga0075435_100035427 Ga0075435_1000354274 152
8 3300009147 Ga0114129_10341284 Ga0114129_103412843 152
9 3300014968 Ga0157379_10116343 Ga0157379_101163433 152
10 3300027876 Ga0209974_10059230 Ga0209974_100592302 152
11 3300035172 Ga0373955_0463325 Ga0373955_0463325_208_678 152
12 3300042011 Ga0439454_100652 Ga0439454_100652_69_530 152
13 3300042439 Ga0439464_0093384 Ga0439464_0093384_89_550 152
14 3300042993 Ga0439440_0032645 Ga0439440_0032645_514_981 152
15 3300049570 Ga0501033_0720816 Ga0501033_0720816_189_647 152
16 3300049587 Ga0501071_0313238 Ga0501071_0313238_604_1062 152
17 3300050507 nmdc:mga05p37_299257_c1 nmdc:mga05p37_299257_c1_593_1051 152
18 3300050512 nmdc:mga0n895_184334_c1 nmdc:mga0n895_184334_c1_1493_1951 152
19 3300050513 nmdc:mga0rr50_270267_c1 nmdc:mga0rr50_270267_c1_261_719 152
20 3300050514 nmdc:mga08x19_1161462_c1 nmdc:mga08x19_1161462_c1_42_500 152
21 3300050515 nmdc:mga0a205_11262_c1 nmdc:mga0a205_11262_c1_5970_6428 152
22 3300002459 JGI24751J29686_10024321 JGI24751J29686_100243212 153
23 3300005330 Ga0070690_100647491 Ga0070690_1006474911 153
24 3300005334 Ga0068869_100096572 Ga0068869_1000965722 153
25 3300005337 Ga0070682_101458129 Ga0070682_1014581291 153
26 3300005339 Ga0070660_101324747 Ga0070660_1013247471 153
27 3300005354 Ga0070675_100281889 Ga0070675_1002818892 153
28 3300005455 Ga0070663_100579498 Ga0070663_1005794982 153
29 3300005544 Ga0070686_100737860 Ga0070686_1007378602 153
30 3300005544 Ga0070686_101056086 Ga0070686_1010560862 153
31 3300005564 Ga0070664_100152090 Ga0070664_1001520902 153
32 3300005842 Ga0068858_100008903 Ga0068858_1000089033 153
33 3300005844 Ga0068862_100599307 Ga0068862_1005993072 153
34 3300006237 Ga0097621_100000491 Ga0097621_10000049112 153
35 3300006358 Ga0068871_100010512 Ga0068871_1000105123 153
36 3300009101 Ga0105247_11323955 Ga0105247_113239551 153
37 3300009176 Ga0105242_10014745 Ga0105242_100147454 153
38 3300009177 Ga0105248_11382836 Ga0105248_113828362 153
39 3300009177 Ga0105248_11688599 Ga0105248_116885991 153
40 3300013104 Ga0157370_10403321 Ga0157370_104033212 153
41 3300013306 Ga0163162_11148816 Ga0163162_111488162 153
42 3300013308 Ga0157375_10136534 Ga0157375_101365341 153
43 3300013308 Ga0157375_11099477 Ga0157375_110994772 153
44 3300014325 Ga0163163_10261905 Ga0163163_102619052 153
45 3300014968 Ga0157379_10067766 Ga0157379_100677663 153
46 3300014969 Ga0157376_10140572 Ga0157376_101405722 153
47 3300025900 Ga0207710_10012471 Ga0207710_100124713 153
48 3300025907 Ga0207645_10147272 Ga0207645_101472722 153
49 3300025908 Ga0207643_10031908 Ga0207643_100319084 153
50 3300025925 Ga0207650_10535292 Ga0207650_105352922 153
51 3300025926 Ga0207659_10279966 Ga0207659_102799662 153
52 3300025927 Ga0207687_10850048 Ga0207687_108500481 153
53 3300025934 Ga0207686_10019187 Ga0207686_100191872 153
54 3300025935 Ga0207709_10197562 Ga0207709_101975622 153
55 3300025938 Ga0207704_10046592 Ga0207704_100465923 153
56 3300025941 Ga0207711_10171150 Ga0207711_101711502 153
57 3300026067 Ga0207678_10496826 Ga0207678_104968262 153
58 3300026089 Ga0207648_10833728 Ga0207648_108337282 153
59 3300026095 Ga0207676_10097975 Ga0207676_100979752 153
60 3300026095 Ga0207676_10849720 Ga0207676_108497201 153
61 3300026142 Ga0207698_10088151 Ga0207698_100881512 153
62 3300028379 Ga0268266_10054105 Ga0268266_100541051 153
63 3300028381 Ga0268264_10775511 Ga0268264_107755112 153
64 3300035119 Ga0373956_0223500 Ga0373956_0223500_234_707 153
65 3300035170 Ga0373943_0124050 Ga0373943_0124050_43_516 153
66 3300035172 Ga0373955_0665361 Ga0373955_0665361_29_502 153
67 3300037068 Ga0373925_0496367 Ga0373925_0496367_322_795 153
68 3300046455 Ga0495603_0063471 Ga0495603_0063471_1195_1668 153
69 3300046473 Ga0495582_0118102 Ga0495582_0118102_420_893 153
70 3300046476 Ga0495662_0505033 Ga0495662_0505033_23_496 153
71 3300046533 Ga0495640_0054769 Ga0495640_0054769_731_1192 153
72 3300046535 Ga0495586_0074839 Ga0495586_0074839_268_741 153
73 3300046543 Ga0495645_0011107 Ga0495645_0011107_112_585 153
74 3300046663 Ga0495635_0200578 Ga0495635_0200578_706_1179 153
75 3300046678 Ga0495599_0366166 Ga0495599_0366166_342_815 153
76 3300046681 Ga0495647_0058426 Ga0495647_0058426_627_1100 153
77 3300046681 Ga0495647_0096855 Ga0495647_0096855_44_517 153
78 3300046683 Ga0495658_0039106 Ga0495658_0039106_366_839 153
79 3300047319 Ga0495674_0186479 Ga0495674_0186479_243_716 153
80 3300047322 Ga0495680_0126574 Ga0495680_0126574_1321_1794 153
81 3300047471 Ga0495684_0086028 Ga0495684_0086028_1698_2171 153
82 3300048911 Ga0496108_0025003 Ga0496108_0025003_2504_2977 153
83 3300048912 Ga0496109_0331752 Ga0496109_0331752_346_819 153
84 3300048915 Ga0496112_0037423 Ga0496112_0037423_447_920 153
85 3300048916 Ga0496113_0177816 Ga0496113_0177816_409_882 153
86 3300048917 Ga0496114_0041782 Ga0496114_0041782_2653_3126 153
87 3300053094 Ga0500566_0226009 Ga0500566_0226009_257_730 153
88 3300003203 JGI25406J46586_10037792 JGI25406J46586_100377922 154
89 3300005290 Ga0065712_10251049 Ga0065712_102510491 154
90 3300005290 Ga0065712_10636686 Ga0065712_106366861 154
91 3300005293 Ga0065715_10639614 Ga0065715_106396142 154
92 3300005295 Ga0065707_10524797 Ga0065707_105247972 154
93 3300005328 Ga0070676_10277072 Ga0070676_102770722 154
94 3300005329 Ga0070683_100085861 Ga0070683_1000858613 154
95 3300005330 Ga0070690_100085097 Ga0070690_1000850972 154
96 3300005330 Ga0070690_100243194 Ga0070690_1002431942 154
97 3300005330 Ga0070690_100655740 Ga0070690_1006557402 154
98 3300005333 Ga0070677_10407443 Ga0070677_104074431 154
99 3300005334 Ga0068869_100005548 Ga0068869_1000055483 154
100 3300005335 Ga0070666_10039433 Ga0070666_100394332 154
101 3300005336 Ga0070680_100307806 Ga0070680_1003078063 154
102 3300005336 Ga0070680_100982075 Ga0070680_1009820751 154
103 3300005336 Ga0070680_101036432 Ga0070680_1010364321 154
104 3300005338 Ga0068868_100188517 Ga0068868_1001885172 154
105 3300005338 Ga0068868_100390635 Ga0068868_1003906351 154
106 3300005338 Ga0068868_102197568 Ga0068868_1021975681 154
107 3300005339 Ga0070660_100082029 Ga0070660_1000820294 154
108 3300005339 Ga0070660_100361684 Ga0070660_1003616842 154
109 3300005339 Ga0070660_101052490 Ga0070660_1010524901 154
110 3300005340 Ga0070689_100453063 Ga0070689_1004530631 154
111 3300005340 Ga0070689_100723052 Ga0070689_1007230521 154
112 3300005341 Ga0070691_10271224 Ga0070691_102712241 154
113 3300005341 Ga0070691_10330129 Ga0070691_103301291 154
114 3300005343 Ga0070687_100008554 Ga0070687_1000085544 154
115 3300005344 Ga0070661_100414795 Ga0070661_1004147951 154
116 3300005345 Ga0070692_10070524 Ga0070692_100705242 154
117 3300005347 Ga0070668_100252156 Ga0070668_1002521563 154
118 3300005353 Ga0070669_100005329 Ga0070669_1000053291 154
119 3300005353 Ga0070669_100042667 Ga0070669_1000426671 154
120 3300005353 Ga0070669_100097062 Ga0070669_1000970623 154
121 3300005353 Ga0070669_100917146 Ga0070669_1009171461 154
122 3300005353 Ga0070669_101147984 Ga0070669_1011479841 154
123 3300005353 Ga0070669_101373106 Ga0070669_1013731061 154
124 3300005354 Ga0070675_100075989 Ga0070675_1000759892 154
125 3300005354 Ga0070675_100245149 Ga0070675_1002451491 154
126 3300005354 Ga0070675_100854273 Ga0070675_1008542732 154
127 3300005356 Ga0070674_100003472 Ga0070674_1000034727 154
128 3300005356 Ga0070674_100021751 Ga0070674_1000217512 154
129 3300005356 Ga0070674_100047443 Ga0070674_1000474432 154
130 3300005356 Ga0070674_100647594 Ga0070674_1006475941 154
131 3300005364 Ga0070673_100241893 Ga0070673_1002418932 154
132 3300005365 Ga0070688_100048853 Ga0070688_1000488532 154
133 3300005365 Ga0070688_100356709 Ga0070688_1003567092 154
134 3300005367 Ga0070667_100329936 Ga0070667_1003299362 154
135 3300005367 Ga0070667_100560199 Ga0070667_1005601992 154
136 3300005406 Ga0070703_10367038 Ga0070703_103670381 154
137 3300005435 Ga0070714_100017981 Ga0070714_1000179813 154
138 3300005436 Ga0070713_100406918 Ga0070713_1004069182 154
139 3300005438 Ga0070701_10015284 Ga0070701_100152842 154
140 3300005438 Ga0070701_10120202 Ga0070701_101202021 154
141 3300005441 Ga0070700_100002184 Ga0070700_1000021843 154
142 3300005441 Ga0070700_100007571 Ga0070700_1000075712 154
143 3300005441 Ga0070700_100040187 Ga0070700_1000401871 154
144 3300005441 Ga0070700_100048842 Ga0070700_1000488422 154
145 3300005444 Ga0070694_100482708 Ga0070694_1004827082 154
146 3300005444 Ga0070694_100822174 Ga0070694_1008221741 154
147 3300005444 Ga0070694_100909293 Ga0070694_1009092931 154
148 3300005444 Ga0070694_101102079 Ga0070694_1011020792 154
149 3300005445 Ga0070708_100303668 Ga0070708_1003036683 154
150 3300005445 Ga0070708_101977453 Ga0070708_1019774531 154
151 3300005455 Ga0070663_100120008 Ga0070663_1001200082 154
152 3300005455 Ga0070663_100129798 Ga0070663_1001297982 154
153 3300005455 Ga0070663_101891555 Ga0070663_1018915551 154
154 3300005458 Ga0070681_10014561 Ga0070681_100145618 154
155 3300005459 Ga0068867_100003165 Ga0068867_1000031657 154
156 3300005459 Ga0068867_100102642 Ga0068867_1001026422 154
157 3300005459 Ga0068867_100210346 Ga0068867_1002103463 154
158 3300005468 Ga0070707_100609032 Ga0070707_1006090322 154
159 3300005468 Ga0070707_100916855 Ga0070707_1009168551 154
160 3300005471 Ga0070698_100129199 Ga0070698_1001291993 154
161 3300005471 Ga0070698_100493055 Ga0070698_1004930552 154
162 3300005471 Ga0070698_100601505 Ga0070698_1006015051 154
163 3300005518 Ga0070699_100002012 Ga0070699_1000020122 154
164 3300005518 Ga0070699_101091497 Ga0070699_1010914971 154
165 3300005530 Ga0070679_100040461 Ga0070679_1000404612 154
166 3300005530 Ga0070679_100049935 Ga0070679_1000499354 154
167 3300005535 Ga0070684_100187598 Ga0070684_1001875982 154
168 3300005536 Ga0070697_100170580 Ga0070697_1001705801 154
169 3300005539 Ga0068853_100196465 Ga0068853_1001964653 154
170 3300005543 Ga0070672_100084274 Ga0070672_1000842741 154
171 3300005544 Ga0070686_100057146 Ga0070686_1000571461 154
172 3300005544 Ga0070686_100130902 Ga0070686_1001309021 154
173 3300005544 Ga0070686_100220726 Ga0070686_1002207262 154
174 3300005544 Ga0070686_100705965 Ga0070686_1007059651 154
175 3300005545 Ga0070695_100002468 Ga0070695_1000024687 154
176 3300005545 Ga0070695_100022402 Ga0070695_1000224022 154
177 3300005545 Ga0070695_100337306 Ga0070695_1003373061 154
178 3300005546 Ga0070696_100016233 Ga0070696_1000162335 154
179 3300005546 Ga0070696_100036951 Ga0070696_1000369512 154
180 3300005546 Ga0070696_100160329 Ga0070696_1001603292 154
181 3300005549 Ga0070704_100009365 Ga0070704_1000093655 154
182 3300005549 Ga0070704_100222089 Ga0070704_1002220892 154
183 3300005549 Ga0070704_100255264 Ga0070704_1002552643 154
184 3300005549 Ga0070704_100287858 Ga0070704_1002878582 154
185 3300005549 Ga0070704_100526392 Ga0070704_1005263922 154
186 3300005563 Ga0068855_100020797 Ga0068855_1000207977 154
187 3300005578 Ga0068854_100022971 Ga0068854_1000229714 154
188 3300005578 Ga0068854_100054657 Ga0068854_1000546573 154
189 3300005614 Ga0068856_101662602 Ga0068856_1016626021 154
190 3300005615 Ga0070702_100148269 Ga0070702_1001482692 154
191 3300005616 Ga0068852_100761296 Ga0068852_1007612961 154
192 3300005617 Ga0068859_100307837 Ga0068859_1003078373 154
193 3300005617 Ga0068859_101774045 Ga0068859_1017740451 154
194 3300005618 Ga0068864_100320508 Ga0068864_1003205082 154
195 3300005618 Ga0068864_100804435 Ga0068864_1008044352 154
196 3300005618 Ga0068864_100892196 Ga0068864_1008921962 154
197 3300005718 Ga0068866_10028362 Ga0068866_100283623 154
198 3300005718 Ga0068866_10039065 Ga0068866_100390652 154
199 3300005719 Ga0068861_100204237 Ga0068861_1002042373 154
200 3300005719 Ga0068861_100743154 Ga0068861_1007431542 154
201 3300005719 Ga0068861_100842988 Ga0068861_1008429881 154
202 3300005719 Ga0068861_101302462 Ga0068861_1013024621 154
203 3300005719 Ga0068861_101750132 Ga0068861_1017501321 154
204 3300005834 Ga0068851_10324873 Ga0068851_103248731 154
205 3300005841 Ga0068863_100616346 Ga0068863_1006163462 154
206 3300005842 Ga0068858_100006376 Ga0068858_10000637611 154
207 3300005842 Ga0068858_100159796 Ga0068858_1001597961 154
208 3300005842 Ga0068858_100392959 Ga0068858_1003929592 154
209 3300005842 Ga0068858_100728342 Ga0068858_1007283421 154
210 3300005842 Ga0068858_101318240 Ga0068858_1013182401 154
211 3300005843 Ga0068860_100137960 Ga0068860_1001379601 154
212 3300005843 Ga0068860_100351429 Ga0068860_1003514291 154
213 3300005843 Ga0068860_100764109 Ga0068860_1007641092 154
214 3300005843 Ga0068860_101751843 Ga0068860_1017518431 154
215 3300005844 Ga0068862_100007706 Ga0068862_1000077065 154
216 3300005844 Ga0068862_100023168 Ga0068862_1000231684 154
217 3300005844 Ga0068862_101281063 Ga0068862_1012810631 154
218 3300005937 Ga0081455_10337282 Ga0081455_103372822 154
219 3300005985 Ga0081539_10006423 Ga0081539_100064233 154
220 3300006173 Ga0070716_100041497 Ga0070716_1000414973 154
221 3300006173 Ga0070716_100093604 Ga0070716_1000936041 154
222 3300006173 Ga0070716_101371777 Ga0070716_1013717772 154
223 3300006175 Ga0070712_100273531 Ga0070712_1002735313 154
224 3300006237 Ga0097621_100003090 Ga0097621_1000030903 154
225 3300006237 Ga0097621_100201459 Ga0097621_1002014592 154
226 3300006237 Ga0097621_100276077 Ga0097621_1002760772 154
227 3300006358 Ga0068871_100001107 Ga0068871_1000011073 154
228 3300006358 Ga0068871_100538957 Ga0068871_1005389571 154
229 3300006844 Ga0075428_100081829 Ga0075428_1000818294 154
230 3300006844 Ga0075428_100117167 Ga0075428_1001171673 154
231 3300006846 Ga0075430_100168996 Ga0075430_1001689963 154
232 3300006847 Ga0075431_100390085 Ga0075431_1003900852 154
233 3300006871 Ga0075434_100042252 Ga0075434_1000422524 154
234 3300006871 Ga0075434_100091844 Ga0075434_1000918442 154
235 3300006871 Ga0075434_100101935 Ga0075434_1001019353 154
236 3300006871 Ga0075434_100485330 Ga0075434_1004853302 154
237 3300006871 Ga0075434_100588711 Ga0075434_1005887113 154
238 3300006880 Ga0075429_101696492 Ga0075429_1016964921 154
239 3300006881 Ga0068865_100022104 Ga0068865_1000221042 154
240 3300006881 Ga0068865_100294951 Ga0068865_1002949512 154
241 3300006881 Ga0068865_100383542 Ga0068865_1003835422 154
242 3300006914 Ga0075436_100014387 Ga0075436_1000143875 154
243 3300006914 Ga0075436_100081102 Ga0075436_1000811023 154
244 3300006914 Ga0075436_100085555 Ga0075436_1000855553 154
245 3300006914 Ga0075436_100261237 Ga0075436_1002612371 154
246 3300006931 Ga0097620_100307833 Ga0097620_1003078333 154
247 3300006931 Ga0097620_101774014 Ga0097620_1017740141 154
248 3300007076 Ga0075435_100007120 Ga0075435_1000071204 154
249 3300007076 Ga0075435_100060351 Ga0075435_1000603513 154
250 3300007076 Ga0075435_100420801 Ga0075435_1004208011 154
251 3300007265 Ga0099794_10064534 Ga0099794_100645341 154
252 3300009093 Ga0105240_10011543 Ga0105240_100115437 154
253 3300009093 Ga0105240_10130144 Ga0105240_101301443 154
254 3300009094 Ga0111539_10004585 Ga0111539_1000458516 154
255 3300009094 Ga0111539_10021248 Ga0111539_100212484 154
256 3300009094 Ga0111539_11236344 Ga0111539_112363442 154
257 3300009094 Ga0111539_11252228 Ga0111539_112522281 154
258 3300009098 Ga0105245_10408947 Ga0105245_104089472 154
259 3300009098 Ga0105245_10513788 Ga0105245_105137881 154
260 3300009098 Ga0105245_11813368 Ga0105245_118133681 154
261 3300009101 Ga0105247_10003746 Ga0105247_100037467 154
262 3300009101 Ga0105247_11147469 Ga0105247_111474691 154
263 3300009147 Ga0114129_10003005 Ga0114129_1000300511 154
264 3300009147 Ga0114129_10009590 Ga0114129_100095908 154
265 3300009147 Ga0114129_10255349 Ga0114129_102553491 154
266 3300009147 Ga0114129_10876055 Ga0114129_108760551 154
267 3300009148 Ga0105243_10005747 Ga0105243_100057479 154
268 3300009148 Ga0105243_10521592 Ga0105243_105215922 154
269 3300009148 Ga0105243_10632245 Ga0105243_106322451 154
270 3300009148 Ga0105243_10768920 Ga0105243_107689201 154
271 3300009174 Ga0105241_10016789 Ga0105241_100167892 154
272 3300009174 Ga0105241_10854544 Ga0105241_108545441 154
273 3300009174 Ga0105241_11263399 Ga0105241_112633991 154
274 3300009176 Ga0105242_10049063 Ga0105242_100490633 154
275 3300009176 Ga0105242_10178766 Ga0105242_101787662 154
276 3300009176 Ga0105242_11163647 Ga0105242_111636472 154
277 3300009176 Ga0105242_12412189 Ga0105242_124121891 154
278 3300009177 Ga0105248_10025874 Ga0105248_100258745 154
279 3300009177 Ga0105248_10051241 Ga0105248_100512414 154
280 3300009177 Ga0105248_10065729 Ga0105248_100657291 154
281 3300009177 Ga0105248_10662131 Ga0105248_106621313 154
282 3300009177 Ga0105248_11562907 Ga0105248_115629071 154
283 3300009545 Ga0105237_11681099 Ga0105237_116810991 154
284 3300009551 Ga0105238_10012691 Ga0105238_100126918 154
285 3300009551 Ga0105238_10724325 Ga0105238_107243252 154
286 3300009553 Ga0105249_10056160 Ga0105249_100561605 154
287 3300009553 Ga0105249_10655349 Ga0105249_106553492 154
288 3300009553 Ga0105249_11615739 Ga0105249_116157391 154
289 3300010375 Ga0105239_11456264 Ga0105239_114562642 154
290 3300011119 Ga0105246_10360153 Ga0105246_103601532 154
291 3300011119 Ga0105246_10424975 Ga0105246_104249752 154
292 3300013105 Ga0157369_11541658 Ga0157369_115416581 154
293 3300013297 Ga0157378_12002953 Ga0157378_120029531 154
294 3300013307 Ga0157372_10190407 Ga0157372_101904072 154
295 3300013308 Ga0157375_10066455 Ga0157375_100664554 154
296 3300013308 Ga0157375_10500098 Ga0157375_105000981 154
297 3300013308 Ga0157375_10740713 Ga0157375_107407131 154
298 3300014325 Ga0163163_10213898 Ga0163163_102138982 154
299 3300014325 Ga0163163_11444192 Ga0163163_114441921 154
300 3300014326 Ga0157380_10086536 Ga0157380_100865362 154
301 3300014326 Ga0157380_10353092 Ga0157380_103530922 154
302 3300014326 Ga0157380_10709760 Ga0157380_107097602 154
303 3300014326 Ga0157380_10777990 Ga0157380_107779901 154
304 3300014745 Ga0157377_10340699 Ga0157377_103406992 154
305 3300014968 Ga0157379_10005722 Ga0157379_100057227 154
306 3300014968 Ga0157379_10500991 Ga0157379_105009912 154
307 3300014968 Ga0157379_10971797 Ga0157379_109717972 154
308 3300014969 Ga0157376_10693536 Ga0157376_106935361 154
309 3300015265 Ga0182005_1245895 Ga0182005_12458951 154
310 3300017792 Ga0163161_10558140 Ga0163161_105581401 154
311 3300025315 Ga0207697_10110133 Ga0207697_101101332 154
312 3300025893 Ga0207682_10586084 Ga0207682_105860841 154
313 3300025899 Ga0207642_10015048 Ga0207642_100150482 154
314 3300025899 Ga0207642_10084503 Ga0207642_100845033 154
315 3300025900 Ga0207710_10005377 Ga0207710_100053772 154
316 3300025901 Ga0207688_10197285 Ga0207688_101972852 154
317 3300025901 Ga0207688_10331306 Ga0207688_103313061 154
318 3300025901 Ga0207688_10922933 Ga0207688_109229331 154
319 3300025903 Ga0207680_10136487 Ga0207680_101364872 154
320 3300025903 Ga0207680_10200845 Ga0207680_102008452 154
321 3300025907 Ga0207645_10011628 Ga0207645_100116284 154
322 3300025907 Ga0207645_10270858 Ga0207645_102708581 154
323 3300025908 Ga0207643_10062430 Ga0207643_100624302 154
324 3300025908 Ga0207643_10974830 Ga0207643_109748301 154
325 3300025909 Ga0207705_10116108 Ga0207705_101161083 154
326 3300025910 Ga0207684_10231337 Ga0207684_102313371 154
327 3300025910 Ga0207684_10355065 Ga0207684_103550652 154
328 3300025910 Ga0207684_10518406 Ga0207684_105184061 154
329 3300025911 Ga0207654_10018539 Ga0207654_100185392 154
330 3300025911 Ga0207654_10427680 Ga0207654_104276801 154
331 3300025911 Ga0207654_10811664 Ga0207654_108116641 154
332 3300025912 Ga0207707_10069371 Ga0207707_100693712 154
333 3300025913 Ga0207695_10035464 Ga0207695_100354643 154
334 3300025913 Ga0207695_10073089 Ga0207695_100730893 154
335 3300025913 Ga0207695_10385596 Ga0207695_103855962 154
336 3300025915 Ga0207693_10199072 Ga0207693_101990722 154
337 3300025917 Ga0207660_10045755 Ga0207660_100457553 154
338 3300025918 Ga0207662_10085309 Ga0207662_100853092 154
339 3300025918 Ga0207662_10576440 Ga0207662_105764402 154
340 3300025919 Ga0207657_10000448 Ga0207657_100004484 154
341 3300025919 Ga0207657_10622168 Ga0207657_106221681 154
342 3300025920 Ga0207649_10818863 Ga0207649_108188631 154
343 3300025921 Ga0207652_10074593 Ga0207652_100745931 154
344 3300025921 Ga0207652_10147531 Ga0207652_101475311 154
345 3300025922 Ga0207646_10402679 Ga0207646_104026791 154
346 3300025923 Ga0207681_10014493 Ga0207681_100144935 154
347 3300025923 Ga0207681_10022470 Ga0207681_100224704 154
348 3300025923 Ga0207681_10055231 Ga0207681_100552312 154
349 3300025923 Ga0207681_10267567 Ga0207681_102675672 154
350 3300025923 Ga0207681_10526870 Ga0207681_105268701 154
351 3300025923 Ga0207681_10883352 Ga0207681_108833521 154
352 3300025923 Ga0207681_11226757 Ga0207681_112267571 154
353 3300025924 Ga0207694_10075167 Ga0207694_100751673 154
354 3300025924 Ga0207694_11103807 Ga0207694_111038071 154
355 3300025926 Ga0207659_10107886 Ga0207659_101078862 154
356 3300025927 Ga0207687_10180945 Ga0207687_101809452 154
357 3300025927 Ga0207687_10727635 Ga0207687_107276351 154
358 3300025931 Ga0207644_10890390 Ga0207644_108903901 154
359 3300025933 Ga0207706_10078833 Ga0207706_100788333 154
360 3300025934 Ga0207686_10008837 Ga0207686_100088372 154
361 3300025935 Ga0207709_10108784 Ga0207709_101087842 154
362 3300025935 Ga0207709_10148014 Ga0207709_101480142 154
363 3300025935 Ga0207709_10736745 Ga0207709_107367451 154
364 3300025936 Ga0207670_10270448 Ga0207670_102704482 154
365 3300025937 Ga0207669_10063861 Ga0207669_100638613 154
366 3300025937 Ga0207669_10075630 Ga0207669_100756303 154
367 3300025937 Ga0207669_10163537 Ga0207669_101635372 154
368 3300025938 Ga0207704_10001915 Ga0207704_1000191512 154
369 3300025938 Ga0207704_10052554 Ga0207704_100525543 154
370 3300025939 Ga0207665_10059331 Ga0207665_100593313 154
371 3300025939 Ga0207665_10123932 Ga0207665_101239323 154
372 3300025940 Ga0207691_10058452 Ga0207691_100584522 154
373 3300025940 Ga0207691_10920530 Ga0207691_109205301 154
374 3300025941 Ga0207711_10026694 Ga0207711_100266942 154
375 3300025941 Ga0207711_10212815 Ga0207711_102128152 154
376 3300025941 Ga0207711_10248831 Ga0207711_102488311 154
377 3300025941 Ga0207711_11329138 Ga0207711_113291381 154
378 3300025942 Ga0207689_10032193 Ga0207689_100321933 154
379 3300025944 Ga0207661_10098762 Ga0207661_100987623 154
380 3300025949 Ga0207667_10131023 Ga0207667_101310232 154
381 3300025949 Ga0207667_10519938 Ga0207667_105199381 154
382 3300025949 Ga0207667_11983907 Ga0207667_119839071 154
383 3300025960 Ga0207651_10196938 Ga0207651_101969381 154
384 3300025960 Ga0207651_10359114 Ga0207651_103591141 154
385 3300025961 Ga0207712_10727976 Ga0207712_107279762 154
386 3300025961 Ga0207712_11863022 Ga0207712_118630221 154
387 3300025972 Ga0207668_10123390 Ga0207668_101233903 154
388 3300025972 Ga0207668_10177611 Ga0207668_101776112 154
389 3300025981 Ga0207640_10009623 Ga0207640_100096232 154
390 3300025981 Ga0207640_10485473 Ga0207640_104854732 154
391 3300025981 Ga0207640_10536156 Ga0207640_105361562 154
392 3300025986 Ga0207658_10554222 Ga0207658_105542222 154
393 3300025986 Ga0207658_10824651 Ga0207658_108246511 154
394 3300026035 Ga0207703_10157010 Ga0207703_101570102 154
395 3300026035 Ga0207703_10419059 Ga0207703_104190591 154
396 3300026035 Ga0207703_10788649 Ga0207703_107886492 154
397 3300026035 Ga0207703_10813619 Ga0207703_108136191 154
398 3300026041 Ga0207639_10161244 Ga0207639_101612441 154
399 3300026067 Ga0207678_10073614 Ga0207678_100736142 154
400 3300026067 Ga0207678_10089975 Ga0207678_100899752 154
401 3300026075 Ga0207708_10004076 Ga0207708_100040762 154
402 3300026075 Ga0207708_10066324 Ga0207708_100663241 154
403 3300026075 Ga0207708_10705813 Ga0207708_107058132 154
404 3300026088 Ga0207641_10546006 Ga0207641_105460062 154
405 3300026089 Ga0207648_10000802 Ga0207648_1000080215 154
406 3300026089 Ga0207648_10017964 Ga0207648_100179643 154
407 3300026089 Ga0207648_10307167 Ga0207648_103071671 154
408 3300026089 Ga0207648_10351353 Ga0207648_103513532 154
409 3300026089 Ga0207648_10503879 Ga0207648_105038792 154
410 3300026095 Ga0207676_10172785 Ga0207676_101727852 154
411 3300026095 Ga0207676_10782536 Ga0207676_107825362 154
412 3300026116 Ga0207674_12099102 Ga0207674_120991021 154
413 3300026118 Ga0207675_100003438 Ga0207675_1000034386 154
414 3300026118 Ga0207675_100008037 Ga0207675_1000080373 154
415 3300026118 Ga0207675_100026637 Ga0207675_1000266372 154
416 3300026118 Ga0207675_100082000 Ga0207675_1000820003 154
417 3300026118 Ga0207675_100295147 Ga0207675_1002951473 154
418 3300026118 Ga0207675_100297167 Ga0207675_1002971672 154
419 3300027907 Ga0207428_10008383 Ga0207428_100083837 154
420 3300027907 Ga0207428_10058793 Ga0207428_100587934 154
421 3300027907 Ga0207428_10942401 Ga0207428_109424011 154
422 3300028379 Ga0268266_10797775 Ga0268266_107977752 154
423 3300028380 Ga0268265_10004006 Ga0268265_100040066 154
424 3300028380 Ga0268265_10030648 Ga0268265_100306483 154
425 3300028380 Ga0268265_10154862 Ga0268265_101548622 154
426 3300028380 Ga0268265_10195042 Ga0268265_101950422 154
427 3300028380 Ga0268265_10352745 Ga0268265_103527451 154
428 3300028381 Ga0268264_10128495 Ga0268264_101284953 154
429 3300028381 Ga0268264_10142874 Ga0268264_101428742 154
430 3300028381 Ga0268264_10168656 Ga0268264_101686562 154
431 3300028381 Ga0268264_11202200 Ga0268264_112022001 154
432 3300028381 Ga0268264_11987719 Ga0268264_119877191 154
433 3300028381 Ga0268264_12128022 Ga0268264_121280221 154
434 3300031344 Ga0265316_10282318 Ga0265316_102823181 154
435 3300031548 Ga0307408_100460014 Ga0307408_1004600142 154
436 3300031548 Ga0307408_100634881 Ga0307408_1006348811 154
437 3300031711 Ga0265314_10120161 Ga0265314_101201612 154
438 3300031731 Ga0307405_10551294 Ga0307405_105512941 154
439 3300031824 Ga0307413_11005855 Ga0307413_110058551 154
440 3300031852 Ga0307410_10907490 Ga0307410_109074901 154
441 3300031903 Ga0307407_10253003 Ga0307407_102530031 154
442 3300031903 Ga0307407_10266700 Ga0307407_102667001 154
443 3300031911 Ga0307412_11397689 Ga0307412_113976892 154
444 3300032002 Ga0307416_101080945 Ga0307416_1010809452 154
445 3300032005 Ga0307411_10015044 Ga0307411_100150444 154
446 3300032005 Ga0307411_11917682 Ga0307411_119176821 154
447 3300034817 Ga0373948_0006326 Ga0373948_0006326_397_867 154
448 3300034957 Ga0373938_0152264 Ga0373938_0152264_19_489 154
449 3300035084 Ga0373928_0007511 Ga0373928_0007511_1604_2074 154
450 3300035088 Ga0373940_0271815 Ga0373940_0271815_46_516 154
451 3300035089 Ga0373944_0149309 Ga0373944_0149309_10_474 154
452 3300035090 Ga0373949_0002163 Ga0373949_0002163_1105_1575 154
453 3300035091 Ga0373951_0007755 Ga0373951_0007755_1122_1592 154
454 3300035092 Ga0373952_0003771 Ga0373952_0003771_67_537 154
455 3300035112 Ga0373932_0006339 Ga0373932_0006339_2204_2674 154
456 3300035112 Ga0373932_0167821 Ga0373932_0167821_263_727 154
457 3300035114 Ga0373939_0015830 Ga0373939_0015830_769_1239 154
458 3300035115 Ga0373941_0000343 Ga0373941_0000343_7821_8291 154
459 3300035121 Ga0373960_0001256 Ga0373960_0001256_4178_4648 154
460 3300035171 Ga0373946_0069755 Ga0373946_0069755_346_813 154
461 3300035241 Ga0373961_0062944 Ga0373961_0062944_558_1028 154
462 3300035242 Ga0373962_0001870 Ga0373962_0001870_50_520 154
463 3300035691 Ga0373931_0001339 Ga0373931_0001339_2517_2987 154
464 3300035691 Ga0373931_0082457 Ga0373931_0082457_866_1345 154
465 3300035691 Ga0373931_0120135 Ga0373931_0120135_894_1361 154
466 3300036401 Ga0373937_0159180 Ga0373937_0159180_633_1100 154
467 3300037068 Ga0373925_0241361 Ga0373925_0241361_887_1354 154
468 3300041459 Ga0451800_1621613 Ga0451800_1621613_60_530 154
469 3300045051 Ga0451576_0010882 Ga0451576_0010882_7828_8298 154
470 3300045051 Ga0451576_0679933 Ga0451576_0679933_125_592 154
471 3300046454 Ga0495592_0322612 Ga0495592_0322612_69_536 154
472 3300046472 Ga0495580_0073772 Ga0495580_0073772_336_800 154
473 3300046477 Ga0495664_0695675 Ga0495664_0695675_20_487 154
474 3300046506 Ga0495583_0160906 Ga0495583_0160906_214_678 154
475 3300046517 Ga0495630_0117208 Ga0495630_0117208_944_1411 154
476 3300046517 Ga0495630_0177025 Ga0495630_0177025_740_1207 154
477 3300046525 Ga0495663_0265200 Ga0495663_0265200_14_484 154
478 3300046526 Ga0495666_0322956 Ga0495666_0322956_10_477 154
479 3300046535 Ga0495586_0569150 Ga0495586_0569150_177_641 154
480 3300046539 Ga0495621_0097697 Ga0495621_0097697_478_945 154
481 3300046642 Ga0495634_0423410 Ga0495634_0423410_244_711 154
482 3300046663 Ga0495635_0197813 Ga0495635_0197813_839_1306 154
483 3300046681 Ga0495647_0115562 Ga0495647_0115562_423_893 154
484 3300046681 Ga0495647_0299780 Ga0495647_0299780_181_648 154
485 3300046683 Ga0495658_0058218 Ga0495658_0058218_131_598 154
486 3300047319 Ga0495674_0106880 Ga0495674_0106880_154_621 154
487 3300047322 Ga0495680_0943251 Ga0495680_0943251_69_536 154
488 3300047471 Ga0495684_0160441 Ga0495684_0160441_1109_1576 154
489 3300048088 Ga0495602_0600681 Ga0495602_0600681_100_567 154
490 3300048905 Ga0496102_0067969 Ga0496102_0067969_316_780 154
491 3300048905 Ga0496102_0091619 Ga0496102_0091619_1900_2367 154
492 3300048905 Ga0496102_1415078 Ga0496102_1415078_44_514 154
493 3300048906 Ga0496103_0316398 Ga0496103_0316398_372_836 154
494 3300048906 Ga0496103_0750067 Ga0496103_0750067_85_555 154
495 3300048907 Ga0496104_1590651 Ga0496104_1590651_57_521 154
496 3300048909 Ga0496106_0776202 Ga0496106_0776202_110_580 154
497 3300048909 Ga0496106_1183616 Ga0496106_1183616_113_577 154
498 3300048912 Ga0496109_1098377 Ga0496109_1098377_13_477 154
499 3300048916 Ga0496113_0354640 Ga0496113_0354640_342_806 154
500 3300049583 Ga0501067_0625052 Ga0501067_0625052_124_594 154
501 3300049591 Ga0501075_0077467 Ga0501075_0077467_1194_1658 154
502 3300050507 nmdc:mga05p37_11228_c1 nmdc:mga05p37_11228_c1_4875_5342 154
503 3300050507 nmdc:mga05p37_156059_c1 nmdc:mga05p37_156059_c1_1234_1698 154
504 3300050507 nmdc:mga05p37_32801_c1 nmdc:mga05p37_32801_c1_871_1341 154
505 3300050507 nmdc:mga05p37_386041_c1 nmdc:mga05p37_386041_c1_550_1017 154
506 3300050507 nmdc:mga05p37_47284_c1 nmdc:mga05p37_47284_c1_574_1044 154
507 3300050508 nmdc:mga09592_76446_c1 nmdc:mga09592_76446_c1_42_515 154
508 3300050510 nmdc:mga06r32_337151_c1 nmdc:mga06r32_337151_c1_649_1119 154
509 3300050511 nmdc:mga08y16_168554_c1 nmdc:mga08y16_168554_c1_1419_1892 154
510 3300050511 nmdc:mga08y16_19092_c1 nmdc:mga08y16_19092_c1_6672_7142 154
511 3300050511 nmdc:mga08y16_683_c1 nmdc:mga08y16_683_c1_19710_20177 154
512 3300050511 nmdc:mga08y16_800102_c1 nmdc:mga08y16_800102_c1_408_881 154
513 3300050512 nmdc:mga0n895_357886_c1 nmdc:mga0n895_357886_c1_214_684 154
514 3300050512 nmdc:mga0n895_42983_c1 nmdc:mga0n895_42983_c1_2468_2938 154
515 3300050512 nmdc:mga0n895_454300_c1 nmdc:mga0n895_454300_c1_729_1199 154
516 3300050512 nmdc:mga0n895_632267_c1 nmdc:mga0n895_632267_c1_132_602 154
517 3300050512 nmdc:mga0n895_71935_c1 nmdc:mga0n895_71935_c1_2576_3046 154
518 3300050513 nmdc:mga0rr50_10783_c1 nmdc:mga0rr50_10783_c1_10_480 154
519 3300050513 nmdc:mga0rr50_1258634_c1 nmdc:mga0rr50_1258634_c1_64_531 154
520 3300050513 nmdc:mga0rr50_321957_c1 nmdc:mga0rr50_321957_c1_531_995 154
521 3300050513 nmdc:mga0rr50_373910_c1 nmdc:mga0rr50_373910_c1_646_1113 154
522 3300050513 nmdc:mga0rr50_49091_c1 nmdc:mga0rr50_49091_c1_1478_1948 154
523 3300050513 nmdc:mga0rr50_690846_c1 nmdc:mga0rr50_690846_c1_187_657 154
524 3300050514 nmdc:mga08x19_150702_c1 nmdc:mga08x19_150702_c1_724_1191 154
525 3300050514 nmdc:mga08x19_245572_c1 nmdc:mga08x19_245572_c1_87_557 154
526 3300050514 nmdc:mga08x19_422416_c1 nmdc:mga08x19_422416_c1_218_682 154
527 3300050514 nmdc:mga08x19_8172_c1 nmdc:mga08x19_8172_c1_1131_1601 154
528 3300050514 nmdc:mga08x19_88202_c1 nmdc:mga08x19_88202_c1_48_518 154
529 3300050515 nmdc:mga0a205_1005171_c1 nmdc:mga0a205_1005171_c1_114_587 154
530 3300050515 nmdc:mga0a205_154044_c1 nmdc:mga0a205_154044_c1_1720_2184 154
531 3300050515 nmdc:mga0a205_818286_c1 nmdc:mga0a205_818286_c1_85_555 154
532 3300053077 Ga0495601_0498053 Ga0495601_0498053_252_719 154
533 3300053085 Ga0495619_0008562 Ga0495619_0008562_2826_3293 154
534 3300059424 Ga0590075_045219 Ga0590075_045219_147_626 154
535 3300059426 Ga0590077_091703 Ga0590077_091703_73_552 154
536 3300000044 ARSoilOldRDRAFT_c005815 ARSoilOldRDRAFT_0058151 155
537 3300001977 JGI24746J21847_1000635 JGI24746J21847_10006352 155
538 3300003320 rootH2_10206308 rootH2_102063082 155
539 3300004798 Ga0058859_11634508 Ga0058859_116345081 155
540 3300004801 Ga0058860_12130943 Ga0058860_121309431 155
541 3300005288 Ga0065714_10021748 Ga0065714_100217482 155
542 3300005289 Ga0065704_10014277 Ga0065704_100142772 155
543 3300005290 Ga0065712_10000373 Ga0065712_1000037310 155
544 3300005290 Ga0065712_10008353 Ga0065712_100083533 155
545 3300005290 Ga0065712_10080010 Ga0065712_100800103 155
546 3300005290 Ga0065712_10086798 Ga0065712_100867982 155
547 3300005290 Ga0065712_10119676 Ga0065712_101196762 155
548 3300005290 Ga0065712_10369363 Ga0065712_103693632 155
549 3300005293 Ga0065715_10089661 Ga0065715_100896617 155
550 3300005293 Ga0065715_10094316 Ga0065715_100943163 155
551 3300005293 Ga0065715_10137491 Ga0065715_101374912 155
552 3300005293 Ga0065715_10283272 Ga0065715_102832721 155
553 3300005295 Ga0065707_10107323 Ga0065707_101073231 155
554 3300005295 Ga0065707_10107853 Ga0065707_101078531 155
555 3300005295 Ga0065707_10195881 Ga0065707_101958812 155
556 3300005295 Ga0065707_10342578 Ga0065707_103425781 155
557 3300005295 Ga0065707_10847730 Ga0065707_108477301 155
558 3300005328 Ga0070676_10115721 Ga0070676_101157211 155
559 3300005328 Ga0070676_10169845 Ga0070676_101698451 155
560 3300005328 Ga0070676_11239471 Ga0070676_112394711 155
561 3300005330 Ga0070690_100047569 Ga0070690_1000475692 155
562 3300005330 Ga0070690_100071050 Ga0070690_1000710502 155
563 3300005330 Ga0070690_100194594 Ga0070690_1001945942 155
564 3300005330 Ga0070690_100803169 Ga0070690_1008031691 155
565 3300005331 Ga0070670_100068895 Ga0070670_1000688952 155
566 3300005331 Ga0070670_100073656 Ga0070670_1000736562 155
567 3300005331 Ga0070670_100190877 Ga0070670_1001908772 155
568 3300005331 Ga0070670_100387010 Ga0070670_1003870102 155
569 3300005333 Ga0070677_10004638 Ga0070677_100046383 155
570 3300005333 Ga0070677_10071396 Ga0070677_100713962 155
571 3300005333 Ga0070677_10105968 Ga0070677_101059681 155
572 3300005333 Ga0070677_10213751 Ga0070677_102137512 155
573 3300005334 Ga0068869_100008204 Ga0068869_1000082044 155
574 3300005334 Ga0068869_100358631 Ga0068869_1003586312 155
575 3300005335 Ga0070666_10332421 Ga0070666_103324211 155
576 3300005335 Ga0070666_10575274 Ga0070666_105752741 155
577 3300005336 Ga0070680_100906617 Ga0070680_1009066171 155
578 3300005336 Ga0070680_101818216 Ga0070680_1018182161 155
579 3300005338 Ga0068868_100630411 Ga0068868_1006304111 155
580 3300005338 Ga0068868_101039303 Ga0068868_1010393031 155
581 3300005339 Ga0070660_100154283 Ga0070660_1001542832 155
582 3300005340 Ga0070689_100092599 Ga0070689_1000925992 155
583 3300005340 Ga0070689_100211104 Ga0070689_1002111042 155
584 3300005340 Ga0070689_100357903 Ga0070689_1003579032 155
585 3300005340 Ga0070689_100368543 Ga0070689_1003685432 155
586 3300005343 Ga0070687_100003556 Ga0070687_1000035564 155
587 3300005344 Ga0070661_100027569 Ga0070661_1000275694 155
588 3300005344 Ga0070661_100276763 Ga0070661_1002767632 155
589 3300005344 Ga0070661_101115107 Ga0070661_1011151071 155
590 3300005347 Ga0070668_100100000 Ga0070668_1001000002 155
591 3300005347 Ga0070668_100148140 Ga0070668_1001481402 155
592 3300005347 Ga0070668_100177775 Ga0070668_1001777752 155
593 3300005347 Ga0070668_101486300 Ga0070668_1014863001 155
594 3300005347 Ga0070668_102072717 Ga0070668_1020727171 155
595 3300005353 Ga0070669_100004321 Ga0070669_1000043213 155
596 3300005353 Ga0070669_100146488 Ga0070669_1001464882 155
597 3300005353 Ga0070669_100192345 Ga0070669_1001923452 155
598 3300005353 Ga0070669_100202752 Ga0070669_1002027522 155
599 3300005353 Ga0070669_100304132 Ga0070669_1003041321 155
600 3300005353 Ga0070669_100897182 Ga0070669_1008971821 155
601 3300005354 Ga0070675_100011134 Ga0070675_1000111344 155
602 3300005354 Ga0070675_100015561 Ga0070675_1000155613 155
603 3300005354 Ga0070675_100104614 Ga0070675_1001046142 155
604 3300005354 Ga0070675_100141512 Ga0070675_1001415122 155
605 3300005354 Ga0070675_100259780 Ga0070675_1002597802 155
606 3300005354 Ga0070675_100999716 Ga0070675_1009997162 155
607 3300005355 Ga0070671_100242860 Ga0070671_1002428602 155
608 3300005356 Ga0070674_100001261 Ga0070674_10000126111 155
609 3300005356 Ga0070674_100110747 Ga0070674_1001107471 155
610 3300005356 Ga0070674_100843913 Ga0070674_1008439131 155
611 3300005356 Ga0070674_101630815 Ga0070674_1016308151 155
612 3300005356 Ga0070674_101822367 Ga0070674_1018223671 155
613 3300005364 Ga0070673_100006876 Ga0070673_1000068763 155
614 3300005364 Ga0070673_100179758 Ga0070673_1001797582 155
615 3300005364 Ga0070673_100348781 Ga0070673_1003487811 155
616 3300005364 Ga0070673_100373137 Ga0070673_1003731372 155
617 3300005364 Ga0070673_100425224 Ga0070673_1004252242 155
618 3300005364 Ga0070673_100863626 Ga0070673_1008636261 155
619 3300005365 Ga0070688_100069819 Ga0070688_1000698192 155
620 3300005365 Ga0070688_100071597 Ga0070688_1000715972 155
621 3300005365 Ga0070688_100073223 Ga0070688_1000732232 155
622 3300005365 Ga0070688_100108645 Ga0070688_1001086452 155
623 3300005365 Ga0070688_100162799 Ga0070688_1001627992 155
624 3300005365 Ga0070688_100325846 Ga0070688_1003258461 155
625 3300005365 Ga0070688_100353396 Ga0070688_1003533962 155
626 3300005365 Ga0070688_100796916 Ga0070688_1007969161 155
627 3300005366 Ga0070659_100355655 Ga0070659_1003556552 155
628 3300005367 Ga0070667_100028388 Ga0070667_1000283884 155
629 3300005367 Ga0070667_100091938 Ga0070667_1000919382 155
630 3300005367 Ga0070667_100430202 Ga0070667_1004302021 155
631 3300005438 Ga0070701_10006936 Ga0070701_100069365 155
632 3300005438 Ga0070701_10040039 Ga0070701_100400392 155
633 3300005438 Ga0070701_10045069 Ga0070701_100450692 155
634 3300005438 Ga0070701_10345288 Ga0070701_103452882 155
635 3300005440 Ga0070705_100057678 Ga0070705_1000576782 155
636 3300005440 Ga0070705_100653574 Ga0070705_1006535742 155
637 3300005441 Ga0070700_100015844 Ga0070700_1000158442 155
638 3300005441 Ga0070700_100047841 Ga0070700_1000478412 155
639 3300005441 Ga0070700_100060756 Ga0070700_1000607562 155
640 3300005441 Ga0070700_100106558 Ga0070700_1001065582 155
641 3300005441 Ga0070700_100519330 Ga0070700_1005193301 155
642 3300005441 Ga0070700_100827293 Ga0070700_1008272931 155
643 3300005444 Ga0070694_100373610 Ga0070694_1003736102 155
644 3300005445 Ga0070708_100211381 Ga0070708_1002113812 155
645 3300005455 Ga0070663_100680321 Ga0070663_1006803212 155
646 3300005456 Ga0070678_100028346 Ga0070678_1000283463 155
647 3300005456 Ga0070678_100561889 Ga0070678_1005618891 155
648 3300005456 Ga0070678_102356987 Ga0070678_1023569871 155
649 3300005457 Ga0070662_100028176 Ga0070662_1000281762 155
650 3300005457 Ga0070662_100148813 Ga0070662_1001488131 155
651 3300005457 Ga0070662_100180495 Ga0070662_1001804951 155
652 3300005457 Ga0070662_100268608 Ga0070662_1002686081 155
653 3300005459 Ga0068867_100082617 Ga0068867_1000826172 155
654 3300005459 Ga0068867_100410134 Ga0068867_1004101342 155
655 3300005459 Ga0068867_100650980 Ga0068867_1006509801 155
656 3300005459 Ga0068867_100867712 Ga0068867_1008677122 155
657 3300005459 Ga0068867_101540035 Ga0068867_1015400351 155
658 3300005466 Ga0070685_10068966 Ga0070685_100689662 155
659 3300005466 Ga0070685_10085415 Ga0070685_100854151 155
660 3300005466 Ga0070685_10221116 Ga0070685_102211162 155
661 3300005466 Ga0070685_10363763 Ga0070685_103637632 155
662 3300005466 Ga0070685_10815907 Ga0070685_108159071 155
663 3300005466 Ga0070685_10842732 Ga0070685_108427321 155
664 3300005468 Ga0070707_100035611 Ga0070707_1000356113 155
665 3300005518 Ga0070699_100705653 Ga0070699_1007056531 155
666 3300005530 Ga0070679_101868748 Ga0070679_1018687481 155
667 3300005536 Ga0070697_100327541 Ga0070697_1003275411 155
668 3300005543 Ga0070672_100043187 Ga0070672_1000431872 155
669 3300005543 Ga0070672_100063994 Ga0070672_1000639942 155
670 3300005543 Ga0070672_100199170 Ga0070672_1001991702 155
671 3300005543 Ga0070672_100784755 Ga0070672_1007847552 155
672 3300005543 Ga0070672_100790618 Ga0070672_1007906181 155
673 3300005544 Ga0070686_100031463 Ga0070686_1000314632 155
674 3300005544 Ga0070686_100085056 Ga0070686_1000850562 155
675 3300005545 Ga0070695_100016243 Ga0070695_1000162434 155
676 3300005545 Ga0070695_100961961 Ga0070695_1009619611 155
677 3300005548 Ga0070665_100322689 Ga0070665_1003226892 155
678 3300005549 Ga0070704_100119305 Ga0070704_1001193052 155
679 3300005549 Ga0070704_100654531 Ga0070704_1006545312 155
680 3300005549 Ga0070704_101049520 Ga0070704_1010495202 155
681 3300005564 Ga0070664_100024009 Ga0070664_1000240094 155
682 3300005564 Ga0070664_100118928 Ga0070664_1001189282 155
683 3300005564 Ga0070664_100134973 Ga0070664_1001349731 155
684 3300005564 Ga0070664_100269325 Ga0070664_1002693252 155
685 3300005577 Ga0068857_100102707 Ga0068857_1001027072 155
686 3300005577 Ga0068857_100120998 Ga0068857_1001209982 155
687 3300005577 Ga0068857_100510647 Ga0068857_1005106472 155
688 3300005577 Ga0068857_100558327 Ga0068857_1005583272 155
689 3300005577 Ga0068857_100978243 Ga0068857_1009782431 155
690 3300005615 Ga0070702_100431735 Ga0070702_1004317351 155
691 3300005615 Ga0070702_100434359 Ga0070702_1004343591 155
692 3300005616 Ga0068852_100166490 Ga0068852_1001664902 155
693 3300005617 Ga0068859_100002669 Ga0068859_1000026698 155
694 3300005617 Ga0068859_100128259 Ga0068859_1001282591 155
695 3300005617 Ga0068859_100160182 Ga0068859_1001601822 155
696 3300005617 Ga0068859_100420487 Ga0068859_1004204871 155
697 3300005617 Ga0068859_100982350 Ga0068859_1009823502 155
698 3300005618 Ga0068864_100040716 Ga0068864_1000407163 155
699 3300005618 Ga0068864_100167280 Ga0068864_1001672802 155
700 3300005718 Ga0068866_10160996 Ga0068866_101609962 155
701 3300005718 Ga0068866_10731106 Ga0068866_107311062 155
702 3300005719 Ga0068861_100023735 Ga0068861_1000237353 155
703 3300005719 Ga0068861_100038017 Ga0068861_1000380171 155
704 3300005719 Ga0068861_100410940 Ga0068861_1004109402 155
705 3300005719 Ga0068861_101831395 Ga0068861_1018313951 155
706 3300005840 Ga0068870_10397874 Ga0068870_103978742 155
707 3300005841 Ga0068863_100040460 Ga0068863_1000404602 155
708 3300005841 Ga0068863_100227413 Ga0068863_1002274132 155
709 3300005841 Ga0068863_100343678 Ga0068863_1003436782 155
710 3300005842 Ga0068858_100097573 Ga0068858_1000975732 155
711 3300005842 Ga0068858_100482562 Ga0068858_1004825622 155
712 3300005843 Ga0068860_100440932 Ga0068860_1004409322 155
713 3300005843 Ga0068860_101159720 Ga0068860_1011597202 155
714 3300005843 Ga0068860_101219834 Ga0068860_1012198341 155
715 3300005844 Ga0068862_100050972 Ga0068862_1000509724 155
716 3300005844 Ga0068862_100135111 Ga0068862_1001351112 155
717 3300005844 Ga0068862_100167788 Ga0068862_1001677882 155
718 3300005844 Ga0068862_100415906 Ga0068862_1004159062 155
719 3300005844 Ga0068862_100963408 Ga0068862_1009634082 155
720 3300005844 Ga0068862_101190193 Ga0068862_1011901931 155
721 3300005985 Ga0081539_10059806 Ga0081539_100598062 155
722 3300005985 Ga0081539_10100662 Ga0081539_101006622 155
723 3300006175 Ga0070712_100096486 Ga0070712_1000964862 155
724 3300006237 Ga0097621_100020345 Ga0097621_1000203453 155
725 3300006237 Ga0097621_101280509 Ga0097621_1012805091 155
726 3300006358 Ga0068871_100089251 Ga0068871_1000892512 155
727 3300006358 Ga0068871_100242880 Ga0068871_1002428802 155
728 3300006358 Ga0068871_100291792 Ga0068871_1002917922 155
729 3300006358 Ga0068871_100400444 Ga0068871_1004004442 155
730 3300006844 Ga0075428_100003764 Ga0075428_1000037645 155
731 3300006844 Ga0075428_100008503 Ga0075428_1000085037 155
732 3300006844 Ga0075428_100029789 Ga0075428_1000297894 155
733 3300006844 Ga0075428_100070369 Ga0075428_1000703693 155
734 3300006844 Ga0075428_100698484 Ga0075428_1006984842 155
735 3300006844 Ga0075428_100926372 Ga0075428_1009263722 155
736 3300006844 Ga0075428_101725272 Ga0075428_1017252721 155
737 3300006846 Ga0075430_100002827 Ga0075430_10000282710 155
738 3300006846 Ga0075430_100009055 Ga0075430_1000090551 155
739 3300006846 Ga0075430_100025724 Ga0075430_1000257242 155
740 3300006846 Ga0075430_100423544 Ga0075430_1004235442 155
741 3300006846 Ga0075430_100535947 Ga0075430_1005359472 155
742 3300006846 Ga0075430_101643218 Ga0075430_1016432181 155
743 3300006847 Ga0075431_100002521 Ga0075431_1000025218 155
744 3300006847 Ga0075431_100043740 Ga0075431_1000437402 155
745 3300006847 Ga0075431_100203614 Ga0075431_1002036142 155
746 3300006847 Ga0075431_100399090 Ga0075431_1003990902 155
747 3300006847 Ga0075431_101340746 Ga0075431_1013407461 155
748 3300006852 Ga0075433_10000719 Ga0075433_1000071913 155
749 3300006852 Ga0075433_10003035 Ga0075433_100030357 155
750 3300006852 Ga0075433_10046914 Ga0075433_100469142 155
751 3300006852 Ga0075433_11372447 Ga0075433_113724471 155
752 3300006871 Ga0075434_100009384 Ga0075434_1000093843 155
753 3300006871 Ga0075434_100014191 Ga0075434_1000141913 155
754 3300006871 Ga0075434_100019206 Ga0075434_1000192065 155
755 3300006871 Ga0075434_101053817 Ga0075434_1010538172 155
756 3300006880 Ga0075429_100003842 Ga0075429_10000384210 155
757 3300006880 Ga0075429_100005497 Ga0075429_1000054979 155
758 3300006880 Ga0075429_100184095 Ga0075429_1001840952 155
759 3300006880 Ga0075429_100493860 Ga0075429_1004938602 155
760 3300006880 Ga0075429_100680130 Ga0075429_1006801301 155
761 3300006881 Ga0068865_100033189 Ga0068865_1000331891 155
762 3300006931 Ga0097620_100002669 Ga0097620_1000026698 155
763 3300006931 Ga0097620_100128263 Ga0097620_1001282631 155
764 3300006931 Ga0097620_100160182 Ga0097620_1001601822 155
765 3300006931 Ga0097620_100420494 Ga0097620_1004204942 155
766 3300006931 Ga0097620_100982294 Ga0097620_1009822942 155
767 3300007076 Ga0075435_100024515 Ga0075435_1000245155 155
768 3300007076 Ga0075435_100025018 Ga0075435_1000250184 155
769 3300009094 Ga0111539_10001096 Ga0111539_1000109613 155
770 3300009094 Ga0111539_10001535 Ga0111539_1000153517 155
771 3300009094 Ga0111539_10002877 Ga0111539_1000287711 155
772 3300009094 Ga0111539_10007218 Ga0111539_1000721816 155
773 3300009094 Ga0111539_10021062 Ga0111539_100210622 155
774 3300009094 Ga0111539_10040375 Ga0111539_100403753 155
775 3300009094 Ga0111539_10223930 Ga0111539_102239302 155
776 3300009094 Ga0111539_10464300 Ga0111539_104643002 155
777 3300009094 Ga0111539_10635646 Ga0111539_106356462 155
778 3300009094 Ga0111539_11087557 Ga0111539_110875572 155
779 3300009094 Ga0111539_11087991 Ga0111539_110879911 155
780 3300009147 Ga0114129_10034096 Ga0114129_100340966 155
781 3300009147 Ga0114129_10044082 Ga0114129_100440822 155
782 3300009147 Ga0114129_10196868 Ga0114129_101968682 155
783 3300009147 Ga0114129_10373398 Ga0114129_103733982 155
784 3300009147 Ga0114129_10633000 Ga0114129_106330001 155
785 3300009147 Ga0114129_10765889 Ga0114129_107658892 155
786 3300009147 Ga0114129_11368504 Ga0114129_113685042 155
787 3300009147 Ga0114129_11563707 Ga0114129_115637072 155
788 3300009177 Ga0105248_10058517 Ga0105248_100585171 155
789 3300009553 Ga0105249_10064382 Ga0105249_100643821 155
790 3300009553 Ga0105249_10234697 Ga0105249_102346972 155
791 3300009553 Ga0105249_10950119 Ga0105249_109501191 155
792 3300009553 Ga0105249_11674273 Ga0105249_116742731 155
793 3300009553 Ga0105249_12884872 Ga0105249_128848721 155
794 3300009553 Ga0105249_12992665 Ga0105249_129926651 155
795 3300012508 Ga0157315_1020076 Ga0157315_10200761 155
796 3300013296 Ga0157374_10275837 Ga0157374_102758372 155
797 3300013296 Ga0157374_10367168 Ga0157374_103671682 155
798 3300013306 Ga0163162_10034885 Ga0163162_100348854 155
799 3300013306 Ga0163162_10173920 Ga0163162_101739201 155
800 3300013306 Ga0163162_10869929 Ga0163162_108699291 155
801 3300013308 Ga0157375_10070818 Ga0157375_100708181 155
802 3300013308 Ga0157375_11348247 Ga0157375_113482471 155
803 3300014325 Ga0163163_10049669 Ga0163163_100496692 155
804 3300014326 Ga0157380_10007481 Ga0157380_100074815 155
805 3300014326 Ga0157380_10013472 Ga0157380_100134725 155
806 3300014326 Ga0157380_10092262 Ga0157380_100922622 155
807 3300014326 Ga0157380_10095680 Ga0157380_100956802 155
808 3300014326 Ga0157380_10605065 Ga0157380_106050652 155
809 3300014326 Ga0157380_10763339 Ga0157380_107633392 155
810 3300014326 Ga0157380_11430781 Ga0157380_114307811 155
811 3300014326 Ga0157380_12140741 Ga0157380_121407412 155
812 3300014745 Ga0157377_10011536 Ga0157377_100115362 155
813 3300014745 Ga0157377_10031760 Ga0157377_100317602 155
814 3300014745 Ga0157377_10220772 Ga0157377_102207722 155
815 3300014745 Ga0157377_10319348 Ga0157377_103193481 155
816 3300014745 Ga0157377_10328638 Ga0157377_103286382 155
817 3300014968 Ga0157379_10048906 Ga0157379_100489064 155
818 3300014969 Ga0157376_10154267 Ga0157376_101542672 155
819 3300014969 Ga0157376_12272039 Ga0157376_122720391 155
820 3300017792 Ga0163161_10054592 Ga0163161_100545922 155
821 3300025290 Ga0207673_1004444 Ga0207673_10044442 155
822 3300025315 Ga0207697_10006229 Ga0207697_100062294 155
823 3300025315 Ga0207697_10014857 Ga0207697_100148573 155
824 3300025315 Ga0207697_10057159 Ga0207697_100571592 155
825 3300025315 Ga0207697_10062782 Ga0207697_100627821 155
826 3300025315 Ga0207697_10100761 Ga0207697_101007612 155
827 3300025885 Ga0207653_10042479 Ga0207653_100424792 155
828 3300025893 Ga0207682_10025689 Ga0207682_100256892 155
829 3300025893 Ga0207682_10044666 Ga0207682_100446662 155
830 3300025893 Ga0207682_10084505 Ga0207682_100845052 155
831 3300025893 Ga0207682_10100194 Ga0207682_101001942 155
832 3300025899 Ga0207642_10193415 Ga0207642_101934151 155
833 3300025899 Ga0207642_10420664 Ga0207642_104206642 155
834 3300025901 Ga0207688_10001167 Ga0207688_100011672 155
835 3300025903 Ga0207680_10575620 Ga0207680_105756201 155
836 3300025907 Ga0207645_10006799 Ga0207645_100067998 155
837 3300025907 Ga0207645_10035884 Ga0207645_100358842 155
838 3300025907 Ga0207645_10262055 Ga0207645_102620552 155
839 3300025908 Ga0207643_10000421 Ga0207643_1000042122 155
840 3300025908 Ga0207643_10003973 Ga0207643_100039736 155
841 3300025908 Ga0207643_10137132 Ga0207643_101371322 155
842 3300025908 Ga0207643_10225562 Ga0207643_102255622 155
843 3300025910 Ga0207684_10086680 Ga0207684_100866802 155
844 3300025915 Ga0207693_10176989 Ga0207693_101769892 155
845 3300025917 Ga0207660_10402687 Ga0207660_104026872 155
846 3300025918 Ga0207662_10008088 Ga0207662_100080881 155
847 3300025918 Ga0207662_10596891 Ga0207662_105968912 155
848 3300025920 Ga0207649_10034873 Ga0207649_100348732 155
849 3300025920 Ga0207649_10690565 Ga0207649_106905651 155
850 3300025920 Ga0207649_10808486 Ga0207649_108084861 155
851 3300025920 Ga0207649_11101091 Ga0207649_111010911 155
852 3300025922 Ga0207646_10063922 Ga0207646_100639222 155
853 3300025923 Ga0207681_10014583 Ga0207681_100145832 155
854 3300025923 Ga0207681_10027511 Ga0207681_100275113 155
855 3300025923 Ga0207681_10187241 Ga0207681_101872412 155
856 3300025923 Ga0207681_10574473 Ga0207681_105744731 155
857 3300025923 Ga0207681_11234983 Ga0207681_112349832 155
858 3300025925 Ga0207650_10023131 Ga0207650_100231314 155
859 3300025925 Ga0207650_10110013 Ga0207650_101100132 155
860 3300025925 Ga0207650_10218521 Ga0207650_102185211 155
861 3300025926 Ga0207659_10014101 Ga0207659_100141013 155
862 3300025926 Ga0207659_10082191 Ga0207659_100821911 155
863 3300025926 Ga0207659_10117411 Ga0207659_101174112 155
864 3300025926 Ga0207659_10249523 Ga0207659_102495232 155
865 3300025926 Ga0207659_10299663 Ga0207659_102996632 155
866 3300025932 Ga0207690_10073740 Ga0207690_100737402 155
867 3300025933 Ga0207706_10013947 Ga0207706_100139477 155
868 3300025933 Ga0207706_10016745 Ga0207706_100167454 155
869 3300025933 Ga0207706_10094059 Ga0207706_100940593 155
870 3300025936 Ga0207670_10093496 Ga0207670_100934962 155
871 3300025936 Ga0207670_10098961 Ga0207670_100989612 155
872 3300025936 Ga0207670_10167320 Ga0207670_101673201 155
873 3300025936 Ga0207670_10216198 Ga0207670_102161982 155
874 3300025936 Ga0207670_10440253 Ga0207670_104402532 155
875 3300025937 Ga0207669_10004678 Ga0207669_100046783 155
876 3300025937 Ga0207669_10118812 Ga0207669_101188122 155
877 3300025937 Ga0207669_10377140 Ga0207669_103771402 155
878 3300025937 Ga0207669_11131837 Ga0207669_111318371 155
879 3300025938 Ga0207704_10599289 Ga0207704_105992892 155
880 3300025938 Ga0207704_10773359 Ga0207704_107733591 155
881 3300025940 Ga0207691_10011048 Ga0207691_100110489 155
882 3300025940 Ga0207691_10037771 Ga0207691_100377712 155
883 3300025940 Ga0207691_10052143 Ga0207691_100521434 155
884 3300025940 Ga0207691_10101756 Ga0207691_101017562 155
885 3300025940 Ga0207691_10192560 Ga0207691_101925602 155
886 3300025940 Ga0207691_10220937 Ga0207691_102209372 155
887 3300025940 Ga0207691_10232816 Ga0207691_102328161 155
888 3300025940 Ga0207691_10265102 Ga0207691_102651023 155
889 3300025942 Ga0207689_10009631 Ga0207689_100096314 155
890 3300025942 Ga0207689_10012411 Ga0207689_100124117 155
891 3300025942 Ga0207689_10365702 Ga0207689_103657022 155
892 3300025942 Ga0207689_10426007 Ga0207689_104260071 155
893 3300025945 Ga0207679_10007458 Ga0207679_100074584 155
894 3300025945 Ga0207679_10021997 Ga0207679_100219973 155
895 3300025945 Ga0207679_10106162 Ga0207679_101061622 155
896 3300025945 Ga0207679_10196205 Ga0207679_101962052 155
897 3300025945 Ga0207679_10306941 Ga0207679_103069412 155
898 3300025945 Ga0207679_10594375 Ga0207679_105943752 155
899 3300025945 Ga0207679_10710492 Ga0207679_107104921 155
900 3300025960 Ga0207651_10026837 Ga0207651_100268372 155
901 3300025960 Ga0207651_10045179 Ga0207651_100451792 155
902 3300025960 Ga0207651_10048143 Ga0207651_100481431 155
903 3300025960 Ga0207651_10566373 Ga0207651_105663731 155
904 3300025961 Ga0207712_11686813 Ga0207712_116868131 155
905 3300025972 Ga0207668_10039855 Ga0207668_100398552 155
906 3300025972 Ga0207668_10179344 Ga0207668_101793442 155
907 3300025972 Ga0207668_10372496 Ga0207668_103724962 155
908 3300025972 Ga0207668_10669683 Ga0207668_106696832 155
909 3300025981 Ga0207640_10880173 Ga0207640_108801731 155
910 3300025981 Ga0207640_11902215 Ga0207640_119022151 155
911 3300025986 Ga0207658_10520492 Ga0207658_105204922 155
912 3300025986 Ga0207658_10714620 Ga0207658_107146202 155
913 3300025986 Ga0207658_11066660 Ga0207658_110666601 155
914 3300026023 Ga0207677_10118776 Ga0207677_101187762 155
915 3300026023 Ga0207677_11499156 Ga0207677_114991561 155
916 3300026035 Ga0207703_10085378 Ga0207703_100853782 155
917 3300026041 Ga0207639_11013193 Ga0207639_110131931 155
918 3300026067 Ga0207678_10441441 Ga0207678_104414411 155
919 3300026075 Ga0207708_10013130 Ga0207708_100131305 155
920 3300026075 Ga0207708_10039098 Ga0207708_100390982 155
921 3300026075 Ga0207708_10179488 Ga0207708_101794882 155
922 3300026075 Ga0207708_10186032 Ga0207708_101860322 155
923 3300026075 Ga0207708_11408974 Ga0207708_114089741 155
924 3300026088 Ga0207641_10142894 Ga0207641_101428942 155
925 3300026088 Ga0207641_10437360 Ga0207641_104373602 155
926 3300026089 Ga0207648_10073765 Ga0207648_100737652 155
927 3300026089 Ga0207648_10142645 Ga0207648_101426452 155
928 3300026089 Ga0207648_10160602 Ga0207648_101606022 155
929 3300026089 Ga0207648_10624495 Ga0207648_106244951 155
930 3300026089 Ga0207648_10742489 Ga0207648_107424892 155
931 3300026089 Ga0207648_10931739 Ga0207648_109317392 155
932 3300026095 Ga0207676_10181467 Ga0207676_101814672 155
933 3300026116 Ga0207674_10076334 Ga0207674_100763343 155
934 3300026116 Ga0207674_10172945 Ga0207674_101729452 155
935 3300026116 Ga0207674_11073421 Ga0207674_110734212 155
936 3300026118 Ga0207675_100030876 Ga0207675_1000308762 155
937 3300026118 Ga0207675_100039233 Ga0207675_1000392332 155
938 3300026118 Ga0207675_100308482 Ga0207675_1003084822 155
939 3300026118 Ga0207675_100453834 Ga0207675_1004538341 155
940 3300026118 Ga0207675_101009548 Ga0207675_1010095481 155
941 3300026121 Ga0207683_10042430 Ga0207683_100424303 155
942 3300026121 Ga0207683_10051914 Ga0207683_100519143 155
943 3300026121 Ga0207683_10153964 Ga0207683_101539642 155
944 3300026121 Ga0207683_10532556 Ga0207683_105325562 155
945 3300027682 Ga0209971_1078061 Ga0209971_10780611 155
946 3300027717 Ga0209998_10055051 Ga0209998_100550511 155
947 3300027876 Ga0209974_10062413 Ga0209974_100624132 155
948 3300027907 Ga0207428_10000515 Ga0207428_1000051519 155
949 3300027907 Ga0207428_10002311 Ga0207428_1000231110 155
950 3300027907 Ga0207428_10006882 Ga0207428_100068829 155
951 3300027907 Ga0207428_10327876 Ga0207428_103278762 155
952 3300027907 Ga0207428_10752096 Ga0207428_107520961 155
953 3300028379 Ga0268266_10400147 Ga0268266_104001472 155
954 3300028380 Ga0268265_10188184 Ga0268265_101881842 155
955 3300028380 Ga0268265_10234290 Ga0268265_102342902 155
956 3300028380 Ga0268265_10258420 Ga0268265_102584202 155
957 3300028380 Ga0268265_10389729 Ga0268265_103897292 155
958 3300028380 Ga0268265_10664087 Ga0268265_106640872 155
959 3300028380 Ga0268265_10749026 Ga0268265_107490261 155
960 3300028380 Ga0268265_11165060 Ga0268265_111650602 155
961 3300028381 Ga0268264_11184763 Ga0268264_111847631 155
962 3300031548 Ga0307408_100086674 Ga0307408_1000866742 155
963 3300031731 Ga0307405_10004821 Ga0307405_100048214 155
964 3300031824 Ga0307413_10126311 Ga0307413_101263112 155
965 3300031852 Ga0307410_10008571 Ga0307410_100085712 155
966 3300031901 Ga0307406_10068985 Ga0307406_100689852 155
967 3300031903 Ga0307407_10003751 Ga0307407_100037516 155
968 3300031911 Ga0307412_10027611 Ga0307412_100276112 155
969 3300031911 Ga0307412_10574164 Ga0307412_105741642 155
970 3300031911 Ga0307412_11605491 Ga0307412_116054911 155
971 3300031995 Ga0307409_100062413 Ga0307409_1000624133 155
972 3300031995 Ga0307409_101109911 Ga0307409_1011099111 155
973 3300032002 Ga0307416_100097463 Ga0307416_1000974632 155
974 3300032005 Ga0307411_10127862 Ga0307411_101278622 155
975 3300032005 Ga0307411_10445419 Ga0307411_104454192 155
976 3300032005 Ga0307411_10819585 Ga0307411_108195851 155
977 3300032126 Ga0307415_100024282 Ga0307415_1000242822 155
978 3300035112 Ga0373932_0111103 Ga0373932_0111103_231_698 155
979 3300035115 Ga0373941_0266422 Ga0373941_0266422_139_606 155
980 3300035121 Ga0373960_0025199 Ga0373960_0025199_1051_1518 155
981 3300035241 Ga0373961_0022626 Ga0373961_0022626_287_754 155
982 3300041408 Ga0439453_0022459 Ga0439453_0022459_452_1093 155
983 3300041999 Ga0439433_0027879 Ga0439433_0027879_689_1156 155
984 3300042015 Ga0439462_0199881 Ga0439462_0199881_61_528 155
985 3300042118 Ga0450914_046764 Ga0450914_046764_37_504 155
986 3300042156 Ga0439446_0042916 Ga0439446_0042916_434_901 155
987 3300042156 Ga0439446_0099084 Ga0439446_0099084_369_836 155
988 3300042435 Ga0439434_0057687 Ga0439434_0057687_265_732 155
989 3300042436 Ga0439435_0092311 Ga0439435_0092311_192_659 155
990 3300042439 Ga0439464_0122213 Ga0439464_0122213_150_617 155
991 3300042530 Ga0450916_024858 Ga0450916_024858_27_494 155
992 3300042993 Ga0439440_0104953 Ga0439440_0104953_136_603 155
993 3300046499 Ga0495594_0062966 Ga0495594_0062966_780_1247 155
994 3300046537 Ga0495598_0179138 Ga0495598_0179138_37_504 155
995 3300046539 Ga0495621_0054794 Ga0495621_0054794_331_798 155
996 3300046558 Ga0495633_0143241 Ga0495633_0143241_215_682 155
997 3300046664 Ga0495659_0488488 Ga0495659_0488488_41_508 155
998 3300046674 Ga0495588_0254220 Ga0495588_0254220_52_519 155
999 3300046684 Ga0495669_0207481 Ga0495669_0207481_334_801 155
1000 3300047318 Ga0495636_0064540 Ga0495636_0064540_714_1181 155
1001 3300048909 Ga0496106_0485290 Ga0496106_0485290_211_678 155
1002 3300048913 Ga0496110_0171743 Ga0496110_0171743_557_1024 155
1003 3300048913 Ga0496110_0680971 Ga0496110_0680971_346_813 155
1004 3300049521 Ga0501298_030201 Ga0501298_030201_294_761 155
1005 3300049572 Ga0501036_0101941 Ga0501036_0101941_447_1019 155
1006 3300049572 Ga0501036_0119187 Ga0501036_0119187_29_496 155
1007 3300049573 Ga0501037_0372352 Ga0501037_0372352_318_890 155
1008 3300049575 Ga0501039_0056023 Ga0501039_0056023_2344_2811 155
1009 3300049575 Ga0501039_0069299 Ga0501039_0069299_189_761 155
1010 3300049576 Ga0501040_0018432 Ga0501040_0018432_4093_4560 155
1011 3300049576 Ga0501040_0086204 Ga0501040_0086204_436_1008 155
1012 3300049576 Ga0501040_0964412 Ga0501040_0964412_96_563 155
1013 3300049577 Ga0501041_0064651 Ga0501041_0064651_1280_1852 155
1014 3300049577 Ga0501041_0189559 Ga0501041_0189559_189_656 155
1015 3300049578 Ga0501042_0025948 Ga0501042_0025948_13_585 155
1016 3300049578 Ga0501042_0062804 Ga0501042_0062804_36_503 155
1017 3300049580 Ga0501046_0001085 Ga0501046_0001085_26163_26630 155
1018 3300049582 Ga0501048_0063991 Ga0501048_0063991_314_886 155
1019 3300049582 Ga0501048_0088906 Ga0501048_0088906_24_491 155
1020 3300049587 Ga0501071_0037006 Ga0501071_0037006_2955_3422 155
1021 3300049587 Ga0501071_0156786 Ga0501071_0156786_831_1403 155
1022 3300049590 Ga0501074_0658231 Ga0501074_0658231_47_514 155
1023 3300049590 Ga0501074_1172151 Ga0501074_1172151_40_507 155
1024 3300049591 Ga0501075_0003591 Ga0501075_0003591_8944_9516 155
1025 3300049591 Ga0501075_0276180 Ga0501075_0276180_160_627 155
1026 3300049591 Ga0501075_0480718 Ga0501075_0480718_411_878 155
1027 3300049591 Ga0501075_0592558 Ga0501075_0592558_173_640 155
1028 3300049592 Ga0501076_0024232 Ga0501076_0024232_1992_2564 155
1029 3300049592 Ga0501076_0854306 Ga0501076_0854306_51_518 155
1030 3300049592 Ga0501076_1162535 Ga0501076_1162535_68_535 155
1031 3300049593 Ga0501077_0015002 Ga0501077_0015002_19_486 155
1032 3300049593 Ga0501077_0711413 Ga0501077_0711413_26_493 155
1033 3300049679 Ga0501249_010075 Ga0501249_010075_1329_1796 155
1034 3300049741 Ga0501079_0209458 Ga0501079_0209458_475_942 155
1035 3300049743 Ga0501081_0030039 Ga0501081_0030039_2603_3175 155
1036 3300049743 Ga0501081_0046932 Ga0501081_0046932_270_737 155
1037 3300049744 Ga0501083_0218121 Ga0501083_0218121_485_952 155
1038 3300049744 Ga0501083_0493680 Ga0501083_0493680_182_652 155
1039 3300049823 Ga0501044_1174262 Ga0501044_1174262_43_615 155
1040 3300049824 Ga0501045_0056520 Ga0501045_0056520_930_1502 155
1041 3300050507 nmdc:mga05p37_1035000_c1 nmdc:mga05p37_1035000_c1_302_769 155
1042 3300050507 nmdc:mga05p37_1363605_c1 nmdc:mga05p37_1363605_c1_62_529 155
1043 3300050507 nmdc:mga05p37_174100_c1 nmdc:mga05p37_174100_c1_1764_2237 155
1044 3300050507 nmdc:mga05p37_406896_c1 nmdc:mga05p37_406896_c1_1106_1573 155
1045 3300050507 nmdc:mga05p37_43511_c1 nmdc:mga05p37_43511_c1_4884_5351 155
1046 3300050507 nmdc:mga05p37_81153_c2 nmdc:mga05p37_81153_c2_1194_1661 155
1047 3300050507 nmdc:mga05p37_822700_c1 nmdc:mga05p37_822700_c1_249_716 155
1048 3300050508 nmdc:mga09592_2456_c1 nmdc:mga09592_2456_c1_8880_9347 155
1049 3300050508 nmdc:mga09592_290133_c1 nmdc:mga09592_290133_c1_783_1319 155
1050 3300050508 nmdc:mga09592_3877_c1 nmdc:mga09592_3877_c1_4085_4552 155
1051 3300050508 nmdc:mga09592_514254_c1 nmdc:mga09592_514254_c1_391_858 155
1052 3300050508 nmdc:mga09592_54046_c1 nmdc:mga09592_54046_c1_174_641 155
1053 3300050509 nmdc:mga0qj67_1191813_c1 nmdc:mga0qj67_1191813_c1_64_531 155
1054 3300050509 nmdc:mga0qj67_15050_c1 nmdc:mga0qj67_15050_c1_3880_4347 155
1055 3300050509 nmdc:mga0qj67_2494_c1 nmdc:mga0qj67_2494_c1_7623_8090 155
1056 3300050509 nmdc:mga0qj67_49253_c1 nmdc:mga0qj67_49253_c1_2812_3279 155
1057 3300050509 nmdc:mga0qj67_585652_c1 nmdc:mga0qj67_585652_c1_204_671 155
1058 3300050510 nmdc:mga06r32_263642_c1 nmdc:mga06r32_263642_c1_586_1053 155
1059 3300050510 nmdc:mga06r32_31910_c1 nmdc:mga06r32_31910_c1_991_1458 155
1060 3300050510 nmdc:mga06r32_41442_c1 nmdc:mga06r32_41442_c1_2905_3372 155
1061 3300050510 nmdc:mga06r32_6589_c1 nmdc:mga06r32_6589_c1_4326_4793 155
1062 3300050511 nmdc:mga08y16_1241992_c1 nmdc:mga08y16_1241992_c1_89_556 155
1063 3300050511 nmdc:mga08y16_1271719_c1 nmdc:mga08y16_1271719_c1_75_614 155
1064 3300050511 nmdc:mga08y16_3326_c2 nmdc:mga08y16_3326_c2_4449_4916 155
1065 3300050511 nmdc:mga08y16_37298_c1 nmdc:mga08y16_37298_c1_1306_1773 155
1066 3300050511 nmdc:mga08y16_43724_c1 nmdc:mga08y16_43724_c1_1788_2255 155
1067 3300050511 nmdc:mga08y16_48345_c1 nmdc:mga08y16_48345_c1_2194_2661 155
1068 3300050511 nmdc:mga08y16_526993_c1 nmdc:mga08y16_526993_c1_698_1165 155
1069 3300050511 nmdc:mga08y16_5474_c1 nmdc:mga08y16_5474_c1_10921_11442 155
1070 3300050511 nmdc:mga08y16_79251_c1 nmdc:mga08y16_79251_c1_741_1208 155
1071 3300050511 nmdc:mga08y16_976_c1 nmdc:mga08y16_976_c1_11376_11843 155
1072 3300050512 nmdc:mga0n895_1176576_c1 nmdc:mga0n895_1176576_c1_206_679 155
1073 3300050512 nmdc:mga0n895_16886_c1 nmdc:mga0n895_16886_c1_1490_1957 155
1074 3300050512 nmdc:mga0n895_77894_c1 nmdc:mga0n895_77894_c1_2773_3240 155
1075 3300050512 nmdc:mga0n895_8913_c1 nmdc:mga0n895_8913_c1_2425_2892 155
1076 3300050513 nmdc:mga0rr50_118939_c1 nmdc:mga0rr50_118939_c1_1151_1618 155
1077 3300050515 nmdc:mga0a205_200440_c1 nmdc:mga0a205_200440_c1_738_1205 155
1078 3300050515 nmdc:mga0a205_5674_c1 nmdc:mga0a205_5674_c1_9977_10444 155
1079 3300050515 nmdc:mga0a205_894_c1 nmdc:mga0a205_894_c1_15578_16045 155
1080 3300054114 Ga0501084_0004609 Ga0501084_0004609_10380_10847 155
1081 3300054114 Ga0501084_0073686 Ga0501084_0073686_1929_2501 155
1082 3300060353 Ga0501082_0014744 Ga0501082_0014744_5821_6288 155
1083 3300061734 Ga0530510_0032284 Ga0530510_0032284_2335_2802 155
1084 3300061734 Ga0530510_1262851 Ga0530510_1262851_84_551 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

40

168

0.98

PF08534

Redoxin

Redoxin

39

184

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.9613 3 154
2cx4-assembly4.cif.gz_H crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the aeropyrum pernix k1 (form-2 crystal) 0.9608 3 153
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.9431 3 154
2cx4-assembly4.cif.gz_H crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the aeropyrum pernix k1 (form-2 crystal) 0.9367 3 153
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.9287 1 154
ID Description Score Start End Superfamily
2cx4E00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9435 1 153 3.40.30.10
2cx4E00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9317 1 153 3.40.30.10
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9189 1 154 3.40.30.10
4af2A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9116 1 154 3.40.30.10
2yzhD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9101 1 153 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A818UNV0-F1-model_v4 Thioredoxin domain-containing protein 0.9778 2 153 GO:0016209
GO:0016491
AF-A0A7J4AB69-F1-model_v4 Peroxiredoxin 0.9769 3 154 GO:0016209
GO:0016491
AF-A0A818UKB0-F1-model_v4 Thioredoxin domain-containing protein 0.9768 1 151 GO:0016209
GO:0016491
AF-A0A7C2XF79-F1-model_v4 Peroxiredoxin 0.9766 3 154 GO:0016209
GO:0016491
AF-A0A817PIK7-F1-model_v4 Thioredoxin domain-containing protein 0.9762 1 153 GO:0016209
GO:0016491

Feature Viewer

pLDDT pTM Quality
90.48 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map