F489751
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1084 | 321 | 1084 | 156 |
Family's Representative Sequence
| Representative Sequence | 3300049572|Ga0501036_0101941|Ga0501036_0101941_447_1019 |
| Length | 190 |
| Sequence | MAVAAAVAVIGDELMADTYYNHWFENRHDHQGDASMSVEVGAKAPDFTLPNQDREPVSLSEQLKSGPVVLAFFPAAFSGTCQKEMCTFRDSASTLNSVKAKVLGISVDTFFALKAWGDENKLNFPLLSDFNKDVIAKYGVVNPDMIGLKNIAKRSVFVIDKGGVVRHREVLEDARNEPNYEKITQTLASL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 195 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 196 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 199 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 200 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 201 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 202 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 204 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 207 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 208 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 209 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 210 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 215 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 217 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 226 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 230 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 232 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 233 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 234 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 235 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 236 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 237 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 238 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 239 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 240 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 241 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 242 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 274 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 275 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 276 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 277 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 280 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 281 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 282 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 283 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 284 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 300 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 317 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 319 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 320 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.82 |
| Metatranscriptomes | 0.18 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.09 |
| Nodule | 0 |
| Rhizoplane | 1.85 |
| Rhizosphere | 97.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARSoilOldRDRAFT_c005815 | 3300000044 | Bacteria | 1037 |
| 2 | JGI24746J21847_1000635 | 3300001977 | Bacteria | 5368 |
| 3 | JGI24751J29686_10024321 | 3300002459 | Bacteria | 1256 |
| 4 | JGI25406J46586_10037792 | 3300003203 | Unclassified | 1737 |
| 5 | rootH2_10206308 | 3300003320 | Bacteria | 1125 |
| 6 | Ga0058859_11634508 | 3300004798 | Unclassified | 819 |
| 7 | Ga0058860_12130943 | 3300004801 | Bacteria | 687 |
| 8 | Ga0065714_10021748 | 3300005288 | Bacteria | 1694 |
| 9 | Ga0065704_10014277 | 3300005289 | Bacteria | 2056 |
| 10 | Ga0065712_10000373 | 3300005290 | Bacteria | 15174 |
| 11 | Ga0065712_10008353 | 3300005290 | Unclassified | 4460 |
| 12 | Ga0065712_10080010 | 3300005290 | Bacteria | 3144 |
| 13 | Ga0065712_10086798 | 3300005290 | Bacteria | 2615 |
| 14 | Ga0065712_10119676 | 3300005290 | Bacteria | 1688 |
| 15 | Ga0065712_10251049 | 3300005290 | Bacteria | 960 |
| 16 | Ga0065712_10369363 | 3300005290 | Unclassified | 763 |
| 17 | Ga0065712_10636686 | 3300005290 | Unclassified | 573 |
| 18 | Ga0065715_10089661 | 3300005293 | Bacteria | 9036 |
| 19 | Ga0065715_10094316 | 3300005293 | Unclassified | 4371 |
| 20 | Ga0065715_10137491 | 3300005293 | Bacteria | 1906 |
| 21 | Ga0065715_10283272 | 3300005293 | Bacteria | 1067 |
| 22 | Ga0065715_10639614 | 3300005293 | Unclassified | 683 |
| 23 | Ga0065707_10107323 | 3300005295 | Unclassified | 2559 |
| 24 | Ga0065707_10107853 | 3300005295 | Bacteria | 2536 |
| 25 | Ga0065707_10195881 | 3300005295 | Bacteria | 1336 |
| 26 | Ga0065707_10342578 | 3300005295 | Bacteria | 931 |
| 27 | Ga0065707_10524797 | 3300005295 | Unclassified | 739 |
| 28 | Ga0065707_10847730 | 3300005295 | Unclassified | 583 |
| 29 | Ga0070676_10115721 | 3300005328 | Bacteria | 1676 |
| 30 | Ga0070676_10169845 | 3300005328 | Bacteria | 1410 |
| 31 | Ga0070676_10277072 | 3300005328 | Unclassified | 1129 |
| 32 | Ga0070676_11239471 | 3300005328 | Unclassified | 568 |
| 33 | Ga0070683_100085861 | 3300005329 | Bacteria | 2951 |
| 34 | Ga0070690_100047569 | 3300005330 | Bacteria | 2729 |
| 35 | Ga0070690_100071050 | 3300005330 | Bacteria | 2261 |
| 36 | Ga0070690_100085097 | 3300005330 | Bacteria | 2074 |
| 37 | Ga0070690_100194594 | 3300005330 | Bacteria | 1408 |
| 38 | Ga0070690_100243194 | 3300005330 | Bacteria | 1270 |
| 39 | Ga0070690_100647491 | 3300005330 | Bacteria | 807 |
| 40 | Ga0070690_100655740 | 3300005330 | Bacteria | 802 |
| 41 | Ga0070690_100803169 | 3300005330 | Unclassified | 730 |
| 42 | Ga0070670_100068895 | 3300005331 | Unclassified | 3037 |
| 43 | Ga0070670_100073656 | 3300005331 | Bacteria | 2933 |
| 44 | Ga0070670_100190877 | 3300005331 | Bacteria | 1779 |
| 45 | Ga0070670_100387010 | 3300005331 | Bacteria | 1233 |
| 46 | Ga0070677_10004638 | 3300005333 | Bacteria | 4496 |
| 47 | Ga0070677_10071396 | 3300005333 | Bacteria | 1461 |
| 48 | Ga0070677_10105968 | 3300005333 | Bacteria | 1247 |
| 49 | Ga0070677_10213751 | 3300005333 | Unclassified | 938 |
| 50 | Ga0070677_10407443 | 3300005333 | Bacteria | 718 |
| 51 | Ga0068869_100005548 | 3300005334 | Bacteria | 7941 |
| 52 | Ga0068869_100008204 | 3300005334 | Bacteria | 6719 |
| 53 | Ga0068869_100096572 | 3300005334 | Bacteria | 2231 |
| 54 | Ga0068869_100358631 | 3300005334 | Bacteria | 1190 |
| 55 | Ga0070666_10039433 | 3300005335 | Bacteria | 3148 |
| 56 | Ga0070666_10332421 | 3300005335 | Bacteria | 1085 |
| 57 | Ga0070666_10575274 | 3300005335 | Bacteria | 821 |
| 58 | Ga0070680_100307806 | 3300005336 | Unclassified | 1344 |
| 59 | Ga0070680_100906617 | 3300005336 | Bacteria | 761 |
| 60 | Ga0070680_100982075 | 3300005336 | Unclassified | 729 |
| 61 | Ga0070680_101036432 | 3300005336 | Bacteria | 709 |
| 62 | Ga0070680_101818216 | 3300005336 | Bacteria | 528 |
| 63 | Ga0070682_101458129 | 3300005337 | Bacteria | 587 |
| 64 | Ga0068868_100188517 | 3300005338 | Bacteria | 1714 |
| 65 | Ga0068868_100390635 | 3300005338 | Bacteria | 1199 |
| 66 | Ga0068868_100630411 | 3300005338 | Bacteria | 953 |
| 67 | Ga0068868_101039303 | 3300005338 | Unclassified | 751 |
| 68 | Ga0068868_102197568 | 3300005338 | Bacteria | 526 |
| 69 | Ga0070660_100082029 | 3300005339 | Bacteria | 2532 |
| 70 | Ga0070660_100154283 | 3300005339 | Unclassified | 1848 |
| 71 | Ga0070660_100361684 | 3300005339 | Bacteria | 1196 |
| 72 | Ga0070660_101052490 | 3300005339 | Unclassified | 688 |
| 73 | Ga0070660_101324747 | 3300005339 | Unclassified | 611 |
| 74 | Ga0070689_100092599 | 3300005340 | Bacteria | 2384 |
| 75 | Ga0070689_100211104 | 3300005340 | Unclassified | 1589 |
| 76 | Ga0070689_100357903 | 3300005340 | Bacteria | 1226 |
| 77 | Ga0070689_100368543 | 3300005340 | Bacteria | 1208 |
| 78 | Ga0070689_100453063 | 3300005340 | Bacteria | 1092 |
| 79 | Ga0070689_100723052 | 3300005340 | Bacteria | 871 |
| 80 | Ga0070691_10271224 | 3300005341 | Bacteria | 917 |
| 81 | Ga0070691_10330129 | 3300005341 | Unclassified | 841 |
| 82 | Ga0070687_100003556 | 3300005343 | Bacteria | 6067 |
| 83 | Ga0070687_100008554 | 3300005343 | Bacteria | 4343 |
| 84 | Ga0070661_100027569 | 3300005344 | Bacteria | 4091 |
| 85 | Ga0070661_100276763 | 3300005344 | Bacteria | 1301 |
| 86 | Ga0070661_100414795 | 3300005344 | Bacteria | 1066 |
| 87 | Ga0070661_101115107 | 3300005344 | Bacteria | 658 |
| 88 | Ga0070692_10070524 | 3300005345 | Bacteria | 1861 |
| 89 | Ga0070668_100100000 | 3300005347 | Bacteria | 2297 |
| 90 | Ga0070668_100148140 | 3300005347 | Bacteria | 1896 |
| 91 | Ga0070668_100177775 | 3300005347 | Bacteria | 1737 |
| 92 | Ga0070668_100252156 | 3300005347 | Bacteria | 1465 |
| 93 | Ga0070668_101486300 | 3300005347 | Bacteria | 619 |
| 94 | Ga0070668_102072717 | 3300005347 | Bacteria | 525 |
| 95 | Ga0070669_100004321 | 3300005353 | Bacteria | 10266 |
| 96 | Ga0070669_100005329 | 3300005353 | Bacteria | 9286 |
| 97 | Ga0070669_100042667 | 3300005353 | Bacteria | 3301 |
| 98 | Ga0070669_100097062 | 3300005353 | Bacteria | 2218 |
| 99 | Ga0070669_100146488 | 3300005353 | Bacteria | 1825 |
| 100 | Ga0070669_100192345 | 3300005353 | Unclassified | 1601 |
| 101 | Ga0070669_100202752 | 3300005353 | Bacteria | 1561 |
| 102 | Ga0070669_100304132 | 3300005353 | Bacteria | 1283 |
| 103 | Ga0070669_100897182 | 3300005353 | Bacteria | 757 |
| 104 | Ga0070669_100917146 | 3300005353 | Bacteria | 749 |
| 105 | Ga0070669_101147984 | 3300005353 | Bacteria | 670 |
| 106 | Ga0070669_101373106 | 3300005353 | Bacteria | 613 |
| 107 | Ga0070675_100011134 | 3300005354 | Bacteria | 7038 |
| 108 | Ga0070675_100015561 | 3300005354 | Bacteria | 6017 |
| 109 | Ga0070675_100075989 | 3300005354 | Bacteria | 2793 |
| 110 | Ga0070675_100104614 | 3300005354 | Bacteria | 2388 |
| 111 | Ga0070675_100141512 | 3300005354 | Unclassified | 2057 |
| 112 | Ga0070675_100245149 | 3300005354 | Bacteria | 1566 |
| 113 | Ga0070675_100259780 | 3300005354 | Unclassified | 1522 |
| 114 | Ga0070675_100281889 | 3300005354 | Bacteria | 1460 |
| 115 | Ga0070675_100854273 | 3300005354 | Bacteria | 833 |
| 116 | Ga0070675_100999716 | 3300005354 | Unclassified | 768 |
| 117 | Ga0070671_100242860 | 3300005355 | Bacteria | 1529 |
| 118 | Ga0070674_100001261 | 3300005356 | Bacteria | 13303 |
| 119 | Ga0070674_100003472 | 3300005356 | Bacteria | 8854 |
| 120 | Ga0070674_100021751 | 3300005356 | Bacteria | 4125 |
| 121 | Ga0070674_100047443 | 3300005356 | Bacteria | 2944 |
| 122 | Ga0070674_100110747 | 3300005356 | Unclassified | 2015 |
| 123 | Ga0070674_100647594 | 3300005356 | Bacteria | 898 |
| 124 | Ga0070674_100843913 | 3300005356 | Unclassified | 794 |
| 125 | Ga0070674_101630815 | 3300005356 | Bacteria | 582 |
| 126 | Ga0070674_101822367 | 3300005356 | Bacteria | 552 |
| 127 | Ga0070673_100006876 | 3300005364 | Bacteria | 7440 |
| 128 | Ga0070673_100179758 | 3300005364 | Bacteria | 1810 |
| 129 | Ga0070673_100241893 | 3300005364 | Unclassified | 1569 |
| 130 | Ga0070673_100348781 | 3300005364 | Bacteria | 1313 |
| 131 | Ga0070673_100373137 | 3300005364 | Bacteria | 1270 |
| 132 | Ga0070673_100425224 | 3300005364 | Bacteria | 1191 |
| 133 | Ga0070673_100863626 | 3300005364 | Bacteria | 838 |
| 134 | Ga0070688_100048853 | 3300005365 | Bacteria | 2630 |
| 135 | Ga0070688_100069819 | 3300005365 | Bacteria | 2244 |
| 136 | Ga0070688_100071597 | 3300005365 | Bacteria | 2220 |
| 137 | Ga0070688_100073223 | 3300005365 | Bacteria | 2197 |
| 138 | Ga0070688_100108645 | 3300005365 | Unclassified | 1841 |
| 139 | Ga0070688_100162799 | 3300005365 | Unclassified | 1534 |
| 140 | Ga0070688_100325846 | 3300005365 | Bacteria | 1117 |
| 141 | Ga0070688_100353396 | 3300005365 | Bacteria | 1076 |
| 142 | Ga0070688_100356709 | 3300005365 | Unclassified | 1072 |
| 143 | Ga0070688_100796916 | 3300005365 | Archaea | 739 |
| 144 | Ga0070659_100355655 | 3300005366 | Bacteria | 1229 |
| 145 | Ga0070667_100028388 | 3300005367 | Bacteria | 4658 |
| 146 | Ga0070667_100091938 | 3300005367 | Bacteria | 2610 |
| 147 | Ga0070667_100329936 | 3300005367 | Bacteria | 1378 |
| 148 | Ga0070667_100430202 | 3300005367 | Unclassified | 1204 |
| 149 | Ga0070667_100560199 | 3300005367 | Unclassified | 1051 |
| 150 | Ga0070703_10367038 | 3300005406 | Bacteria | 618 |
| 151 | Ga0070714_100017981 | 3300005435 | Bacteria | 5732 |
| 152 | Ga0070713_100406918 | 3300005436 | Bacteria | 1272 |
| 153 | Ga0070701_10006936 | 3300005438 | Bacteria | 4802 |
| 154 | Ga0070701_10015284 | 3300005438 | Bacteria | 3540 |
| 155 | Ga0070701_10040039 | 3300005438 | Bacteria | 2380 |
| 156 | Ga0070701_10045069 | 3300005438 | Bacteria | 2262 |
| 157 | Ga0070701_10120202 | 3300005438 | Bacteria | 1479 |
| 158 | Ga0070701_10345288 | 3300005438 | Unclassified | 928 |
| 159 | Ga0070705_100057678 | 3300005440 | Unclassified | 2292 |
| 160 | Ga0070705_100653574 | 3300005440 | Bacteria | 820 |
| 161 | Ga0070700_100002184 | 3300005441 | Bacteria | 9939 |
| 162 | Ga0070700_100007571 | 3300005441 | Bacteria | 5871 |
| 163 | Ga0070700_100015844 | 3300005441 | Bacteria | 4283 |
| 164 | Ga0070700_100040187 | 3300005441 | Bacteria | 2862 |
| 165 | Ga0070700_100047841 | 3300005441 | Bacteria | 2649 |
| 166 | Ga0070700_100048842 | 3300005441 | Bacteria | 2624 |
| 167 | Ga0070700_100060756 | 3300005441 | Bacteria | 2382 |
| 168 | Ga0070700_100106558 | 3300005441 | Bacteria | 1856 |
| 169 | Ga0070700_100519330 | 3300005441 | Unclassified | 920 |
| 170 | Ga0070700_100827293 | 3300005441 | Bacteria | 748 |
| 171 | Ga0070694_100373610 | 3300005444 | Bacteria | 1110 |
| 172 | Ga0070694_100482708 | 3300005444 | Bacteria | 984 |
| 173 | Ga0070694_100822174 | 3300005444 | Unclassified | 763 |
| 174 | Ga0070694_100909293 | 3300005444 | Bacteria | 727 |
| 175 | Ga0070694_101102079 | 3300005444 | Unclassified | 662 |
| 176 | Ga0070708_100211381 | 3300005445 | Bacteria | 1818 |
| 177 | Ga0070708_100303668 | 3300005445 | Bacteria | 1503 |
| 178 | Ga0070708_101977453 | 3300005445 | Bacteria | 540 |
| 179 | Ga0070663_100120008 | 3300005455 | Bacteria | 1985 |
| 180 | Ga0070663_100129798 | 3300005455 | Bacteria | 1913 |
| 181 | Ga0070663_100579498 | 3300005455 | Unclassified | 941 |
| 182 | Ga0070663_100680321 | 3300005455 | Bacteria | 873 |
| 183 | Ga0070663_101891555 | 3300005455 | Unclassified | 536 |
| 184 | Ga0070678_100028346 | 3300005456 | Bacteria | 3818 |
| 185 | Ga0070678_100561889 | 3300005456 | Bacteria | 1014 |
| 186 | Ga0070678_102356987 | 3300005456 | Unclassified | 505 |
| 187 | Ga0070662_100028176 | 3300005457 | Bacteria | 3906 |
| 188 | Ga0070662_100148813 | 3300005457 | Bacteria | 1821 |
| 189 | Ga0070662_100180495 | 3300005457 | Bacteria | 1664 |
| 190 | Ga0070662_100268608 | 3300005457 | Bacteria | 1376 |
| 191 | Ga0070681_10014561 | 3300005458 | Bacteria | 7827 |
| 192 | Ga0068867_100003165 | 3300005459 | Bacteria | 11608 |
| 193 | Ga0068867_100082617 | 3300005459 | Bacteria | 2424 |
| 194 | Ga0068867_100102642 | 3300005459 | Unclassified | 2186 |
| 195 | Ga0068867_100210346 | 3300005459 | Bacteria | 1562 |
| 196 | Ga0068867_100410134 | 3300005459 | Bacteria | 1145 |
| 197 | Ga0068867_100650980 | 3300005459 | Bacteria | 924 |
| 198 | Ga0068867_100867712 | 3300005459 | Bacteria | 810 |
| 199 | Ga0068867_101540035 | 3300005459 | Bacteria | 620 |
| 200 | Ga0070685_10068966 | 3300005466 | Unclassified | 2090 |
| 201 | Ga0070685_10085415 | 3300005466 | Bacteria | 1900 |
| 202 | Ga0070685_10221116 | 3300005466 | Unclassified | 1241 |
| 203 | Ga0070685_10363763 | 3300005466 | Bacteria | 992 |
| 204 | Ga0070685_10815907 | 3300005466 | Unclassified | 689 |
| 205 | Ga0070685_10842732 | 3300005466 | Bacteria | 679 |
| 206 | Ga0070707_100035611 | 3300005468 | Bacteria | 4749 |
| 207 | Ga0070707_100609032 | 3300005468 | Bacteria | 1055 |
| 208 | Ga0070707_100916855 | 3300005468 | Bacteria | 841 |
| 209 | Ga0070698_100129199 | 3300005471 | Bacteria | 2483 |
| 210 | Ga0070698_100493055 | 3300005471 | Bacteria | 1163 |
| 211 | Ga0070698_100601505 | 3300005471 | Unclassified | 1040 |
| 212 | Ga0070699_100002012 | 3300005518 | Bacteria | 18361 |
| 213 | Ga0070699_100705653 | 3300005518 | Bacteria | 922 |
| 214 | Ga0070699_101091497 | 3300005518 | Unclassified | 732 |
| 215 | Ga0070679_100040461 | 3300005530 | Bacteria | 4637 |
| 216 | Ga0070679_100049935 | 3300005530 | Bacteria | 4167 |
| 217 | Ga0070679_101868748 | 3300005530 | Unclassified | 549 |
| 218 | Ga0070684_100187598 | 3300005535 | Bacteria | 1881 |
| 219 | Ga0070697_100170580 | 3300005536 | Bacteria | 1841 |
| 220 | Ga0070697_100327541 | 3300005536 | Bacteria | 1320 |
| 221 | Ga0068853_100196465 | 3300005539 | Bacteria | 1835 |
| 222 | Ga0070672_100043187 | 3300005543 | Bacteria | 3475 |
| 223 | Ga0070672_100063994 | 3300005543 | Bacteria | 2905 |
| 224 | Ga0070672_100084274 | 3300005543 | Bacteria | 2552 |
| 225 | Ga0070672_100199170 | 3300005543 | Bacteria | 1674 |
| 226 | Ga0070672_100784755 | 3300005543 | Unclassified | 838 |
| 227 | Ga0070672_100790618 | 3300005543 | Unclassified | 834 |
| 228 | Ga0070686_100031463 | 3300005544 | Bacteria | 3244 |
| 229 | Ga0070686_100057146 | 3300005544 | Bacteria | 2505 |
| 230 | Ga0070686_100085056 | 3300005544 | Bacteria | 2103 |
| 231 | Ga0070686_100130902 | 3300005544 | Unclassified | 1735 |
| 232 | Ga0070686_100220726 | 3300005544 | Bacteria | 1370 |
| 233 | Ga0070686_100705965 | 3300005544 | Bacteria | 805 |
| 234 | Ga0070686_100737860 | 3300005544 | Bacteria | 789 |
| 235 | Ga0070686_101056086 | 3300005544 | Bacteria | 669 |
| 236 | Ga0070695_100002468 | 3300005545 | Bacteria | 10652 |
| 237 | Ga0070695_100016243 | 3300005545 | Bacteria | 4504 |
| 238 | Ga0070695_100022402 | 3300005545 | Bacteria | 3874 |
| 239 | Ga0070695_100337306 | 3300005545 | Bacteria | 1125 |
| 240 | Ga0070695_100961961 | 3300005545 | Bacteria | 693 |
| 241 | Ga0070696_100016233 | 3300005546 | Bacteria | 5011 |
| 242 | Ga0070696_100036951 | 3300005546 | Bacteria | 3369 |
| 243 | Ga0070696_100160329 | 3300005546 | Bacteria | 1657 |
| 244 | Ga0070665_100322689 | 3300005548 | Bacteria | 1548 |
| 245 | Ga0070704_100009365 | 3300005549 | Bacteria | 5912 |
| 246 | Ga0070704_100119305 | 3300005549 | Bacteria | 2023 |
| 247 | Ga0070704_100222089 | 3300005549 | Bacteria | 1537 |
| 248 | Ga0070704_100255264 | 3300005549 | Bacteria | 1442 |
| 249 | Ga0070704_100287858 | 3300005549 | Bacteria | 1364 |
| 250 | Ga0070704_100526392 | 3300005549 | Bacteria | 1030 |
| 251 | Ga0070704_100654531 | 3300005549 | Unclassified | 928 |
| 252 | Ga0070704_101049520 | 3300005549 | Unclassified | 739 |
| 253 | Ga0068855_100020797 | 3300005563 | Bacteria | 7868 |
| 254 | Ga0070664_100024009 | 3300005564 | Bacteria | 5039 |
| 255 | Ga0070664_100118928 | 3300005564 | Unclassified | 2312 |
| 256 | Ga0070664_100134973 | 3300005564 | Bacteria | 2169 |
| 257 | Ga0070664_100152090 | 3300005564 | Bacteria | 2043 |
| 258 | Ga0070664_100269325 | 3300005564 | Bacteria | 1534 |
| 259 | Ga0068857_100102707 | 3300005577 | Bacteria | 2566 |
| 260 | Ga0068857_100120998 | 3300005577 | Bacteria | 2357 |
| 261 | Ga0068857_100510647 | 3300005577 | Bacteria | 1129 |
| 262 | Ga0068857_100558327 | 3300005577 | Bacteria | 1079 |
| 263 | Ga0068857_100978243 | 3300005577 | Bacteria | 814 |
| 264 | Ga0068854_100022971 | 3300005578 | Bacteria | 4256 |
| 265 | Ga0068854_100054657 | 3300005578 | Bacteria | 2872 |
| 266 | Ga0068856_101662602 | 3300005614 | Unclassified | 651 |
| 267 | Ga0070702_100148269 | 3300005615 | Unclassified | 1503 |
| 268 | Ga0070702_100431735 | 3300005615 | Bacteria | 951 |
| 269 | Ga0070702_100434359 | 3300005615 | Unclassified | 948 |
| 270 | Ga0068852_100166490 | 3300005616 | Bacteria | 2063 |
| 271 | Ga0068852_100761296 | 3300005616 | Bacteria | 981 |
| 272 | Ga0068859_100002669 | 3300005617 | Bacteria | 18110 |
| 273 | Ga0068859_100128259 | 3300005617 | Bacteria | 2607 |
| 274 | Ga0068859_100160182 | 3300005617 | Bacteria | 2329 |
| 275 | Ga0068859_100307837 | 3300005617 | Bacteria | 1678 |
| 276 | Ga0068859_100420487 | 3300005617 | Bacteria | 1433 |
| 277 | Ga0068859_100982350 | 3300005617 | Unclassified | 927 |
| 278 | Ga0068859_101774045 | 3300005617 | Unclassified | 682 |
| 279 | Ga0068864_100040716 | 3300005618 | Bacteria | 3974 |
| 280 | Ga0068864_100167280 | 3300005618 | Bacteria | 2002 |
| 281 | Ga0068864_100320508 | 3300005618 | Bacteria | 1456 |
| 282 | Ga0068864_100804435 | 3300005618 | Bacteria | 924 |
| 283 | Ga0068864_100892196 | 3300005618 | Bacteria | 878 |
| 284 | Ga0068866_10028362 | 3300005718 | Bacteria | 2667 |
| 285 | Ga0068866_10039065 | 3300005718 | Unclassified | 2342 |
| 286 | Ga0068866_10160996 | 3300005718 | Bacteria | 1309 |
| 287 | Ga0068866_10731106 | 3300005718 | Bacteria | 682 |
| 288 | Ga0068861_100023735 | 3300005719 | Bacteria | 4428 |
| 289 | Ga0068861_100038017 | 3300005719 | Bacteria | 3580 |
| 290 | Ga0068861_100204237 | 3300005719 | Bacteria | 1660 |
| 291 | Ga0068861_100410940 | 3300005719 | Bacteria | 1203 |
| 292 | Ga0068861_100743154 | 3300005719 | Bacteria | 916 |
| 293 | Ga0068861_100842988 | 3300005719 | Bacteria | 863 |
| 294 | Ga0068861_101302462 | 3300005719 | Bacteria | 706 |
| 295 | Ga0068861_101750132 | 3300005719 | Bacteria | 616 |
| 296 | Ga0068861_101831395 | 3300005719 | Bacteria | 602 |
| 297 | Ga0068851_10324873 | 3300005834 | Unclassified | 890 |
| 298 | Ga0068870_10397874 | 3300005840 | Unclassified | 896 |
| 299 | Ga0068863_100040460 | 3300005841 | Bacteria | 4432 |
| 300 | Ga0068863_100227413 | 3300005841 | Unclassified | 1799 |
| 301 | Ga0068863_100343678 | 3300005841 | Bacteria | 1452 |
| 302 | Ga0068863_100616346 | 3300005841 | Unclassified | 1075 |
| 303 | Ga0068858_100006376 | 3300005842 | Bacteria | 11491 |
| 304 | Ga0068858_100008903 | 3300005842 | Bacteria | 9623 |
| 305 | Ga0068858_100097573 | 3300005842 | Bacteria | 2739 |
| 306 | Ga0068858_100159796 | 3300005842 | Bacteria | 2122 |
| 307 | Ga0068858_100392959 | 3300005842 | Bacteria | 1332 |
| 308 | Ga0068858_100482562 | 3300005842 | Bacteria | 1196 |
| 309 | Ga0068858_100728342 | 3300005842 | Bacteria | 966 |
| 310 | Ga0068858_101318240 | 3300005842 | Bacteria | 711 |
| 311 | Ga0068860_100137960 | 3300005843 | Bacteria | 2343 |
| 312 | Ga0068860_100351429 | 3300005843 | Unclassified | 1451 |
| 313 | Ga0068860_100440932 | 3300005843 | Bacteria | 1293 |
| 314 | Ga0068860_100764109 | 3300005843 | Bacteria | 979 |
| 315 | Ga0068860_101159720 | 3300005843 | Bacteria | 793 |
| 316 | Ga0068860_101219834 | 3300005843 | Bacteria | 773 |
| 317 | Ga0068860_101751843 | 3300005843 | Bacteria | 643 |
| 318 | Ga0068862_100007706 | 3300005844 | Bacteria | 8906 |
| 319 | Ga0068862_100023168 | 3300005844 | Bacteria | 5199 |
| 320 | Ga0068862_100050972 | 3300005844 | Bacteria | 3539 |
| 321 | Ga0068862_100135111 | 3300005844 | Bacteria | 2185 |
| 322 | Ga0068862_100167788 | 3300005844 | Bacteria | 1963 |
| 323 | Ga0068862_100415906 | 3300005844 | Bacteria | 1260 |
| 324 | Ga0068862_100599307 | 3300005844 | Bacteria | 1057 |
| 325 | Ga0068862_100963408 | 3300005844 | Bacteria | 842 |
| 326 | Ga0068862_101190193 | 3300005844 | Bacteria | 760 |
| 327 | Ga0068862_101281063 | 3300005844 | Bacteria | 734 |
| 328 | Ga0081455_10337282 | 3300005937 | Bacteria | 1068 |
| 329 | Ga0081539_10006423 | 3300005985 | Bacteria | 11288 |
| 330 | Ga0081539_10059806 | 3300005985 | Bacteria | 2095 |
| 331 | Ga0081539_10100662 | 3300005985 | Unclassified | 1474 |
| 332 | Ga0070716_100041497 | 3300006173 | Bacteria | 2564 |
| 333 | Ga0070716_100093604 | 3300006173 | Bacteria | 1825 |
| 334 | Ga0070716_101371777 | 3300006173 | Bacteria | 574 |
| 335 | Ga0070712_100096486 | 3300006175 | Unclassified | 2177 |
| 336 | Ga0070712_100273531 | 3300006175 | Bacteria | 1358 |
| 337 | Ga0097621_100000491 | 3300006237 | Bacteria | 27694 |
| 338 | Ga0097621_100003090 | 3300006237 | Bacteria | 11416 |
| 339 | Ga0097621_100020345 | 3300006237 | Bacteria | 5113 |
| 340 | Ga0097621_100201459 | 3300006237 | Bacteria | 1728 |
| 341 | Ga0097621_100276077 | 3300006237 | Bacteria | 1478 |
| 342 | Ga0097621_101280509 | 3300006237 | Archaea | 692 |
| 343 | Ga0068871_100001107 | 3300006358 | Bacteria | 18079 |
| 344 | Ga0068871_100010512 | 3300006358 | Bacteria | 6759 |
| 345 | Ga0068871_100089251 | 3300006358 | Bacteria | 2566 |
| 346 | Ga0068871_100242880 | 3300006358 | Unclassified | 1566 |
| 347 | Ga0068871_100291792 | 3300006358 | Bacteria | 1429 |
| 348 | Ga0068871_100400444 | 3300006358 | Bacteria | 1222 |
| 349 | Ga0068871_100538957 | 3300006358 | Bacteria | 1056 |
| 350 | Ga0075428_100003764 | 3300006844 | Bacteria | 16622 |
| 351 | Ga0075428_100008503 | 3300006844 | Bacteria | 11385 |
| 352 | Ga0075428_100029789 | 3300006844 | Bacteria | 6038 |
| 353 | Ga0075428_100070369 | 3300006844 | Bacteria | 3825 |
| 354 | Ga0075428_100081829 | 3300006844 | Bacteria | 3523 |
| 355 | Ga0075428_100117167 | 3300006844 | Bacteria | 2901 |
| 356 | Ga0075428_100698484 | 3300006844 | Unclassified | 1081 |
| 357 | Ga0075428_100926372 | 3300006844 | Unclassified | 924 |
| 358 | Ga0075428_101725272 | 3300006844 | Bacteria | 653 |
| 359 | Ga0075430_100002827 | 3300006846 | Bacteria | 14521 |
| 360 | Ga0075430_100009055 | 3300006846 | Bacteria | 8414 |
| 361 | Ga0075430_100025724 | 3300006846 | Bacteria | 5008 |
| 362 | Ga0075430_100168996 | 3300006846 | Bacteria | 1819 |
| 363 | Ga0075430_100423544 | 3300006846 | Unclassified | 1099 |
| 364 | Ga0075430_100535947 | 3300006846 | Bacteria | 965 |
| 365 | Ga0075430_101643218 | 3300006846 | Bacteria | 527 |
| 366 | Ga0075431_100002521 | 3300006847 | Bacteria | 17661 |
| 367 | Ga0075431_100043740 | 3300006847 | Bacteria | 4620 |
| 368 | Ga0075431_100203614 | 3300006847 | Bacteria | 2024 |
| 369 | Ga0075431_100390085 | 3300006847 | Bacteria | 1395 |
| 370 | Ga0075431_100399090 | 3300006847 | Unclassified | 1376 |
| 371 | Ga0075431_101340746 | 3300006847 | Bacteria | 676 |
| 372 | Ga0075433_10000719 | 3300006852 | Bacteria | 22669 |
| 373 | Ga0075433_10003035 | 3300006852 | Bacteria | 12898 |
| 374 | Ga0075433_10046914 | 3300006852 | Bacteria | 3758 |
| 375 | Ga0075433_10344894 | 3300006852 | Bacteria | 1316 |
| 376 | Ga0075433_11372447 | 3300006852 | Unclassified | 612 |
| 377 | Ga0075434_100009384 | 3300006871 | Bacteria | 9118 |
| 378 | Ga0075434_100011803 | 3300006871 | Bacteria | 8253 |
| 379 | Ga0075434_100014191 | 3300006871 | Bacteria | 7611 |
| 380 | Ga0075434_100019206 | 3300006871 | Bacteria | 6612 |
| 381 | Ga0075434_100042252 | 3300006871 | Bacteria | 4519 |
| 382 | Ga0075434_100091844 | 3300006871 | Bacteria | 3038 |
| 383 | Ga0075434_100101935 | 3300006871 | Bacteria | 2878 |
| 384 | Ga0075434_100485330 | 3300006871 | Bacteria | 1257 |
| 385 | Ga0075434_100588711 | 3300006871 | Bacteria | 1132 |
| 386 | Ga0075434_101053817 | 3300006871 | Bacteria | 827 |
| 387 | Ga0075429_100003842 | 3300006880 | Bacteria | 12830 |
| 388 | Ga0075429_100005497 | 3300006880 | Bacteria | 10909 |
| 389 | Ga0075429_100184095 | 3300006880 | Bacteria | 1830 |
| 390 | Ga0075429_100493860 | 3300006880 | Bacteria | 1072 |
| 391 | Ga0075429_100680130 | 3300006880 | Bacteria | 902 |
| 392 | Ga0075429_101696492 | 3300006880 | Bacteria | 549 |
| 393 | Ga0068865_100022104 | 3300006881 | Bacteria | 4143 |
| 394 | Ga0068865_100033189 | 3300006881 | Bacteria | 3454 |
| 395 | Ga0068865_100294951 | 3300006881 | Unclassified | 1296 |
| 396 | Ga0068865_100383542 | 3300006881 | Bacteria | 1147 |
| 397 | Ga0075436_100014387 | 3300006914 | Bacteria | 5416 |
| 398 | Ga0075436_100017806 | 3300006914 | Bacteria | 4865 |
| 399 | Ga0075436_100081102 | 3300006914 | Archaea | 2249 |
| 400 | Ga0075436_100085555 | 3300006914 | Bacteria | 2189 |
| 401 | Ga0075436_100261237 | 3300006914 | Unclassified | 1235 |
| 402 | Ga0097620_100002669 | 3300006931 | Bacteria | 18110 |
| 403 | Ga0097620_100128263 | 3300006931 | Bacteria | 2607 |
| 404 | Ga0097620_100160182 | 3300006931 | Bacteria | 2329 |
| 405 | Ga0097620_100307833 | 3300006931 | Bacteria | 1678 |
| 406 | Ga0097620_100420494 | 3300006931 | Bacteria | 1433 |
| 407 | Ga0097620_100982294 | 3300006931 | Unclassified | 927 |
| 408 | Ga0097620_101774014 | 3300006931 | Unclassified | 682 |
| 409 | Ga0075435_100007120 | 3300007076 | Bacteria | 7944 |
| 410 | Ga0075435_100024515 | 3300007076 | Bacteria | 4684 |
| 411 | Ga0075435_100025018 | 3300007076 | Bacteria | 4642 |
| 412 | Ga0075435_100035427 | 3300007076 | Bacteria | 3961 |
| 413 | Ga0075435_100060351 | 3300007076 | Bacteria | 3075 |
| 414 | Ga0075435_100420801 | 3300007076 | Bacteria | 1150 |
| 415 | Ga0099794_10064534 | 3300007265 | Bacteria | 1784 |
| 416 | Ga0105240_10011543 | 3300009093 | Bacteria | 12296 |
| 417 | Ga0105240_10130144 | 3300009093 | Bacteria | 3020 |
| 418 | Ga0111539_10001096 | 3300009094 | Bacteria | 35773 |
| 419 | Ga0111539_10001535 | 3300009094 | Bacteria | 30735 |
| 420 | Ga0111539_10002877 | 3300009094 | Bacteria | 22849 |
| 421 | Ga0111539_10004585 | 3300009094 | Bacteria | 18059 |
| 422 | Ga0111539_10007218 | 3300009094 | Bacteria | 14240 |
| 423 | Ga0111539_10021062 | 3300009094 | Bacteria | 8030 |
| 424 | Ga0111539_10021248 | 3300009094 | Bacteria | 7992 |
| 425 | Ga0111539_10040375 | 3300009094 | Bacteria | 5618 |
| 426 | Ga0111539_10223930 | 3300009094 | Bacteria | 2191 |
| 427 | Ga0111539_10464300 | 3300009094 | Bacteria | 1474 |
| 428 | Ga0111539_10635646 | 3300009094 | Bacteria | 1243 |
| 429 | Ga0111539_11087557 | 3300009094 | Bacteria | 929 |
| 430 | Ga0111539_11087991 | 3300009094 | Bacteria | 929 |
| 431 | Ga0111539_11236344 | 3300009094 | Bacteria | 867 |
| 432 | Ga0111539_11252228 | 3300009094 | Unclassified | 861 |
| 433 | Ga0105245_10408947 | 3300009098 | Bacteria | 1358 |
| 434 | Ga0105245_10513788 | 3300009098 | Bacteria | 1215 |
| 435 | Ga0105245_11813368 | 3300009098 | Bacteria | 663 |
| 436 | Ga0105247_10003746 | 3300009101 | Bacteria | 9860 |
| 437 | Ga0105247_11147469 | 3300009101 | Bacteria | 616 |
| 438 | Ga0105247_11323955 | 3300009101 | Unclassified | 579 |
| 439 | Ga0114129_10003005 | 3300009147 | Bacteria | 23633 |
| 440 | Ga0114129_10009590 | 3300009147 | Bacteria | 13809 |
| 441 | Ga0114129_10034096 | 3300009147 | Bacteria | 7191 |
| 442 | Ga0114129_10044082 | 3300009147 | Bacteria | 6275 |
| 443 | Ga0114129_10196868 | 3300009147 | Unclassified | 2732 |
| 444 | Ga0114129_10255349 | 3300009147 | Bacteria | 2352 |
| 445 | Ga0114129_10341284 | 3300009147 | Bacteria | 1987 |
| 446 | Ga0114129_10373398 | 3300009147 | Bacteria | 1884 |
| 447 | Ga0114129_10633000 | 3300009147 | Unclassified | 1382 |
| 448 | Ga0114129_10765889 | 3300009147 | Unclassified | 1234 |
| 449 | Ga0114129_10876055 | 3300009147 | Bacteria | 1139 |
| 450 | Ga0114129_11368504 | 3300009147 | Unclassified | 875 |
| 451 | Ga0114129_11563707 | 3300009147 | Bacteria | 808 |
| 452 | Ga0105243_10005747 | 3300009148 | Bacteria | 9634 |
| 453 | Ga0105243_10521592 | 3300009148 | Unclassified | 1130 |
| 454 | Ga0105243_10632245 | 3300009148 | Bacteria | 1035 |
| 455 | Ga0105243_10768920 | 3300009148 | Bacteria | 946 |
| 456 | Ga0105241_10016789 | 3300009174 | Bacteria | 5373 |
| 457 | Ga0105241_10854544 | 3300009174 | Bacteria | 842 |
| 458 | Ga0105241_11263399 | 3300009174 | Unclassified | 702 |
| 459 | Ga0105242_10014745 | 3300009176 | Bacteria | 6053 |
| 460 | Ga0105242_10049063 | 3300009176 | Bacteria | 3434 |
| 461 | Ga0105242_10178766 | 3300009176 | Bacteria | 1871 |
| 462 | Ga0105242_11163647 | 3300009176 | Bacteria | 789 |
| 463 | Ga0105242_12412189 | 3300009176 | Bacteria | 573 |
| 464 | Ga0105248_10025874 | 3300009177 | Bacteria | 6528 |
| 465 | Ga0105248_10051241 | 3300009177 | Bacteria | 4632 |
| 466 | Ga0105248_10058517 | 3300009177 | Bacteria | 4328 |
| 467 | Ga0105248_10065729 | 3300009177 | Bacteria | 4072 |
| 468 | Ga0105248_10662131 | 3300009177 | Bacteria | 1178 |
| 469 | Ga0105248_11382836 | 3300009177 | Bacteria | 796 |
| 470 | Ga0105248_11562907 | 3300009177 | Unclassified | 747 |
| 471 | Ga0105248_11688599 | 3300009177 | Bacteria | 718 |
| 472 | Ga0105237_11681099 | 3300009545 | Unclassified | 642 |
| 473 | Ga0105238_10012691 | 3300009551 | Bacteria | 8503 |
| 474 | Ga0105238_10724325 | 3300009551 | Bacteria | 1007 |
| 475 | Ga0105249_10056160 | 3300009553 | Bacteria | 3604 |
| 476 | Ga0105249_10064382 | 3300009553 | Unclassified | 3370 |
| 477 | Ga0105249_10234697 | 3300009553 | Bacteria | 1810 |
| 478 | Ga0105249_10655349 | 3300009553 | Unclassified | 1108 |
| 479 | Ga0105249_10950119 | 3300009553 | Bacteria | 927 |
| 480 | Ga0105249_11615739 | 3300009553 | Unclassified | 721 |
| 481 | Ga0105249_11674273 | 3300009553 | Unclassified | 709 |
| 482 | Ga0105249_12884872 | 3300009553 | Bacteria | 552 |
| 483 | Ga0105249_12992665 | 3300009553 | Bacteria | 543 |
| 484 | Ga0105239_11456264 | 3300010375 | Bacteria | 791 |
| 485 | Ga0105246_10360153 | 3300011119 | Bacteria | 1195 |
| 486 | Ga0105246_10424975 | 3300011119 | Bacteria | 1110 |
| 487 | Ga0157315_1020076 | 3300012508 | Unclassified | 698 |
| 488 | Ga0157370_10403321 | 3300013104 | Unclassified | 1258 |
| 489 | Ga0157369_11541658 | 3300013105 | Unclassified | 676 |
| 490 | Ga0157374_10275837 | 3300013296 | Bacteria | 1659 |
| 491 | Ga0157374_10367168 | 3300013296 | Bacteria | 1432 |
| 492 | Ga0157378_12002953 | 3300013297 | Bacteria | 629 |
| 493 | Ga0163162_10034885 | 3300013306 | Bacteria | 5008 |
| 494 | Ga0163162_10173920 | 3300013306 | Bacteria | 2278 |
| 495 | Ga0163162_10869929 | 3300013306 | Bacteria | 1016 |
| 496 | Ga0163162_11148816 | 3300013306 | Bacteria | 881 |
| 497 | Ga0157372_10190407 | 3300013307 | Bacteria | 2376 |
| 498 | Ga0157375_10066455 | 3300013308 | Bacteria | 3600 |
| 499 | Ga0157375_10070818 | 3300013308 | Bacteria | 3498 |
| 500 | Ga0157375_10136534 | 3300013308 | Bacteria | 2577 |
| 501 | Ga0157375_10500098 | 3300013308 | Unclassified | 1380 |
| 502 | Ga0157375_10740713 | 3300013308 | Bacteria | 1135 |
| 503 | Ga0157375_11099477 | 3300013308 | Bacteria | 930 |
| 504 | Ga0157375_11348247 | 3300013308 | Unclassified | 840 |
| 505 | Ga0163163_10049669 | 3300014325 | Bacteria | 4128 |
| 506 | Ga0163163_10213898 | 3300014325 | Bacteria | 1977 |
| 507 | Ga0163163_10261905 | 3300014325 | Bacteria | 1780 |
| 508 | Ga0163163_11444192 | 3300014325 | Bacteria | 749 |
| 509 | Ga0157380_10007481 | 3300014326 | Bacteria | 7754 |
| 510 | Ga0157380_10013472 | 3300014326 | Bacteria | 5962 |
| 511 | Ga0157380_10086536 | 3300014326 | Bacteria | 2575 |
| 512 | Ga0157380_10092262 | 3300014326 | Bacteria | 2502 |
| 513 | Ga0157380_10095680 | 3300014326 | Bacteria | 2461 |
| 514 | Ga0157380_10353092 | 3300014326 | Bacteria | 1377 |
| 515 | Ga0157380_10605065 | 3300014326 | Unclassified | 1085 |
| 516 | Ga0157380_10709760 | 3300014326 | Bacteria | 1012 |
| 517 | Ga0157380_10763339 | 3300014326 | Bacteria | 980 |
| 518 | Ga0157380_10777990 | 3300014326 | Bacteria | 972 |
| 519 | Ga0157380_11430781 | 3300014326 | Unclassified | 742 |
| 520 | Ga0157380_12140741 | 3300014326 | Bacteria | 623 |
| 521 | Ga0157377_10011536 | 3300014745 | Bacteria | 4414 |
| 522 | Ga0157377_10031760 | 3300014745 | Bacteria | 2872 |
| 523 | Ga0157377_10220772 | 3300014745 | Bacteria | 1213 |
| 524 | Ga0157377_10319348 | 3300014745 | Bacteria | 1031 |
| 525 | Ga0157377_10328638 | 3300014745 | Bacteria | 1018 |
| 526 | Ga0157377_10340699 | 3300014745 | Unclassified | 1002 |
| 527 | Ga0157379_10005722 | 3300014968 | Bacteria | 10693 |
| 528 | Ga0157379_10048906 | 3300014968 | Bacteria | 3775 |
| 529 | Ga0157379_10067766 | 3300014968 | Bacteria | 3190 |
| 530 | Ga0157379_10116343 | 3300014968 | Bacteria | 2404 |
| 531 | Ga0157379_10500991 | 3300014968 | Archaea | 1126 |
| 532 | Ga0157379_10971797 | 3300014968 | Bacteria | 808 |
| 533 | Ga0157376_10140572 | 3300014969 | Unclassified | 2165 |
| 534 | Ga0157376_10154267 | 3300014969 | Bacteria | 2074 |
| 535 | Ga0157376_10693536 | 3300014969 | Unclassified | 1023 |
| 536 | Ga0157376_12272039 | 3300014969 | Bacteria | 581 |
| 537 | Ga0182005_1245895 | 3300015265 | Bacteria | 552 |
| 538 | Ga0163161_10054592 | 3300017792 | Unclassified | 2899 |
| 539 | Ga0163161_10558140 | 3300017792 | Bacteria | 939 |
| 540 | Ga0207673_1004444 | 3300025290 | Bacteria | 1678 |
| 541 | Ga0207697_10006229 | 3300025315 | Bacteria | 5424 |
| 542 | Ga0207697_10014857 | 3300025315 | Bacteria | 3225 |
| 543 | Ga0207697_10057159 | 3300025315 | Unclassified | 1619 |
| 544 | Ga0207697_10062782 | 3300025315 | Bacteria | 1548 |
| 545 | Ga0207697_10100761 | 3300025315 | Bacteria | 1231 |
| 546 | Ga0207697_10110133 | 3300025315 | Bacteria | 1179 |
| 547 | Ga0207653_10042479 | 3300025885 | Bacteria | 1496 |
| 548 | Ga0207682_10025689 | 3300025893 | Bacteria | 2336 |
| 549 | Ga0207682_10044666 | 3300025893 | Bacteria | 1817 |
| 550 | Ga0207682_10084505 | 3300025893 | Bacteria | 1366 |
| 551 | Ga0207682_10100194 | 3300025893 | Unclassified | 1266 |
| 552 | Ga0207682_10586084 | 3300025893 | Unclassified | 526 |
| 553 | Ga0207642_10015048 | 3300025899 | Bacteria | 2872 |
| 554 | Ga0207642_10084503 | 3300025899 | Bacteria | 1550 |
| 555 | Ga0207642_10193415 | 3300025899 | Bacteria | 1118 |
| 556 | Ga0207642_10420664 | 3300025899 | Unclassified | 804 |
| 557 | Ga0207710_10005377 | 3300025900 | Bacteria | 5525 |
| 558 | Ga0207710_10012471 | 3300025900 | Bacteria | 3576 |
| 559 | Ga0207688_10001167 | 3300025901 | Bacteria | 13553 |
| 560 | Ga0207688_10197285 | 3300025901 | Unclassified | 1206 |
| 561 | Ga0207688_10331306 | 3300025901 | Unclassified | 935 |
| 562 | Ga0207688_10922933 | 3300025901 | Bacteria | 553 |
| 563 | Ga0207680_10136487 | 3300025903 | Bacteria | 1622 |
| 564 | Ga0207680_10200845 | 3300025903 | Bacteria | 1358 |
| 565 | Ga0207680_10575620 | 3300025903 | Bacteria | 805 |
| 566 | Ga0207645_10006799 | 3300025907 | Bacteria | 8164 |
| 567 | Ga0207645_10011628 | 3300025907 | Bacteria | 6003 |
| 568 | Ga0207645_10035884 | 3300025907 | Unclassified | 3183 |
| 569 | Ga0207645_10147272 | 3300025907 | Bacteria | 1536 |
| 570 | Ga0207645_10262055 | 3300025907 | Bacteria | 1145 |
| 571 | Ga0207645_10270858 | 3300025907 | Unclassified | 1126 |
| 572 | Ga0207643_10000421 | 3300025908 | Bacteria | 28011 |
| 573 | Ga0207643_10003973 | 3300025908 | Bacteria | 7961 |
| 574 | Ga0207643_10031908 | 3300025908 | Bacteria | 2939 |
| 575 | Ga0207643_10062430 | 3300025908 | Bacteria | 2129 |
| 576 | Ga0207643_10137132 | 3300025908 | Bacteria | 1459 |
| 577 | Ga0207643_10225562 | 3300025908 | Bacteria | 1148 |
| 578 | Ga0207643_10974830 | 3300025908 | Bacteria | 549 |
| 579 | Ga0207705_10116108 | 3300025909 | Bacteria | 1982 |
| 580 | Ga0207684_10086680 | 3300025910 | Bacteria | 2667 |
| 581 | Ga0207684_10231337 | 3300025910 | Bacteria | 1595 |
| 582 | Ga0207684_10355065 | 3300025910 | Bacteria | 1262 |
| 583 | Ga0207684_10518406 | 3300025910 | Bacteria | 1021 |
| 584 | Ga0207654_10018539 | 3300025911 | Bacteria | 3654 |
| 585 | Ga0207654_10427680 | 3300025911 | Bacteria | 925 |
| 586 | Ga0207654_10811664 | 3300025911 | Unclassified | 676 |
| 587 | Ga0207707_10069371 | 3300025912 | Bacteria | 3072 |
| 588 | Ga0207695_10035464 | 3300025913 | Bacteria | 5409 |
| 589 | Ga0207695_10073089 | 3300025913 | Bacteria | 3495 |
| 590 | Ga0207695_10385596 | 3300025913 | Bacteria | 1286 |
| 591 | Ga0207693_10176989 | 3300025915 | Bacteria | 1678 |
| 592 | Ga0207693_10199072 | 3300025915 | Bacteria | 1575 |
| 593 | Ga0207660_10045755 | 3300025917 | Bacteria | 3084 |
| 594 | Ga0207660_10402687 | 3300025917 | Bacteria | 1102 |
| 595 | Ga0207662_10008088 | 3300025918 | Bacteria | 5743 |
| 596 | Ga0207662_10085309 | 3300025918 | Bacteria | 1934 |
| 597 | Ga0207662_10576440 | 3300025918 | Bacteria | 781 |
| 598 | Ga0207662_10596891 | 3300025918 | Bacteria | 768 |
| 599 | Ga0207657_10000448 | 3300025919 | Bacteria | 43812 |
| 600 | Ga0207657_10622168 | 3300025919 | Bacteria | 842 |
| 601 | Ga0207649_10034873 | 3300025920 | Bacteria | 3018 |
| 602 | Ga0207649_10690565 | 3300025920 | Unclassified | 791 |
| 603 | Ga0207649_10808486 | 3300025920 | Unclassified | 732 |
| 604 | Ga0207649_10818863 | 3300025920 | Bacteria | 727 |
| 605 | Ga0207649_11101091 | 3300025920 | Bacteria | 627 |
| 606 | Ga0207652_10074593 | 3300025921 | Bacteria | 2954 |
| 607 | Ga0207652_10147531 | 3300025921 | Bacteria | 2106 |
| 608 | Ga0207646_10063922 | 3300025922 | Bacteria | 3285 |
| 609 | Ga0207646_10402679 | 3300025922 | Bacteria | 1236 |
| 610 | Ga0207681_10014493 | 3300025923 | Bacteria | 4900 |
| 611 | Ga0207681_10014583 | 3300025923 | Bacteria | 4889 |
| 612 | Ga0207681_10022470 | 3300025923 | Bacteria | 4023 |
| 613 | Ga0207681_10027511 | 3300025923 | Bacteria | 3678 |
| 614 | Ga0207681_10055231 | 3300025923 | Bacteria | 2704 |
| 615 | Ga0207681_10187241 | 3300025923 | Unclassified | 1581 |
| 616 | Ga0207681_10267567 | 3300025923 | Bacteria | 1340 |
| 617 | Ga0207681_10526870 | 3300025923 | Bacteria | 970 |
| 618 | Ga0207681_10574473 | 3300025923 | Bacteria | 929 |
| 619 | Ga0207681_10883352 | 3300025923 | Unclassified | 748 |
| 620 | Ga0207681_11226757 | 3300025923 | Bacteria | 630 |
| 621 | Ga0207681_11234983 | 3300025923 | Unclassified | 628 |
| 622 | Ga0207694_10075167 | 3300025924 | Bacteria | 2644 |
| 623 | Ga0207694_11103807 | 3300025924 | Bacteria | 671 |
| 624 | Ga0207650_10023131 | 3300025925 | Unclassified | 4406 |
| 625 | Ga0207650_10110013 | 3300025925 | Bacteria | 2131 |
| 626 | Ga0207650_10218521 | 3300025925 | Unclassified | 1533 |
| 627 | Ga0207650_10535292 | 3300025925 | Bacteria | 981 |
| 628 | Ga0207659_10014101 | 3300025926 | Bacteria | 5146 |
| 629 | Ga0207659_10082191 | 3300025926 | Bacteria | 2384 |
| 630 | Ga0207659_10107886 | 3300025926 | Unclassified | 2111 |
| 631 | Ga0207659_10117411 | 3300025926 | Bacteria | 2033 |
| 632 | Ga0207659_10249523 | 3300025926 | Unclassified | 1439 |
| 633 | Ga0207659_10279966 | 3300025926 | Bacteria | 1363 |
| 634 | Ga0207659_10299663 | 3300025926 | Bacteria | 1320 |
| 635 | Ga0207687_10180945 | 3300025927 | Bacteria | 1633 |
| 636 | Ga0207687_10727635 | 3300025927 | Bacteria | 843 |
| 637 | Ga0207687_10850048 | 3300025927 | Bacteria | 780 |
| 638 | Ga0207644_10890390 | 3300025931 | Bacteria | 746 |
| 639 | Ga0207690_10073740 | 3300025932 | Unclassified | 2362 |
| 640 | Ga0207706_10013947 | 3300025933 | Bacteria | 7287 |
| 641 | Ga0207706_10016745 | 3300025933 | Bacteria | 6617 |
| 642 | Ga0207706_10078833 | 3300025933 | Unclassified | 2897 |
| 643 | Ga0207706_10094059 | 3300025933 | Bacteria | 2636 |
| 644 | Ga0207686_10008837 | 3300025934 | Bacteria | 5447 |
| 645 | Ga0207686_10019187 | 3300025934 | Bacteria | 3884 |
| 646 | Ga0207709_10108784 | 3300025935 | Unclassified | 1849 |
| 647 | Ga0207709_10148014 | 3300025935 | Bacteria | 1623 |
| 648 | Ga0207709_10197562 | 3300025935 | Bacteria | 1434 |
| 649 | Ga0207709_10736745 | 3300025935 | Bacteria | 791 |
| 650 | Ga0207670_10093496 | 3300025936 | Bacteria | 2131 |
| 651 | Ga0207670_10098961 | 3300025936 | Unclassified | 2079 |
| 652 | Ga0207670_10167320 | 3300025936 | Unclassified | 1645 |
| 653 | Ga0207670_10216198 | 3300025936 | Bacteria | 1464 |
| 654 | Ga0207670_10270448 | 3300025936 | Unclassified | 1321 |
| 655 | Ga0207670_10440253 | 3300025936 | Bacteria | 1049 |
| 656 | Ga0207669_10004678 | 3300025937 | Bacteria | 6053 |
| 657 | Ga0207669_10063861 | 3300025937 | Unclassified | 2275 |
| 658 | Ga0207669_10075630 | 3300025937 | Bacteria | 2134 |
| 659 | Ga0207669_10118812 | 3300025937 | Bacteria | 1790 |
| 660 | Ga0207669_10163537 | 3300025937 | Unclassified | 1575 |
| 661 | Ga0207669_10377140 | 3300025937 | Unclassified | 1104 |
| 662 | Ga0207669_11131837 | 3300025937 | Unclassified | 661 |
| 663 | Ga0207704_10001915 | 3300025938 | Bacteria | 9328 |
| 664 | Ga0207704_10046592 | 3300025938 | Bacteria | 2585 |
| 665 | Ga0207704_10052554 | 3300025938 | Bacteria | 2471 |
| 666 | Ga0207704_10599289 | 3300025938 | Bacteria | 902 |
| 667 | Ga0207704_10773359 | 3300025938 | Bacteria | 800 |
| 668 | Ga0207665_10059331 | 3300025939 | Bacteria | 2589 |
| 669 | Ga0207665_10123932 | 3300025939 | Bacteria | 1828 |
| 670 | Ga0207691_10011048 | 3300025940 | Bacteria | 8665 |
| 671 | Ga0207691_10037771 | 3300025940 | Bacteria | 4470 |
| 672 | Ga0207691_10052143 | 3300025940 | Bacteria | 3737 |
| 673 | Ga0207691_10058452 | 3300025940 | Bacteria | 3507 |
| 674 | Ga0207691_10101756 | 3300025940 | Bacteria | 2563 |
| 675 | Ga0207691_10192560 | 3300025940 | Bacteria | 1778 |
| 676 | Ga0207691_10220937 | 3300025940 | Bacteria | 1643 |
| 677 | Ga0207691_10232816 | 3300025940 | Unclassified | 1595 |
| 678 | Ga0207691_10265102 | 3300025940 | Unclassified | 1480 |
| 679 | Ga0207691_10920530 | 3300025940 | Bacteria | 731 |
| 680 | Ga0207711_10026694 | 3300025941 | Bacteria | 4848 |
| 681 | Ga0207711_10171150 | 3300025941 | Bacteria | 1971 |
| 682 | Ga0207711_10212815 | 3300025941 | Bacteria | 1766 |
| 683 | Ga0207711_10248831 | 3300025941 | Bacteria | 1632 |
| 684 | Ga0207711_11329138 | 3300025941 | Unclassified | 661 |
| 685 | Ga0207689_10009631 | 3300025942 | Bacteria | 8328 |
| 686 | Ga0207689_10012411 | 3300025942 | Bacteria | 7285 |
| 687 | Ga0207689_10032193 | 3300025942 | Bacteria | 4362 |
| 688 | Ga0207689_10365702 | 3300025942 | Bacteria | 1200 |
| 689 | Ga0207689_10426007 | 3300025942 | Unclassified | 1108 |
| 690 | Ga0207661_10098762 | 3300025944 | Bacteria | 2447 |
| 691 | Ga0207679_10007458 | 3300025945 | Bacteria | 6940 |
| 692 | Ga0207679_10021997 | 3300025945 | Bacteria | 4335 |
| 693 | Ga0207679_10106162 | 3300025945 | Unclassified | 2207 |
| 694 | Ga0207679_10196205 | 3300025945 | Unclassified | 1683 |
| 695 | Ga0207679_10306941 | 3300025945 | Unclassified | 1370 |
| 696 | Ga0207679_10594375 | 3300025945 | Unclassified | 997 |
| 697 | Ga0207679_10710492 | 3300025945 | Unclassified | 912 |
| 698 | Ga0207667_10131023 | 3300025949 | Bacteria | 2583 |
| 699 | Ga0207667_10519938 | 3300025949 | Unclassified | 1206 |
| 700 | Ga0207667_11983907 | 3300025949 | Unclassified | 542 |
| 701 | Ga0207651_10026837 | 3300025960 | Bacteria | 3606 |
| 702 | Ga0207651_10045179 | 3300025960 | Bacteria | 2953 |
| 703 | Ga0207651_10048143 | 3300025960 | Bacteria | 2880 |
| 704 | Ga0207651_10196938 | 3300025960 | Bacteria | 1611 |
| 705 | Ga0207651_10359114 | 3300025960 | Bacteria | 1229 |
| 706 | Ga0207651_10566373 | 3300025960 | Bacteria | 989 |
| 707 | Ga0207712_10727976 | 3300025961 | Bacteria | 868 |
| 708 | Ga0207712_11686813 | 3300025961 | Bacteria | 568 |
| 709 | Ga0207712_11863022 | 3300025961 | Bacteria | 539 |
| 710 | Ga0207668_10039855 | 3300025972 | Bacteria | 3166 |
| 711 | Ga0207668_10123390 | 3300025972 | Bacteria | 1965 |
| 712 | Ga0207668_10177611 | 3300025972 | Bacteria | 1676 |
| 713 | Ga0207668_10179344 | 3300025972 | Unclassified | 1669 |
| 714 | Ga0207668_10372496 | 3300025972 | Bacteria | 1200 |
| 715 | Ga0207668_10669683 | 3300025972 | Bacteria | 910 |
| 716 | Ga0207640_10009623 | 3300025981 | Bacteria | 5419 |
| 717 | Ga0207640_10485473 | 3300025981 | Unclassified | 1026 |
| 718 | Ga0207640_10536156 | 3300025981 | Bacteria | 981 |
| 719 | Ga0207640_10880173 | 3300025981 | Bacteria | 781 |
| 720 | Ga0207640_11902215 | 3300025981 | Bacteria | 538 |
| 721 | Ga0207658_10520492 | 3300025986 | Unclassified | 1061 |
| 722 | Ga0207658_10554222 | 3300025986 | Bacteria | 1029 |
| 723 | Ga0207658_10714620 | 3300025986 | Unclassified | 906 |
| 724 | Ga0207658_10824651 | 3300025986 | Archaea | 843 |
| 725 | Ga0207658_11066660 | 3300025986 | Unclassified | 738 |
| 726 | Ga0207677_10118776 | 3300026023 | Bacteria | 1984 |
| 727 | Ga0207677_11499156 | 3300026023 | Unclassified | 623 |
| 728 | Ga0207703_10085378 | 3300026035 | Bacteria | 2641 |
| 729 | Ga0207703_10157010 | 3300026035 | Bacteria | 1989 |
| 730 | Ga0207703_10419059 | 3300026035 | Bacteria | 1245 |
| 731 | Ga0207703_10788649 | 3300026035 | Bacteria | 907 |
| 732 | Ga0207703_10813619 | 3300026035 | Bacteria | 892 |
| 733 | Ga0207639_10161244 | 3300026041 | Bacteria | 1890 |
| 734 | Ga0207639_11013193 | 3300026041 | Unclassified | 778 |
| 735 | Ga0207678_10073614 | 3300026067 | Bacteria | 2928 |
| 736 | Ga0207678_10089975 | 3300026067 | Bacteria | 2623 |
| 737 | Ga0207678_10441441 | 3300026067 | Unclassified | 1130 |
| 738 | Ga0207678_10496826 | 3300026067 | Unclassified | 1063 |
| 739 | Ga0207708_10004076 | 3300026075 | Bacteria | 10744 |
| 740 | Ga0207708_10013130 | 3300026075 | Bacteria | 6182 |
| 741 | Ga0207708_10039098 | 3300026075 | Bacteria | 3614 |
| 742 | Ga0207708_10066324 | 3300026075 | Bacteria | 2760 |
| 743 | Ga0207708_10179488 | 3300026075 | Bacteria | 1681 |
| 744 | Ga0207708_10186032 | 3300026075 | Unclassified | 1651 |
| 745 | Ga0207708_10705813 | 3300026075 | Bacteria | 863 |
| 746 | Ga0207708_11408974 | 3300026075 | Unclassified | 612 |
| 747 | Ga0207641_10142894 | 3300026088 | Bacteria | 2161 |
| 748 | Ga0207641_10437360 | 3300026088 | Bacteria | 1262 |
| 749 | Ga0207641_10546006 | 3300026088 | Unclassified | 1130 |
| 750 | Ga0207648_10000802 | 3300026089 | Bacteria | 35458 |
| 751 | Ga0207648_10017964 | 3300026089 | Bacteria | 6414 |
| 752 | Ga0207648_10073765 | 3300026089 | Bacteria | 2974 |
| 753 | Ga0207648_10142645 | 3300026089 | Unclassified | 2112 |
| 754 | Ga0207648_10160602 | 3300026089 | Bacteria | 1985 |
| 755 | Ga0207648_10307167 | 3300026089 | Bacteria | 1423 |
| 756 | Ga0207648_10351353 | 3300026089 | Bacteria | 1329 |
| 757 | Ga0207648_10503879 | 3300026089 | Bacteria | 1108 |
| 758 | Ga0207648_10624495 | 3300026089 | Unclassified | 995 |
| 759 | Ga0207648_10742489 | 3300026089 | Bacteria | 911 |
| 760 | Ga0207648_10833728 | 3300026089 | Bacteria | 859 |
| 761 | Ga0207648_10931739 | 3300026089 | Unclassified | 812 |
| 762 | Ga0207676_10097975 | 3300026095 | Bacteria | 2423 |
| 763 | Ga0207676_10172785 | 3300026095 | Bacteria | 1884 |
| 764 | Ga0207676_10181467 | 3300026095 | Bacteria | 1843 |
| 765 | Ga0207676_10782536 | 3300026095 | Unclassified | 930 |
| 766 | Ga0207676_10849720 | 3300026095 | Bacteria | 893 |
| 767 | Ga0207674_10076334 | 3300026116 | Bacteria | 3359 |
| 768 | Ga0207674_10172945 | 3300026116 | Unclassified | 2113 |
| 769 | Ga0207674_11073421 | 3300026116 | Bacteria | 774 |
| 770 | Ga0207674_12099102 | 3300026116 | Bacteria | 529 |
| 771 | Ga0207675_100003438 | 3300026118 | Bacteria | 15481 |
| 772 | Ga0207675_100008037 | 3300026118 | Bacteria | 9940 |
| 773 | Ga0207675_100026637 | 3300026118 | Bacteria | 5382 |
| 774 | Ga0207675_100030876 | 3300026118 | Bacteria | 4990 |
| 775 | Ga0207675_100039233 | 3300026118 | Bacteria | 4420 |
| 776 | Ga0207675_100082000 | 3300026118 | Bacteria | 3024 |
| 777 | Ga0207675_100295147 | 3300026118 | Bacteria | 1577 |
| 778 | Ga0207675_100297167 | 3300026118 | Bacteria | 1572 |
| 779 | Ga0207675_100308482 | 3300026118 | Unclassified | 1543 |
| 780 | Ga0207675_100453834 | 3300026118 | Bacteria | 1270 |
| 781 | Ga0207675_101009548 | 3300026118 | Bacteria | 850 |
| 782 | Ga0207683_10042430 | 3300026121 | Bacteria | 3973 |
| 783 | Ga0207683_10051914 | 3300026121 | Unclassified | 3593 |
| 784 | Ga0207683_10153964 | 3300026121 | Unclassified | 2076 |
| 785 | Ga0207683_10532556 | 3300026121 | Unclassified | 1086 |
| 786 | Ga0207698_10088151 | 3300026142 | Unclassified | 2530 |
| 787 | Ga0209971_1078061 | 3300027682 | Bacteria | 805 |
| 788 | Ga0209998_10055051 | 3300027717 | Bacteria | 928 |
| 789 | Ga0209974_10059230 | 3300027876 | Archaea | 1295 |
| 790 | Ga0209974_10062413 | 3300027876 | Bacteria | 1262 |
| 791 | Ga0207428_10000515 | 3300027907 | Bacteria | 46261 |
| 792 | Ga0207428_10002311 | 3300027907 | Bacteria | 19090 |
| 793 | Ga0207428_10006882 | 3300027907 | Bacteria | 10421 |
| 794 | Ga0207428_10008383 | 3300027907 | Bacteria | 9335 |
| 795 | Ga0207428_10058793 | 3300027907 | Bacteria | 3050 |
| 796 | Ga0207428_10327876 | 3300027907 | Bacteria | 1129 |
| 797 | Ga0207428_10752096 | 3300027907 | Bacteria | 695 |
| 798 | Ga0207428_10942401 | 3300027907 | Bacteria | 609 |
| 799 | Ga0268266_10054105 | 3300028379 | Bacteria | 3449 |
| 800 | Ga0268266_10400147 | 3300028379 | Bacteria | 1298 |
| 801 | Ga0268266_10797775 | 3300028379 | Bacteria | 912 |
| 802 | Ga0268265_10004006 | 3300028380 | Bacteria | 10369 |
| 803 | Ga0268265_10030648 | 3300028380 | Bacteria | 3876 |
| 804 | Ga0268265_10154862 | 3300028380 | Bacteria | 1938 |
| 805 | Ga0268265_10188184 | 3300028380 | Unclassified | 1780 |
| 806 | Ga0268265_10195042 | 3300028380 | Bacteria | 1752 |
| 807 | Ga0268265_10234290 | 3300028380 | Bacteria | 1616 |
| 808 | Ga0268265_10258420 | 3300028380 | Bacteria | 1547 |
| 809 | Ga0268265_10352745 | 3300028380 | Bacteria | 1344 |
| 810 | Ga0268265_10389729 | 3300028380 | Bacteria | 1284 |
| 811 | Ga0268265_10664087 | 3300028380 | Unclassified | 1003 |
| 812 | Ga0268265_10749026 | 3300028380 | Bacteria | 948 |
| 813 | Ga0268265_11165060 | 3300028380 | Bacteria | 767 |
| 814 | Ga0268264_10128495 | 3300028381 | Bacteria | 2243 |
| 815 | Ga0268264_10142874 | 3300028381 | Unclassified | 2136 |
| 816 | Ga0268264_10168656 | 3300028381 | Bacteria | 1978 |
| 817 | Ga0268264_10775511 | 3300028381 | Bacteria | 956 |
| 818 | Ga0268264_11184763 | 3300028381 | Bacteria | 773 |
| 819 | Ga0268264_11202200 | 3300028381 | Bacteria | 767 |
| 820 | Ga0268264_11987719 | 3300028381 | Bacteria | 591 |
| 821 | Ga0268264_12128022 | 3300028381 | Bacteria | 569 |
| 822 | Ga0265316_10282318 | 3300031344 | Bacteria | 1213 |
| 823 | Ga0307408_100086674 | 3300031548 | Bacteria | 2354 |
| 824 | Ga0307408_100460014 | 3300031548 | Bacteria | 1106 |
| 825 | Ga0307408_100634881 | 3300031548 | Unclassified | 953 |
| 826 | Ga0265314_10120161 | 3300031711 | Bacteria | 1655 |
| 827 | Ga0307405_10004821 | 3300031731 | Bacteria | 6435 |
| 828 | Ga0307405_10551294 | 3300031731 | Unclassified | 933 |
| 829 | Ga0307413_10126311 | 3300031824 | Bacteria | 1742 |
| 830 | Ga0307413_11005855 | 3300031824 | Unclassified | 715 |
| 831 | Ga0307410_10008571 | 3300031852 | Bacteria | 5678 |
| 832 | Ga0307410_10907490 | 3300031852 | Unclassified | 755 |
| 833 | Ga0307406_10068985 | 3300031901 | Bacteria | 2310 |
| 834 | Ga0307407_10003751 | 3300031903 | Bacteria | 6311 |
| 835 | Ga0307407_10253003 | 3300031903 | Unclassified | 1208 |
| 836 | Ga0307407_10266700 | 3300031903 | Bacteria | 1180 |
| 837 | Ga0307412_10027611 | 3300031911 | Bacteria | 3541 |
| 838 | Ga0307412_10574164 | 3300031911 | Bacteria | 951 |
| 839 | Ga0307412_11397689 | 3300031911 | Unclassified | 633 |
| 840 | Ga0307412_11605491 | 3300031911 | Bacteria | 594 |
| 841 | Ga0307409_100062413 | 3300031995 | Bacteria | 2917 |
| 842 | Ga0307409_101109911 | 3300031995 | Unclassified | 812 |
| 843 | Ga0307416_100097463 | 3300032002 | Unclassified | 2546 |
| 844 | Ga0307416_101080945 | 3300032002 | Unclassified | 906 |
| 845 | Ga0307411_10015044 | 3300032005 | Bacteria | 4329 |
| 846 | Ga0307411_10127862 | 3300032005 | Bacteria | 1851 |
| 847 | Ga0307411_10445419 | 3300032005 | Bacteria | 1082 |
| 848 | Ga0307411_10819585 | 3300032005 | Bacteria | 821 |
| 849 | Ga0307411_11917682 | 3300032005 | Bacteria | 552 |
| 850 | Ga0307415_100024282 | 3300032126 | Bacteria | 3781 |
| 851 | Ga0373948_0006326 | 3300034817 | Bacteria | 1953 |
| 852 | Ga0373938_0152264 | 3300034957 | Bacteria | 616 |
| 853 | Ga0373928_0007511 | 3300035084 | Bacteria | 2104 |
| 854 | Ga0373940_0271815 | 3300035088 | Bacteria | 576 |
| 855 | Ga0373944_0149309 | 3300035089 | Unclassified | 823 |
| 856 | Ga0373949_0002163 | 3300035090 | Bacteria | 5149 |
| 857 | Ga0373951_0007755 | 3300035091 | Bacteria | 2436 |
| 858 | Ga0373952_0003771 | 3300035092 | Bacteria | 2740 |
| 859 | Ga0373932_0006339 | 3300035112 | Bacteria | 2796 |
| 860 | Ga0373932_0111103 | 3300035112 | Bacteria | 903 |
| 861 | Ga0373932_0167821 | 3300035112 | Bacteria | 763 |
| 862 | Ga0373939_0015830 | 3300035114 | Bacteria | 1979 |
| 863 | Ga0373941_0000343 | 3300035115 | Bacteria | 9134 |
| 864 | Ga0373941_0266422 | 3300035115 | Bacteria | 673 |
| 865 | Ga0373954_0046367 | 3300035118 | Bacteria | 2032 |
| 866 | Ga0373956_0223500 | 3300035119 | Bacteria | 894 |
| 867 | Ga0373960_0001256 | 3300035121 | Bacteria | 5572 |
| 868 | Ga0373960_0025199 | 3300035121 | Bacteria | 1615 |
| 869 | Ga0373943_0124050 | 3300035170 | Bacteria | 1375 |
| 870 | Ga0373946_0069755 | 3300035171 | Bacteria | 1515 |
| 871 | Ga0373955_0463325 | 3300035172 | Bacteria | 773 |
| 872 | Ga0373955_0665361 | 3300035172 | Bacteria | 639 |
| 873 | Ga0373961_0022626 | 3300035241 | Bacteria | 1683 |
| 874 | Ga0373961_0062944 | 3300035241 | Bacteria | 1130 |
| 875 | Ga0373962_0001870 | 3300035242 | Bacteria | 5016 |
| 876 | Ga0373931_0001339 | 3300035691 | Bacteria | 10529 |
| 877 | Ga0373931_0082457 | 3300035691 | Bacteria | 1778 |
| 878 | Ga0373931_0120135 | 3300035691 | Bacteria | 1501 |
| 879 | Ga0373937_0159180 | 3300036401 | Bacteria | 2117 |
| 880 | Ga0373925_0241361 | 3300037068 | Bacteria | 1447 |
| 881 | Ga0373925_0496367 | 3300037068 | Bacteria | 1002 |
| 882 | Ga0439453_0022459 | 3300041408 | Unclassified | 1144 |
| 883 | Ga0451800_1621613 | 3300041459 | Bacteria | 589 |
| 884 | Ga0439433_0027879 | 3300041999 | Archaea | 1283 |
| 885 | Ga0439454_100652 | 3300042011 | Unclassified | 543 |
| 886 | Ga0439462_0199881 | 3300042015 | Archaea | 569 |
| 887 | Ga0450914_046764 | 3300042118 | Unclassified | 561 |
| 888 | Ga0439446_0042916 | 3300042156 | Unclassified | 1336 |
| 889 | Ga0439446_0099084 | 3300042156 | Bacteria | 920 |
| 890 | Ga0439434_0057687 | 3300042435 | Bacteria | 1211 |
| 891 | Ga0439435_0092311 | 3300042436 | Bacteria | 921 |
| 892 | Ga0439464_0093384 | 3300042439 | Unclassified | 909 |
| 893 | Ga0439464_0122213 | 3300042439 | Unclassified | 802 |
| 894 | Ga0450916_024858 | 3300042530 | Bacteria | 843 |
| 895 | Ga0439440_0032645 | 3300042993 | Bacteria | 1237 |
| 896 | Ga0439440_0104953 | 3300042993 | Unclassified | 772 |
| 897 | Ga0451576_0010882 | 3300045051 | Bacteria | 10408 |
| 898 | Ga0451576_0679933 | 3300045051 | Unclassified | 1081 |
| 899 | Ga0495592_0322612 | 3300046454 | Archaea | 998 |
| 900 | Ga0495603_0063471 | 3300046455 | Bacteria | 2179 |
| 901 | Ga0495580_0073772 | 3300046472 | Bacteria | 2382 |
| 902 | Ga0495582_0118102 | 3300046473 | Bacteria | 1493 |
| 903 | Ga0495662_0505033 | 3300046476 | Bacteria | 593 |
| 904 | Ga0495664_0695675 | 3300046477 | Archaea | 601 |
| 905 | Ga0495594_0062966 | 3300046499 | Archaea | 2055 |
| 906 | Ga0495583_0160906 | 3300046506 | Unclassified | 926 |
| 907 | Ga0495630_0117208 | 3300046517 | Bacteria | 2019 |
| 908 | Ga0495630_0177025 | 3300046517 | Bacteria | 1626 |
| 909 | Ga0495663_0265200 | 3300046525 | Bacteria | 613 |
| 910 | Ga0495666_0322956 | 3300046526 | Archaea | 697 |
| 911 | Ga0495640_0054769 | 3300046533 | Bacteria | 2731 |
| 912 | Ga0495586_0074839 | 3300046535 | Bacteria | 1854 |
| 913 | Ga0495586_0569150 | 3300046535 | Bacteria | 654 |
| 914 | Ga0495598_0179138 | 3300046537 | Bacteria | 755 |
| 915 | Ga0495621_0054794 | 3300046539 | Bacteria | 1434 |
| 916 | Ga0495621_0097697 | 3300046539 | Unclassified | 1114 |
| 917 | Ga0495645_0011107 | 3300046543 | Bacteria | 6332 |
| 918 | Ga0495633_0143241 | 3300046558 | Bacteria | 1105 |
| 919 | Ga0495634_0423410 | 3300046642 | Bacteria | 788 |
| 920 | Ga0495635_0197813 | 3300046663 | Bacteria | 1364 |
| 921 | Ga0495635_0200578 | 3300046663 | Bacteria | 1353 |
| 922 | Ga0495659_0488488 | 3300046664 | Bacteria | 539 |
| 923 | Ga0495588_0254220 | 3300046674 | Bacteria | 926 |
| 924 | Ga0495599_0366166 | 3300046678 | Bacteria | 862 |
| 925 | Ga0495647_0058426 | 3300046681 | Bacteria | 1516 |
| 926 | Ga0495647_0096855 | 3300046681 | Bacteria | 1217 |
| 927 | Ga0495647_0115562 | 3300046681 | Unclassified | 1124 |
| 928 | Ga0495647_0299780 | 3300046681 | Bacteria | 724 |
| 929 | Ga0495658_0039106 | 3300046683 | Bacteria | 2630 |
| 930 | Ga0495658_0058218 | 3300046683 | Bacteria | 2210 |
| 931 | Ga0495669_0207481 | 3300046684 | Unclassified | 938 |
| 932 | Ga0495636_0064540 | 3300047318 | Unclassified | 1554 |
| 933 | Ga0495674_0106880 | 3300047319 | Bacteria | 2376 |
| 934 | Ga0495674_0186479 | 3300047319 | Bacteria | 1726 |
| 935 | Ga0495680_0126574 | 3300047322 | Bacteria | 1881 |
| 936 | Ga0495680_0943251 | 3300047322 | Bacteria | 555 |
| 937 | Ga0495684_0086028 | 3300047471 | Bacteria | 2383 |
| 938 | Ga0495684_0160441 | 3300047471 | Bacteria | 1677 |
| 939 | Ga0495602_0600681 | 3300048088 | Bacteria | 757 |
| 940 | Ga0496101_1106349 | 3300048904 | Bacteria | 622 |
| 941 | Ga0496102_0067969 | 3300048905 | Bacteria | 3269 |
| 942 | Ga0496102_0091619 | 3300048905 | Bacteria | 2814 |
| 943 | Ga0496102_1415078 | 3300048905 | Unclassified | 614 |
| 944 | Ga0496103_0316398 | 3300048906 | Bacteria | 1004 |
| 945 | Ga0496103_0750067 | 3300048906 | Unclassified | 617 |
| 946 | Ga0496104_1590651 | 3300048907 | Unclassified | 556 |
| 947 | Ga0496106_0485290 | 3300048909 | Bacteria | 993 |
| 948 | Ga0496106_0776202 | 3300048909 | Bacteria | 761 |
| 949 | Ga0496106_1183616 | 3300048909 | Bacteria | 597 |
| 950 | Ga0496108_0025003 | 3300048911 | Bacteria | 4919 |
| 951 | Ga0496109_0331752 | 3300048912 | Bacteria | 1436 |
| 952 | Ga0496109_1098377 | 3300048912 | Unclassified | 732 |
| 953 | Ga0496110_0171743 | 3300048913 | Bacteria | 1967 |
| 954 | Ga0496110_0680971 | 3300048913 | Bacteria | 929 |
| 955 | Ga0496112_0037423 | 3300048915 | Bacteria | 4737 |
| 956 | Ga0496113_0177816 | 3300048916 | Bacteria | 1686 |
| 957 | Ga0496113_0354640 | 3300048916 | Bacteria | 1177 |
| 958 | Ga0496114_0041782 | 3300048917 | Bacteria | 3800 |
| 959 | Ga0501298_030201 | 3300049521 | Unclassified | 1059 |
| 960 | Ga0501033_0720816 | 3300049570 | Unclassified | 678 |
| 961 | Ga0501036_0101941 | 3300049572 | Bacteria | 2428 |
| 962 | Ga0501036_0119187 | 3300049572 | Bacteria | 2229 |
| 963 | Ga0501037_0372352 | 3300049573 | Bacteria | 983 |
| 964 | Ga0501039_0056023 | 3300049575 | Bacteria | 3054 |
| 965 | Ga0501039_0069299 | 3300049575 | Bacteria | 2739 |
| 966 | Ga0501040_0018432 | 3300049576 | Unclassified | 4634 |
| 967 | Ga0501040_0086204 | 3300049576 | Bacteria | 2180 |
| 968 | Ga0501040_0964412 | 3300049576 | Bacteria | 618 |
| 969 | Ga0501041_0064651 | 3300049577 | Bacteria | 2240 |
| 970 | Ga0501041_0189559 | 3300049577 | Bacteria | 1288 |
| 971 | Ga0501042_0025948 | 3300049578 | Bacteria | 4118 |
| 972 | Ga0501042_0062804 | 3300049578 | Bacteria | 2654 |
| 973 | Ga0501046_0001085 | 3300049580 | Bacteria | 26670 |
| 974 | Ga0501048_0063991 | 3300049582 | Bacteria | 2601 |
| 975 | Ga0501048_0088906 | 3300049582 | Bacteria | 2179 |
| 976 | Ga0501067_0625052 | 3300049583 | Bacteria | 604 |
| 977 | Ga0501071_0037006 | 3300049587 | Bacteria | 3482 |
| 978 | Ga0501071_0156786 | 3300049587 | Bacteria | 1700 |
| 979 | Ga0501071_0313238 | 3300049587 | Unclassified | 1191 |
| 980 | Ga0501074_0658231 | 3300049590 | Unclassified | 740 |
| 981 | Ga0501074_1172151 | 3300049590 | Unclassified | 539 |
| 982 | Ga0501075_0003591 | 3300049591 | Bacteria | 10393 |
| 983 | Ga0501075_0077467 | 3300049591 | Bacteria | 2516 |
| 984 | Ga0501075_0276180 | 3300049591 | Bacteria | 1280 |
| 985 | Ga0501075_0480718 | 3300049591 | Bacteria | 948 |
| 986 | Ga0501075_0592558 | 3300049591 | Unclassified | 846 |
| 987 | Ga0501076_0024232 | 3300049592 | Bacteria | 4688 |
| 988 | Ga0501076_0461218 | 3300049592 | Archaea | 1046 |
| 989 | Ga0501076_0854306 | 3300049592 | Bacteria | 751 |
| 990 | Ga0501076_1162535 | 3300049592 | Unclassified | 635 |
| 991 | Ga0501077_0015002 | 3300049593 | Unclassified | 4871 |
| 992 | Ga0501077_0711413 | 3300049593 | Unclassified | 645 |
| 993 | Ga0501249_010075 | 3300049679 | Bacteria | 1970 |
| 994 | Ga0501079_0209458 | 3300049741 | Bacteria | 1523 |
| 995 | Ga0501081_0030039 | 3300049743 | Bacteria | 3676 |
| 996 | Ga0501081_0046932 | 3300049743 | Bacteria | 2970 |
| 997 | Ga0501083_0218121 | 3300049744 | Bacteria | 1243 |
| 998 | Ga0501083_0493680 | 3300049744 | Bacteria | 797 |
| 999 | Ga0501044_1174262 | 3300049823 | Unclassified | 636 |
| 1000 | Ga0501045_0056520 | 3300049824 | Bacteria | 2870 |
| 1001 | nmdc:mga05p37_1035000_c1 | 3300050507 | Bacteria | 868 |
| 1002 | nmdc:mga05p37_11228_c1 | 3300050507 | Bacteria | 10650 |
| 1003 | nmdc:mga05p37_1363605_c1 | 3300050507 | Bacteria | 717 |
| 1004 | nmdc:mga05p37_156059_c1 | 3300050507 | Archaea | 2789 |
| 1005 | nmdc:mga05p37_174100_c1 | 3300050507 | Unclassified | 2623 |
| 1006 | nmdc:mga05p37_299257_c1 | 3300050507 | Bacteria | 1912 |
| 1007 | nmdc:mga05p37_32801_c1 | 3300050507 | Bacteria | 6354 |
| 1008 | nmdc:mga05p37_386041_c1 | 3300050507 | Bacteria | 1639 |
| 1009 | nmdc:mga05p37_406896_c1 | 3300050507 | Unclassified | 1587 |
| 1010 | nmdc:mga05p37_43511_c1 | 3300050507 | Bacteria | 5525 |
| 1011 | nmdc:mga05p37_47284_c1 | 3300050507 | Bacteria | 5292 |
| 1012 | nmdc:mga05p37_81153_c2 | 3300050507 | Bacteria | 2482 |
| 1013 | nmdc:mga05p37_822700_c1 | 3300050507 | Unclassified | 1013 |
| 1014 | nmdc:mga09592_2456_c1 | 3300050508 | Bacteria | 14958 |
| 1015 | nmdc:mga09592_290133_c1 | 3300050508 | Bacteria | 1418 |
| 1016 | nmdc:mga09592_3877_c1 | 3300050508 | Bacteria | 12047 |
| 1017 | nmdc:mga09592_514254_c1 | 3300050508 | Bacteria | 1030 |
| 1018 | nmdc:mga09592_54046_c1 | 3300050508 | Bacteria | 3393 |
| 1019 | nmdc:mga09592_76446_c1 | 3300050508 | Bacteria | 2847 |
| 1020 | nmdc:mga0qj67_1191813_c1 | 3300050509 | Bacteria | 593 |
| 1021 | nmdc:mga0qj67_15050_c1 | 3300050509 | Bacteria | 5853 |
| 1022 | nmdc:mga0qj67_2494_c1 | 3300050509 | Bacteria | 13126 |
| 1023 | nmdc:mga0qj67_49253_c1 | 3300050509 | Bacteria | 3330 |
| 1024 | nmdc:mga0qj67_585652_c1 | 3300050509 | Unclassified | 893 |
| 1025 | nmdc:mga06r32_263642_c1 | 3300050510 | Bacteria | 1711 |
| 1026 | nmdc:mga06r32_31910_c1 | 3300050510 | Bacteria | 4951 |
| 1027 | nmdc:mga06r32_337151_c1 | 3300050510 | Bacteria | 1493 |
| 1028 | nmdc:mga06r32_41442_c1 | 3300050510 | Bacteria | 4375 |
| 1029 | nmdc:mga06r32_6589_c1 | 3300050510 | Bacteria | 10431 |
| 1030 | nmdc:mga08y16_1241992_c1 | 3300050511 | Bacteria | 714 |
| 1031 | nmdc:mga08y16_1271719_c1 | 3300050511 | Bacteria | 704 |
| 1032 | nmdc:mga08y16_168554_c1 | 3300050511 | Bacteria | 2275 |
| 1033 | nmdc:mga08y16_19092_c1 | 3300050511 | Bacteria | 7223 |
| 1034 | nmdc:mga08y16_3326_c2 | 3300050511 | Bacteria | 5737 |
| 1035 | nmdc:mga08y16_37298_c1 | 3300050511 | Bacteria | 5105 |
| 1036 | nmdc:mga08y16_43724_c1 | 3300050511 | Bacteria | 4695 |
| 1037 | nmdc:mga08y16_48345_c1 | 3300050511 | Bacteria | 4452 |
| 1038 | nmdc:mga08y16_526993_c1 | 3300050511 | Unclassified | 1198 |
| 1039 | nmdc:mga08y16_5474_c1 | 3300050511 | Bacteria | 13280 |
| 1040 | nmdc:mga08y16_683_c1 | 3300050511 | Bacteria | 32086 |
| 1041 | nmdc:mga08y16_79251_c1 | 3300050511 | Bacteria | 3424 |
| 1042 | nmdc:mga08y16_800102_c1 | 3300050511 | Bacteria | 936 |
| 1043 | nmdc:mga08y16_976_c1 | 3300050511 | Bacteria | 27870 |
| 1044 | nmdc:mga0n895_1176576_c1 | 3300050512 | Unclassified | 741 |
| 1045 | nmdc:mga0n895_16886_c1 | 3300050512 | Bacteria | 6711 |
| 1046 | nmdc:mga0n895_184334_c1 | 3300050512 | Bacteria | 2119 |
| 1047 | nmdc:mga0n895_357886_c1 | 3300050512 | Bacteria | 1478 |
| 1048 | nmdc:mga0n895_42983_c1 | 3300050512 | Bacteria | 4400 |
| 1049 | nmdc:mga0n895_454300_c1 | 3300050512 | Bacteria | 1293 |
| 1050 | nmdc:mga0n895_632267_c1 | 3300050512 | Bacteria | 1070 |
| 1051 | nmdc:mga0n895_71935_c1 | 3300050512 | Bacteria | 3430 |
| 1052 | nmdc:mga0n895_77894_c1 | 3300050512 | Unclassified | 3298 |
| 1053 | nmdc:mga0n895_8913_c1 | 3300050512 | Bacteria | 8740 |
| 1054 | nmdc:mga0rr50_10783_c1 | 3300050513 | Bacteria | 5824 |
| 1055 | nmdc:mga0rr50_118939_c1 | 3300050513 | Bacteria | 2100 |
| 1056 | nmdc:mga0rr50_1258634_c1 | 3300050513 | Unclassified | 628 |
| 1057 | nmdc:mga0rr50_270267_c1 | 3300050513 | Bacteria | 1417 |
| 1058 | nmdc:mga0rr50_321957_c1 | 3300050513 | Bacteria | 1296 |
| 1059 | nmdc:mga0rr50_373910_c1 | 3300050513 | Bacteria | 1201 |
| 1060 | nmdc:mga0rr50_49091_c1 | 3300050513 | Bacteria | 3123 |
| 1061 | nmdc:mga0rr50_690846_c1 | 3300050513 | Bacteria | 871 |
| 1062 | nmdc:mga08x19_1161462_c1 | 3300050514 | Unclassified | 548 |
| 1063 | nmdc:mga08x19_150702_c1 | 3300050514 | Bacteria | 1575 |
| 1064 | nmdc:mga08x19_245572_c1 | 3300050514 | Unclassified | 1235 |
| 1065 | nmdc:mga08x19_422416_c1 | 3300050514 | Bacteria | 936 |
| 1066 | nmdc:mga08x19_8172_c1 | 3300050514 | Bacteria | 6218 |
| 1067 | nmdc:mga08x19_88202_c1 | 3300050514 | Bacteria | 2045 |
| 1068 | nmdc:mga0a205_1005171_c1 | 3300050515 | Bacteria | 681 |
| 1069 | nmdc:mga0a205_11262_c1 | 3300050515 | Bacteria | 8232 |
| 1070 | nmdc:mga0a205_154044_c1 | 3300050515 | Bacteria | 2197 |
| 1071 | nmdc:mga0a205_200440_c1 | 3300050515 | Unclassified | 1886 |
| 1072 | nmdc:mga0a205_5674_c1 | 3300050515 | Bacteria | 11245 |
| 1073 | nmdc:mga0a205_818286_c1 | 3300050515 | Unclassified | 779 |
| 1074 | nmdc:mga0a205_894_c1 | 3300050515 | Bacteria | 23641 |
| 1075 | Ga0495601_0498053 | 3300053077 | Archaea | 786 |
| 1076 | Ga0495619_0008562 | 3300053085 | Bacteria | 6474 |
| 1077 | Ga0500566_0226009 | 3300053094 | Bacteria | 927 |
| 1078 | Ga0501084_0004609 | 3300054114 | Bacteria | 11259 |
| 1079 | Ga0501084_0073686 | 3300054114 | Bacteria | 2859 |
| 1080 | Ga0590075_045219 | 3300059424 | Unclassified | 1128 |
| 1081 | Ga0590077_091703 | 3300059426 | Archaea | 705 |
| 1082 | Ga0501082_0014744 | 3300060353 | Bacteria | 6729 |
| 1083 | Ga0530510_0032284 | 3300061734 | Bacteria | 3766 |
| 1084 | Ga0530510_1262851 | 3300061734 | Unclassified | 566 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049592 | Ga0501076_0461218 | Ga0501076_0461218_616_1026 | 131 |
| 2 | 3300048904 | Ga0496101_1106349 | Ga0496101_1106349_194_595 | 133 |
| 3 | 3300035118 | Ga0373954_0046367 | Ga0373954_0046367_550_966 | 138 |
| 4 | 3300006852 | Ga0075433_10344894 | Ga0075433_103448941 | 152 |
| 5 | 3300006871 | Ga0075434_100011803 | Ga0075434_1000118033 | 152 |
| 6 | 3300006914 | Ga0075436_100017806 | Ga0075436_1000178063 | 152 |
| 7 | 3300007076 | Ga0075435_100035427 | Ga0075435_1000354274 | 152 |
| 8 | 3300009147 | Ga0114129_10341284 | Ga0114129_103412843 | 152 |
| 9 | 3300014968 | Ga0157379_10116343 | Ga0157379_101163433 | 152 |
| 10 | 3300027876 | Ga0209974_10059230 | Ga0209974_100592302 | 152 |
| 11 | 3300035172 | Ga0373955_0463325 | Ga0373955_0463325_208_678 | 152 |
| 12 | 3300042011 | Ga0439454_100652 | Ga0439454_100652_69_530 | 152 |
| 13 | 3300042439 | Ga0439464_0093384 | Ga0439464_0093384_89_550 | 152 |
| 14 | 3300042993 | Ga0439440_0032645 | Ga0439440_0032645_514_981 | 152 |
| 15 | 3300049570 | Ga0501033_0720816 | Ga0501033_0720816_189_647 | 152 |
| 16 | 3300049587 | Ga0501071_0313238 | Ga0501071_0313238_604_1062 | 152 |
| 17 | 3300050507 | nmdc:mga05p37_299257_c1 | nmdc:mga05p37_299257_c1_593_1051 | 152 |
| 18 | 3300050512 | nmdc:mga0n895_184334_c1 | nmdc:mga0n895_184334_c1_1493_1951 | 152 |
| 19 | 3300050513 | nmdc:mga0rr50_270267_c1 | nmdc:mga0rr50_270267_c1_261_719 | 152 |
| 20 | 3300050514 | nmdc:mga08x19_1161462_c1 | nmdc:mga08x19_1161462_c1_42_500 | 152 |
| 21 | 3300050515 | nmdc:mga0a205_11262_c1 | nmdc:mga0a205_11262_c1_5970_6428 | 152 |
| 22 | 3300002459 | JGI24751J29686_10024321 | JGI24751J29686_100243212 | 153 |
| 23 | 3300005330 | Ga0070690_100647491 | Ga0070690_1006474911 | 153 |
| 24 | 3300005334 | Ga0068869_100096572 | Ga0068869_1000965722 | 153 |
| 25 | 3300005337 | Ga0070682_101458129 | Ga0070682_1014581291 | 153 |
| 26 | 3300005339 | Ga0070660_101324747 | Ga0070660_1013247471 | 153 |
| 27 | 3300005354 | Ga0070675_100281889 | Ga0070675_1002818892 | 153 |
| 28 | 3300005455 | Ga0070663_100579498 | Ga0070663_1005794982 | 153 |
| 29 | 3300005544 | Ga0070686_100737860 | Ga0070686_1007378602 | 153 |
| 30 | 3300005544 | Ga0070686_101056086 | Ga0070686_1010560862 | 153 |
| 31 | 3300005564 | Ga0070664_100152090 | Ga0070664_1001520902 | 153 |
| 32 | 3300005842 | Ga0068858_100008903 | Ga0068858_1000089033 | 153 |
| 33 | 3300005844 | Ga0068862_100599307 | Ga0068862_1005993072 | 153 |
| 34 | 3300006237 | Ga0097621_100000491 | Ga0097621_10000049112 | 153 |
| 35 | 3300006358 | Ga0068871_100010512 | Ga0068871_1000105123 | 153 |
| 36 | 3300009101 | Ga0105247_11323955 | Ga0105247_113239551 | 153 |
| 37 | 3300009176 | Ga0105242_10014745 | Ga0105242_100147454 | 153 |
| 38 | 3300009177 | Ga0105248_11382836 | Ga0105248_113828362 | 153 |
| 39 | 3300009177 | Ga0105248_11688599 | Ga0105248_116885991 | 153 |
| 40 | 3300013104 | Ga0157370_10403321 | Ga0157370_104033212 | 153 |
| 41 | 3300013306 | Ga0163162_11148816 | Ga0163162_111488162 | 153 |
| 42 | 3300013308 | Ga0157375_10136534 | Ga0157375_101365341 | 153 |
| 43 | 3300013308 | Ga0157375_11099477 | Ga0157375_110994772 | 153 |
| 44 | 3300014325 | Ga0163163_10261905 | Ga0163163_102619052 | 153 |
| 45 | 3300014968 | Ga0157379_10067766 | Ga0157379_100677663 | 153 |
| 46 | 3300014969 | Ga0157376_10140572 | Ga0157376_101405722 | 153 |
| 47 | 3300025900 | Ga0207710_10012471 | Ga0207710_100124713 | 153 |
| 48 | 3300025907 | Ga0207645_10147272 | Ga0207645_101472722 | 153 |
| 49 | 3300025908 | Ga0207643_10031908 | Ga0207643_100319084 | 153 |
| 50 | 3300025925 | Ga0207650_10535292 | Ga0207650_105352922 | 153 |
| 51 | 3300025926 | Ga0207659_10279966 | Ga0207659_102799662 | 153 |
| 52 | 3300025927 | Ga0207687_10850048 | Ga0207687_108500481 | 153 |
| 53 | 3300025934 | Ga0207686_10019187 | Ga0207686_100191872 | 153 |
| 54 | 3300025935 | Ga0207709_10197562 | Ga0207709_101975622 | 153 |
| 55 | 3300025938 | Ga0207704_10046592 | Ga0207704_100465923 | 153 |
| 56 | 3300025941 | Ga0207711_10171150 | Ga0207711_101711502 | 153 |
| 57 | 3300026067 | Ga0207678_10496826 | Ga0207678_104968262 | 153 |
| 58 | 3300026089 | Ga0207648_10833728 | Ga0207648_108337282 | 153 |
| 59 | 3300026095 | Ga0207676_10097975 | Ga0207676_100979752 | 153 |
| 60 | 3300026095 | Ga0207676_10849720 | Ga0207676_108497201 | 153 |
| 61 | 3300026142 | Ga0207698_10088151 | Ga0207698_100881512 | 153 |
| 62 | 3300028379 | Ga0268266_10054105 | Ga0268266_100541051 | 153 |
| 63 | 3300028381 | Ga0268264_10775511 | Ga0268264_107755112 | 153 |
| 64 | 3300035119 | Ga0373956_0223500 | Ga0373956_0223500_234_707 | 153 |
| 65 | 3300035170 | Ga0373943_0124050 | Ga0373943_0124050_43_516 | 153 |
| 66 | 3300035172 | Ga0373955_0665361 | Ga0373955_0665361_29_502 | 153 |
| 67 | 3300037068 | Ga0373925_0496367 | Ga0373925_0496367_322_795 | 153 |
| 68 | 3300046455 | Ga0495603_0063471 | Ga0495603_0063471_1195_1668 | 153 |
| 69 | 3300046473 | Ga0495582_0118102 | Ga0495582_0118102_420_893 | 153 |
| 70 | 3300046476 | Ga0495662_0505033 | Ga0495662_0505033_23_496 | 153 |
| 71 | 3300046533 | Ga0495640_0054769 | Ga0495640_0054769_731_1192 | 153 |
| 72 | 3300046535 | Ga0495586_0074839 | Ga0495586_0074839_268_741 | 153 |
| 73 | 3300046543 | Ga0495645_0011107 | Ga0495645_0011107_112_585 | 153 |
| 74 | 3300046663 | Ga0495635_0200578 | Ga0495635_0200578_706_1179 | 153 |
| 75 | 3300046678 | Ga0495599_0366166 | Ga0495599_0366166_342_815 | 153 |
| 76 | 3300046681 | Ga0495647_0058426 | Ga0495647_0058426_627_1100 | 153 |
| 77 | 3300046681 | Ga0495647_0096855 | Ga0495647_0096855_44_517 | 153 |
| 78 | 3300046683 | Ga0495658_0039106 | Ga0495658_0039106_366_839 | 153 |
| 79 | 3300047319 | Ga0495674_0186479 | Ga0495674_0186479_243_716 | 153 |
| 80 | 3300047322 | Ga0495680_0126574 | Ga0495680_0126574_1321_1794 | 153 |
| 81 | 3300047471 | Ga0495684_0086028 | Ga0495684_0086028_1698_2171 | 153 |
| 82 | 3300048911 | Ga0496108_0025003 | Ga0496108_0025003_2504_2977 | 153 |
| 83 | 3300048912 | Ga0496109_0331752 | Ga0496109_0331752_346_819 | 153 |
| 84 | 3300048915 | Ga0496112_0037423 | Ga0496112_0037423_447_920 | 153 |
| 85 | 3300048916 | Ga0496113_0177816 | Ga0496113_0177816_409_882 | 153 |
| 86 | 3300048917 | Ga0496114_0041782 | Ga0496114_0041782_2653_3126 | 153 |
| 87 | 3300053094 | Ga0500566_0226009 | Ga0500566_0226009_257_730 | 153 |
| 88 | 3300003203 | JGI25406J46586_10037792 | JGI25406J46586_100377922 | 154 |
| 89 | 3300005290 | Ga0065712_10251049 | Ga0065712_102510491 | 154 |
| 90 | 3300005290 | Ga0065712_10636686 | Ga0065712_106366861 | 154 |
| 91 | 3300005293 | Ga0065715_10639614 | Ga0065715_106396142 | 154 |
| 92 | 3300005295 | Ga0065707_10524797 | Ga0065707_105247972 | 154 |
| 93 | 3300005328 | Ga0070676_10277072 | Ga0070676_102770722 | 154 |
| 94 | 3300005329 | Ga0070683_100085861 | Ga0070683_1000858613 | 154 |
| 95 | 3300005330 | Ga0070690_100085097 | Ga0070690_1000850972 | 154 |
| 96 | 3300005330 | Ga0070690_100243194 | Ga0070690_1002431942 | 154 |
| 97 | 3300005330 | Ga0070690_100655740 | Ga0070690_1006557402 | 154 |
| 98 | 3300005333 | Ga0070677_10407443 | Ga0070677_104074431 | 154 |
| 99 | 3300005334 | Ga0068869_100005548 | Ga0068869_1000055483 | 154 |
| 100 | 3300005335 | Ga0070666_10039433 | Ga0070666_100394332 | 154 |
| 101 | 3300005336 | Ga0070680_100307806 | Ga0070680_1003078063 | 154 |
| 102 | 3300005336 | Ga0070680_100982075 | Ga0070680_1009820751 | 154 |
| 103 | 3300005336 | Ga0070680_101036432 | Ga0070680_1010364321 | 154 |
| 104 | 3300005338 | Ga0068868_100188517 | Ga0068868_1001885172 | 154 |
| 105 | 3300005338 | Ga0068868_100390635 | Ga0068868_1003906351 | 154 |
| 106 | 3300005338 | Ga0068868_102197568 | Ga0068868_1021975681 | 154 |
| 107 | 3300005339 | Ga0070660_100082029 | Ga0070660_1000820294 | 154 |
| 108 | 3300005339 | Ga0070660_100361684 | Ga0070660_1003616842 | 154 |
| 109 | 3300005339 | Ga0070660_101052490 | Ga0070660_1010524901 | 154 |
| 110 | 3300005340 | Ga0070689_100453063 | Ga0070689_1004530631 | 154 |
| 111 | 3300005340 | Ga0070689_100723052 | Ga0070689_1007230521 | 154 |
| 112 | 3300005341 | Ga0070691_10271224 | Ga0070691_102712241 | 154 |
| 113 | 3300005341 | Ga0070691_10330129 | Ga0070691_103301291 | 154 |
| 114 | 3300005343 | Ga0070687_100008554 | Ga0070687_1000085544 | 154 |
| 115 | 3300005344 | Ga0070661_100414795 | Ga0070661_1004147951 | 154 |
| 116 | 3300005345 | Ga0070692_10070524 | Ga0070692_100705242 | 154 |
| 117 | 3300005347 | Ga0070668_100252156 | Ga0070668_1002521563 | 154 |
| 118 | 3300005353 | Ga0070669_100005329 | Ga0070669_1000053291 | 154 |
| 119 | 3300005353 | Ga0070669_100042667 | Ga0070669_1000426671 | 154 |
| 120 | 3300005353 | Ga0070669_100097062 | Ga0070669_1000970623 | 154 |
| 121 | 3300005353 | Ga0070669_100917146 | Ga0070669_1009171461 | 154 |
| 122 | 3300005353 | Ga0070669_101147984 | Ga0070669_1011479841 | 154 |
| 123 | 3300005353 | Ga0070669_101373106 | Ga0070669_1013731061 | 154 |
| 124 | 3300005354 | Ga0070675_100075989 | Ga0070675_1000759892 | 154 |
| 125 | 3300005354 | Ga0070675_100245149 | Ga0070675_1002451491 | 154 |
| 126 | 3300005354 | Ga0070675_100854273 | Ga0070675_1008542732 | 154 |
| 127 | 3300005356 | Ga0070674_100003472 | Ga0070674_1000034727 | 154 |
| 128 | 3300005356 | Ga0070674_100021751 | Ga0070674_1000217512 | 154 |
| 129 | 3300005356 | Ga0070674_100047443 | Ga0070674_1000474432 | 154 |
| 130 | 3300005356 | Ga0070674_100647594 | Ga0070674_1006475941 | 154 |
| 131 | 3300005364 | Ga0070673_100241893 | Ga0070673_1002418932 | 154 |
| 132 | 3300005365 | Ga0070688_100048853 | Ga0070688_1000488532 | 154 |
| 133 | 3300005365 | Ga0070688_100356709 | Ga0070688_1003567092 | 154 |
| 134 | 3300005367 | Ga0070667_100329936 | Ga0070667_1003299362 | 154 |
| 135 | 3300005367 | Ga0070667_100560199 | Ga0070667_1005601992 | 154 |
| 136 | 3300005406 | Ga0070703_10367038 | Ga0070703_103670381 | 154 |
| 137 | 3300005435 | Ga0070714_100017981 | Ga0070714_1000179813 | 154 |
| 138 | 3300005436 | Ga0070713_100406918 | Ga0070713_1004069182 | 154 |
| 139 | 3300005438 | Ga0070701_10015284 | Ga0070701_100152842 | 154 |
| 140 | 3300005438 | Ga0070701_10120202 | Ga0070701_101202021 | 154 |
| 141 | 3300005441 | Ga0070700_100002184 | Ga0070700_1000021843 | 154 |
| 142 | 3300005441 | Ga0070700_100007571 | Ga0070700_1000075712 | 154 |
| 143 | 3300005441 | Ga0070700_100040187 | Ga0070700_1000401871 | 154 |
| 144 | 3300005441 | Ga0070700_100048842 | Ga0070700_1000488422 | 154 |
| 145 | 3300005444 | Ga0070694_100482708 | Ga0070694_1004827082 | 154 |
| 146 | 3300005444 | Ga0070694_100822174 | Ga0070694_1008221741 | 154 |
| 147 | 3300005444 | Ga0070694_100909293 | Ga0070694_1009092931 | 154 |
| 148 | 3300005444 | Ga0070694_101102079 | Ga0070694_1011020792 | 154 |
| 149 | 3300005445 | Ga0070708_100303668 | Ga0070708_1003036683 | 154 |
| 150 | 3300005445 | Ga0070708_101977453 | Ga0070708_1019774531 | 154 |
| 151 | 3300005455 | Ga0070663_100120008 | Ga0070663_1001200082 | 154 |
| 152 | 3300005455 | Ga0070663_100129798 | Ga0070663_1001297982 | 154 |
| 153 | 3300005455 | Ga0070663_101891555 | Ga0070663_1018915551 | 154 |
| 154 | 3300005458 | Ga0070681_10014561 | Ga0070681_100145618 | 154 |
| 155 | 3300005459 | Ga0068867_100003165 | Ga0068867_1000031657 | 154 |
| 156 | 3300005459 | Ga0068867_100102642 | Ga0068867_1001026422 | 154 |
| 157 | 3300005459 | Ga0068867_100210346 | Ga0068867_1002103463 | 154 |
| 158 | 3300005468 | Ga0070707_100609032 | Ga0070707_1006090322 | 154 |
| 159 | 3300005468 | Ga0070707_100916855 | Ga0070707_1009168551 | 154 |
| 160 | 3300005471 | Ga0070698_100129199 | Ga0070698_1001291993 | 154 |
| 161 | 3300005471 | Ga0070698_100493055 | Ga0070698_1004930552 | 154 |
| 162 | 3300005471 | Ga0070698_100601505 | Ga0070698_1006015051 | 154 |
| 163 | 3300005518 | Ga0070699_100002012 | Ga0070699_1000020122 | 154 |
| 164 | 3300005518 | Ga0070699_101091497 | Ga0070699_1010914971 | 154 |
| 165 | 3300005530 | Ga0070679_100040461 | Ga0070679_1000404612 | 154 |
| 166 | 3300005530 | Ga0070679_100049935 | Ga0070679_1000499354 | 154 |
| 167 | 3300005535 | Ga0070684_100187598 | Ga0070684_1001875982 | 154 |
| 168 | 3300005536 | Ga0070697_100170580 | Ga0070697_1001705801 | 154 |
| 169 | 3300005539 | Ga0068853_100196465 | Ga0068853_1001964653 | 154 |
| 170 | 3300005543 | Ga0070672_100084274 | Ga0070672_1000842741 | 154 |
| 171 | 3300005544 | Ga0070686_100057146 | Ga0070686_1000571461 | 154 |
| 172 | 3300005544 | Ga0070686_100130902 | Ga0070686_1001309021 | 154 |
| 173 | 3300005544 | Ga0070686_100220726 | Ga0070686_1002207262 | 154 |
| 174 | 3300005544 | Ga0070686_100705965 | Ga0070686_1007059651 | 154 |
| 175 | 3300005545 | Ga0070695_100002468 | Ga0070695_1000024687 | 154 |
| 176 | 3300005545 | Ga0070695_100022402 | Ga0070695_1000224022 | 154 |
| 177 | 3300005545 | Ga0070695_100337306 | Ga0070695_1003373061 | 154 |
| 178 | 3300005546 | Ga0070696_100016233 | Ga0070696_1000162335 | 154 |
| 179 | 3300005546 | Ga0070696_100036951 | Ga0070696_1000369512 | 154 |
| 180 | 3300005546 | Ga0070696_100160329 | Ga0070696_1001603292 | 154 |
| 181 | 3300005549 | Ga0070704_100009365 | Ga0070704_1000093655 | 154 |
| 182 | 3300005549 | Ga0070704_100222089 | Ga0070704_1002220892 | 154 |
| 183 | 3300005549 | Ga0070704_100255264 | Ga0070704_1002552643 | 154 |
| 184 | 3300005549 | Ga0070704_100287858 | Ga0070704_1002878582 | 154 |
| 185 | 3300005549 | Ga0070704_100526392 | Ga0070704_1005263922 | 154 |
| 186 | 3300005563 | Ga0068855_100020797 | Ga0068855_1000207977 | 154 |
| 187 | 3300005578 | Ga0068854_100022971 | Ga0068854_1000229714 | 154 |
| 188 | 3300005578 | Ga0068854_100054657 | Ga0068854_1000546573 | 154 |
| 189 | 3300005614 | Ga0068856_101662602 | Ga0068856_1016626021 | 154 |
| 190 | 3300005615 | Ga0070702_100148269 | Ga0070702_1001482692 | 154 |
| 191 | 3300005616 | Ga0068852_100761296 | Ga0068852_1007612961 | 154 |
| 192 | 3300005617 | Ga0068859_100307837 | Ga0068859_1003078373 | 154 |
| 193 | 3300005617 | Ga0068859_101774045 | Ga0068859_1017740451 | 154 |
| 194 | 3300005618 | Ga0068864_100320508 | Ga0068864_1003205082 | 154 |
| 195 | 3300005618 | Ga0068864_100804435 | Ga0068864_1008044352 | 154 |
| 196 | 3300005618 | Ga0068864_100892196 | Ga0068864_1008921962 | 154 |
| 197 | 3300005718 | Ga0068866_10028362 | Ga0068866_100283623 | 154 |
| 198 | 3300005718 | Ga0068866_10039065 | Ga0068866_100390652 | 154 |
| 199 | 3300005719 | Ga0068861_100204237 | Ga0068861_1002042373 | 154 |
| 200 | 3300005719 | Ga0068861_100743154 | Ga0068861_1007431542 | 154 |
| 201 | 3300005719 | Ga0068861_100842988 | Ga0068861_1008429881 | 154 |
| 202 | 3300005719 | Ga0068861_101302462 | Ga0068861_1013024621 | 154 |
| 203 | 3300005719 | Ga0068861_101750132 | Ga0068861_1017501321 | 154 |
| 204 | 3300005834 | Ga0068851_10324873 | Ga0068851_103248731 | 154 |
| 205 | 3300005841 | Ga0068863_100616346 | Ga0068863_1006163462 | 154 |
| 206 | 3300005842 | Ga0068858_100006376 | Ga0068858_10000637611 | 154 |
| 207 | 3300005842 | Ga0068858_100159796 | Ga0068858_1001597961 | 154 |
| 208 | 3300005842 | Ga0068858_100392959 | Ga0068858_1003929592 | 154 |
| 209 | 3300005842 | Ga0068858_100728342 | Ga0068858_1007283421 | 154 |
| 210 | 3300005842 | Ga0068858_101318240 | Ga0068858_1013182401 | 154 |
| 211 | 3300005843 | Ga0068860_100137960 | Ga0068860_1001379601 | 154 |
| 212 | 3300005843 | Ga0068860_100351429 | Ga0068860_1003514291 | 154 |
| 213 | 3300005843 | Ga0068860_100764109 | Ga0068860_1007641092 | 154 |
| 214 | 3300005843 | Ga0068860_101751843 | Ga0068860_1017518431 | 154 |
| 215 | 3300005844 | Ga0068862_100007706 | Ga0068862_1000077065 | 154 |
| 216 | 3300005844 | Ga0068862_100023168 | Ga0068862_1000231684 | 154 |
| 217 | 3300005844 | Ga0068862_101281063 | Ga0068862_1012810631 | 154 |
| 218 | 3300005937 | Ga0081455_10337282 | Ga0081455_103372822 | 154 |
| 219 | 3300005985 | Ga0081539_10006423 | Ga0081539_100064233 | 154 |
| 220 | 3300006173 | Ga0070716_100041497 | Ga0070716_1000414973 | 154 |
| 221 | 3300006173 | Ga0070716_100093604 | Ga0070716_1000936041 | 154 |
| 222 | 3300006173 | Ga0070716_101371777 | Ga0070716_1013717772 | 154 |
| 223 | 3300006175 | Ga0070712_100273531 | Ga0070712_1002735313 | 154 |
| 224 | 3300006237 | Ga0097621_100003090 | Ga0097621_1000030903 | 154 |
| 225 | 3300006237 | Ga0097621_100201459 | Ga0097621_1002014592 | 154 |
| 226 | 3300006237 | Ga0097621_100276077 | Ga0097621_1002760772 | 154 |
| 227 | 3300006358 | Ga0068871_100001107 | Ga0068871_1000011073 | 154 |
| 228 | 3300006358 | Ga0068871_100538957 | Ga0068871_1005389571 | 154 |
| 229 | 3300006844 | Ga0075428_100081829 | Ga0075428_1000818294 | 154 |
| 230 | 3300006844 | Ga0075428_100117167 | Ga0075428_1001171673 | 154 |
| 231 | 3300006846 | Ga0075430_100168996 | Ga0075430_1001689963 | 154 |
| 232 | 3300006847 | Ga0075431_100390085 | Ga0075431_1003900852 | 154 |
| 233 | 3300006871 | Ga0075434_100042252 | Ga0075434_1000422524 | 154 |
| 234 | 3300006871 | Ga0075434_100091844 | Ga0075434_1000918442 | 154 |
| 235 | 3300006871 | Ga0075434_100101935 | Ga0075434_1001019353 | 154 |
| 236 | 3300006871 | Ga0075434_100485330 | Ga0075434_1004853302 | 154 |
| 237 | 3300006871 | Ga0075434_100588711 | Ga0075434_1005887113 | 154 |
| 238 | 3300006880 | Ga0075429_101696492 | Ga0075429_1016964921 | 154 |
| 239 | 3300006881 | Ga0068865_100022104 | Ga0068865_1000221042 | 154 |
| 240 | 3300006881 | Ga0068865_100294951 | Ga0068865_1002949512 | 154 |
| 241 | 3300006881 | Ga0068865_100383542 | Ga0068865_1003835422 | 154 |
| 242 | 3300006914 | Ga0075436_100014387 | Ga0075436_1000143875 | 154 |
| 243 | 3300006914 | Ga0075436_100081102 | Ga0075436_1000811023 | 154 |
| 244 | 3300006914 | Ga0075436_100085555 | Ga0075436_1000855553 | 154 |
| 245 | 3300006914 | Ga0075436_100261237 | Ga0075436_1002612371 | 154 |
| 246 | 3300006931 | Ga0097620_100307833 | Ga0097620_1003078333 | 154 |
| 247 | 3300006931 | Ga0097620_101774014 | Ga0097620_1017740141 | 154 |
| 248 | 3300007076 | Ga0075435_100007120 | Ga0075435_1000071204 | 154 |
| 249 | 3300007076 | Ga0075435_100060351 | Ga0075435_1000603513 | 154 |
| 250 | 3300007076 | Ga0075435_100420801 | Ga0075435_1004208011 | 154 |
| 251 | 3300007265 | Ga0099794_10064534 | Ga0099794_100645341 | 154 |
| 252 | 3300009093 | Ga0105240_10011543 | Ga0105240_100115437 | 154 |
| 253 | 3300009093 | Ga0105240_10130144 | Ga0105240_101301443 | 154 |
| 254 | 3300009094 | Ga0111539_10004585 | Ga0111539_1000458516 | 154 |
| 255 | 3300009094 | Ga0111539_10021248 | Ga0111539_100212484 | 154 |
| 256 | 3300009094 | Ga0111539_11236344 | Ga0111539_112363442 | 154 |
| 257 | 3300009094 | Ga0111539_11252228 | Ga0111539_112522281 | 154 |
| 258 | 3300009098 | Ga0105245_10408947 | Ga0105245_104089472 | 154 |
| 259 | 3300009098 | Ga0105245_10513788 | Ga0105245_105137881 | 154 |
| 260 | 3300009098 | Ga0105245_11813368 | Ga0105245_118133681 | 154 |
| 261 | 3300009101 | Ga0105247_10003746 | Ga0105247_100037467 | 154 |
| 262 | 3300009101 | Ga0105247_11147469 | Ga0105247_111474691 | 154 |
| 263 | 3300009147 | Ga0114129_10003005 | Ga0114129_1000300511 | 154 |
| 264 | 3300009147 | Ga0114129_10009590 | Ga0114129_100095908 | 154 |
| 265 | 3300009147 | Ga0114129_10255349 | Ga0114129_102553491 | 154 |
| 266 | 3300009147 | Ga0114129_10876055 | Ga0114129_108760551 | 154 |
| 267 | 3300009148 | Ga0105243_10005747 | Ga0105243_100057479 | 154 |
| 268 | 3300009148 | Ga0105243_10521592 | Ga0105243_105215922 | 154 |
| 269 | 3300009148 | Ga0105243_10632245 | Ga0105243_106322451 | 154 |
| 270 | 3300009148 | Ga0105243_10768920 | Ga0105243_107689201 | 154 |
| 271 | 3300009174 | Ga0105241_10016789 | Ga0105241_100167892 | 154 |
| 272 | 3300009174 | Ga0105241_10854544 | Ga0105241_108545441 | 154 |
| 273 | 3300009174 | Ga0105241_11263399 | Ga0105241_112633991 | 154 |
| 274 | 3300009176 | Ga0105242_10049063 | Ga0105242_100490633 | 154 |
| 275 | 3300009176 | Ga0105242_10178766 | Ga0105242_101787662 | 154 |
| 276 | 3300009176 | Ga0105242_11163647 | Ga0105242_111636472 | 154 |
| 277 | 3300009176 | Ga0105242_12412189 | Ga0105242_124121891 | 154 |
| 278 | 3300009177 | Ga0105248_10025874 | Ga0105248_100258745 | 154 |
| 279 | 3300009177 | Ga0105248_10051241 | Ga0105248_100512414 | 154 |
| 280 | 3300009177 | Ga0105248_10065729 | Ga0105248_100657291 | 154 |
| 281 | 3300009177 | Ga0105248_10662131 | Ga0105248_106621313 | 154 |
| 282 | 3300009177 | Ga0105248_11562907 | Ga0105248_115629071 | 154 |
| 283 | 3300009545 | Ga0105237_11681099 | Ga0105237_116810991 | 154 |
| 284 | 3300009551 | Ga0105238_10012691 | Ga0105238_100126918 | 154 |
| 285 | 3300009551 | Ga0105238_10724325 | Ga0105238_107243252 | 154 |
| 286 | 3300009553 | Ga0105249_10056160 | Ga0105249_100561605 | 154 |
| 287 | 3300009553 | Ga0105249_10655349 | Ga0105249_106553492 | 154 |
| 288 | 3300009553 | Ga0105249_11615739 | Ga0105249_116157391 | 154 |
| 289 | 3300010375 | Ga0105239_11456264 | Ga0105239_114562642 | 154 |
| 290 | 3300011119 | Ga0105246_10360153 | Ga0105246_103601532 | 154 |
| 291 | 3300011119 | Ga0105246_10424975 | Ga0105246_104249752 | 154 |
| 292 | 3300013105 | Ga0157369_11541658 | Ga0157369_115416581 | 154 |
| 293 | 3300013297 | Ga0157378_12002953 | Ga0157378_120029531 | 154 |
| 294 | 3300013307 | Ga0157372_10190407 | Ga0157372_101904072 | 154 |
| 295 | 3300013308 | Ga0157375_10066455 | Ga0157375_100664554 | 154 |
| 296 | 3300013308 | Ga0157375_10500098 | Ga0157375_105000981 | 154 |
| 297 | 3300013308 | Ga0157375_10740713 | Ga0157375_107407131 | 154 |
| 298 | 3300014325 | Ga0163163_10213898 | Ga0163163_102138982 | 154 |
| 299 | 3300014325 | Ga0163163_11444192 | Ga0163163_114441921 | 154 |
| 300 | 3300014326 | Ga0157380_10086536 | Ga0157380_100865362 | 154 |
| 301 | 3300014326 | Ga0157380_10353092 | Ga0157380_103530922 | 154 |
| 302 | 3300014326 | Ga0157380_10709760 | Ga0157380_107097602 | 154 |
| 303 | 3300014326 | Ga0157380_10777990 | Ga0157380_107779901 | 154 |
| 304 | 3300014745 | Ga0157377_10340699 | Ga0157377_103406992 | 154 |
| 305 | 3300014968 | Ga0157379_10005722 | Ga0157379_100057227 | 154 |
| 306 | 3300014968 | Ga0157379_10500991 | Ga0157379_105009912 | 154 |
| 307 | 3300014968 | Ga0157379_10971797 | Ga0157379_109717972 | 154 |
| 308 | 3300014969 | Ga0157376_10693536 | Ga0157376_106935361 | 154 |
| 309 | 3300015265 | Ga0182005_1245895 | Ga0182005_12458951 | 154 |
| 310 | 3300017792 | Ga0163161_10558140 | Ga0163161_105581401 | 154 |
| 311 | 3300025315 | Ga0207697_10110133 | Ga0207697_101101332 | 154 |
| 312 | 3300025893 | Ga0207682_10586084 | Ga0207682_105860841 | 154 |
| 313 | 3300025899 | Ga0207642_10015048 | Ga0207642_100150482 | 154 |
| 314 | 3300025899 | Ga0207642_10084503 | Ga0207642_100845033 | 154 |
| 315 | 3300025900 | Ga0207710_10005377 | Ga0207710_100053772 | 154 |
| 316 | 3300025901 | Ga0207688_10197285 | Ga0207688_101972852 | 154 |
| 317 | 3300025901 | Ga0207688_10331306 | Ga0207688_103313061 | 154 |
| 318 | 3300025901 | Ga0207688_10922933 | Ga0207688_109229331 | 154 |
| 319 | 3300025903 | Ga0207680_10136487 | Ga0207680_101364872 | 154 |
| 320 | 3300025903 | Ga0207680_10200845 | Ga0207680_102008452 | 154 |
| 321 | 3300025907 | Ga0207645_10011628 | Ga0207645_100116284 | 154 |
| 322 | 3300025907 | Ga0207645_10270858 | Ga0207645_102708581 | 154 |
| 323 | 3300025908 | Ga0207643_10062430 | Ga0207643_100624302 | 154 |
| 324 | 3300025908 | Ga0207643_10974830 | Ga0207643_109748301 | 154 |
| 325 | 3300025909 | Ga0207705_10116108 | Ga0207705_101161083 | 154 |
| 326 | 3300025910 | Ga0207684_10231337 | Ga0207684_102313371 | 154 |
| 327 | 3300025910 | Ga0207684_10355065 | Ga0207684_103550652 | 154 |
| 328 | 3300025910 | Ga0207684_10518406 | Ga0207684_105184061 | 154 |
| 329 | 3300025911 | Ga0207654_10018539 | Ga0207654_100185392 | 154 |
| 330 | 3300025911 | Ga0207654_10427680 | Ga0207654_104276801 | 154 |
| 331 | 3300025911 | Ga0207654_10811664 | Ga0207654_108116641 | 154 |
| 332 | 3300025912 | Ga0207707_10069371 | Ga0207707_100693712 | 154 |
| 333 | 3300025913 | Ga0207695_10035464 | Ga0207695_100354643 | 154 |
| 334 | 3300025913 | Ga0207695_10073089 | Ga0207695_100730893 | 154 |
| 335 | 3300025913 | Ga0207695_10385596 | Ga0207695_103855962 | 154 |
| 336 | 3300025915 | Ga0207693_10199072 | Ga0207693_101990722 | 154 |
| 337 | 3300025917 | Ga0207660_10045755 | Ga0207660_100457553 | 154 |
| 338 | 3300025918 | Ga0207662_10085309 | Ga0207662_100853092 | 154 |
| 339 | 3300025918 | Ga0207662_10576440 | Ga0207662_105764402 | 154 |
| 340 | 3300025919 | Ga0207657_10000448 | Ga0207657_100004484 | 154 |
| 341 | 3300025919 | Ga0207657_10622168 | Ga0207657_106221681 | 154 |
| 342 | 3300025920 | Ga0207649_10818863 | Ga0207649_108188631 | 154 |
| 343 | 3300025921 | Ga0207652_10074593 | Ga0207652_100745931 | 154 |
| 344 | 3300025921 | Ga0207652_10147531 | Ga0207652_101475311 | 154 |
| 345 | 3300025922 | Ga0207646_10402679 | Ga0207646_104026791 | 154 |
| 346 | 3300025923 | Ga0207681_10014493 | Ga0207681_100144935 | 154 |
| 347 | 3300025923 | Ga0207681_10022470 | Ga0207681_100224704 | 154 |
| 348 | 3300025923 | Ga0207681_10055231 | Ga0207681_100552312 | 154 |
| 349 | 3300025923 | Ga0207681_10267567 | Ga0207681_102675672 | 154 |
| 350 | 3300025923 | Ga0207681_10526870 | Ga0207681_105268701 | 154 |
| 351 | 3300025923 | Ga0207681_10883352 | Ga0207681_108833521 | 154 |
| 352 | 3300025923 | Ga0207681_11226757 | Ga0207681_112267571 | 154 |
| 353 | 3300025924 | Ga0207694_10075167 | Ga0207694_100751673 | 154 |
| 354 | 3300025924 | Ga0207694_11103807 | Ga0207694_111038071 | 154 |
| 355 | 3300025926 | Ga0207659_10107886 | Ga0207659_101078862 | 154 |
| 356 | 3300025927 | Ga0207687_10180945 | Ga0207687_101809452 | 154 |
| 357 | 3300025927 | Ga0207687_10727635 | Ga0207687_107276351 | 154 |
| 358 | 3300025931 | Ga0207644_10890390 | Ga0207644_108903901 | 154 |
| 359 | 3300025933 | Ga0207706_10078833 | Ga0207706_100788333 | 154 |
| 360 | 3300025934 | Ga0207686_10008837 | Ga0207686_100088372 | 154 |
| 361 | 3300025935 | Ga0207709_10108784 | Ga0207709_101087842 | 154 |
| 362 | 3300025935 | Ga0207709_10148014 | Ga0207709_101480142 | 154 |
| 363 | 3300025935 | Ga0207709_10736745 | Ga0207709_107367451 | 154 |
| 364 | 3300025936 | Ga0207670_10270448 | Ga0207670_102704482 | 154 |
| 365 | 3300025937 | Ga0207669_10063861 | Ga0207669_100638613 | 154 |
| 366 | 3300025937 | Ga0207669_10075630 | Ga0207669_100756303 | 154 |
| 367 | 3300025937 | Ga0207669_10163537 | Ga0207669_101635372 | 154 |
| 368 | 3300025938 | Ga0207704_10001915 | Ga0207704_1000191512 | 154 |
| 369 | 3300025938 | Ga0207704_10052554 | Ga0207704_100525543 | 154 |
| 370 | 3300025939 | Ga0207665_10059331 | Ga0207665_100593313 | 154 |
| 371 | 3300025939 | Ga0207665_10123932 | Ga0207665_101239323 | 154 |
| 372 | 3300025940 | Ga0207691_10058452 | Ga0207691_100584522 | 154 |
| 373 | 3300025940 | Ga0207691_10920530 | Ga0207691_109205301 | 154 |
| 374 | 3300025941 | Ga0207711_10026694 | Ga0207711_100266942 | 154 |
| 375 | 3300025941 | Ga0207711_10212815 | Ga0207711_102128152 | 154 |
| 376 | 3300025941 | Ga0207711_10248831 | Ga0207711_102488311 | 154 |
| 377 | 3300025941 | Ga0207711_11329138 | Ga0207711_113291381 | 154 |
| 378 | 3300025942 | Ga0207689_10032193 | Ga0207689_100321933 | 154 |
| 379 | 3300025944 | Ga0207661_10098762 | Ga0207661_100987623 | 154 |
| 380 | 3300025949 | Ga0207667_10131023 | Ga0207667_101310232 | 154 |
| 381 | 3300025949 | Ga0207667_10519938 | Ga0207667_105199381 | 154 |
| 382 | 3300025949 | Ga0207667_11983907 | Ga0207667_119839071 | 154 |
| 383 | 3300025960 | Ga0207651_10196938 | Ga0207651_101969381 | 154 |
| 384 | 3300025960 | Ga0207651_10359114 | Ga0207651_103591141 | 154 |
| 385 | 3300025961 | Ga0207712_10727976 | Ga0207712_107279762 | 154 |
| 386 | 3300025961 | Ga0207712_11863022 | Ga0207712_118630221 | 154 |
| 387 | 3300025972 | Ga0207668_10123390 | Ga0207668_101233903 | 154 |
| 388 | 3300025972 | Ga0207668_10177611 | Ga0207668_101776112 | 154 |
| 389 | 3300025981 | Ga0207640_10009623 | Ga0207640_100096232 | 154 |
| 390 | 3300025981 | Ga0207640_10485473 | Ga0207640_104854732 | 154 |
| 391 | 3300025981 | Ga0207640_10536156 | Ga0207640_105361562 | 154 |
| 392 | 3300025986 | Ga0207658_10554222 | Ga0207658_105542222 | 154 |
| 393 | 3300025986 | Ga0207658_10824651 | Ga0207658_108246511 | 154 |
| 394 | 3300026035 | Ga0207703_10157010 | Ga0207703_101570102 | 154 |
| 395 | 3300026035 | Ga0207703_10419059 | Ga0207703_104190591 | 154 |
| 396 | 3300026035 | Ga0207703_10788649 | Ga0207703_107886492 | 154 |
| 397 | 3300026035 | Ga0207703_10813619 | Ga0207703_108136191 | 154 |
| 398 | 3300026041 | Ga0207639_10161244 | Ga0207639_101612441 | 154 |
| 399 | 3300026067 | Ga0207678_10073614 | Ga0207678_100736142 | 154 |
| 400 | 3300026067 | Ga0207678_10089975 | Ga0207678_100899752 | 154 |
| 401 | 3300026075 | Ga0207708_10004076 | Ga0207708_100040762 | 154 |
| 402 | 3300026075 | Ga0207708_10066324 | Ga0207708_100663241 | 154 |
| 403 | 3300026075 | Ga0207708_10705813 | Ga0207708_107058132 | 154 |
| 404 | 3300026088 | Ga0207641_10546006 | Ga0207641_105460062 | 154 |
| 405 | 3300026089 | Ga0207648_10000802 | Ga0207648_1000080215 | 154 |
| 406 | 3300026089 | Ga0207648_10017964 | Ga0207648_100179643 | 154 |
| 407 | 3300026089 | Ga0207648_10307167 | Ga0207648_103071671 | 154 |
| 408 | 3300026089 | Ga0207648_10351353 | Ga0207648_103513532 | 154 |
| 409 | 3300026089 | Ga0207648_10503879 | Ga0207648_105038792 | 154 |
| 410 | 3300026095 | Ga0207676_10172785 | Ga0207676_101727852 | 154 |
| 411 | 3300026095 | Ga0207676_10782536 | Ga0207676_107825362 | 154 |
| 412 | 3300026116 | Ga0207674_12099102 | Ga0207674_120991021 | 154 |
| 413 | 3300026118 | Ga0207675_100003438 | Ga0207675_1000034386 | 154 |
| 414 | 3300026118 | Ga0207675_100008037 | Ga0207675_1000080373 | 154 |
| 415 | 3300026118 | Ga0207675_100026637 | Ga0207675_1000266372 | 154 |
| 416 | 3300026118 | Ga0207675_100082000 | Ga0207675_1000820003 | 154 |
| 417 | 3300026118 | Ga0207675_100295147 | Ga0207675_1002951473 | 154 |
| 418 | 3300026118 | Ga0207675_100297167 | Ga0207675_1002971672 | 154 |
| 419 | 3300027907 | Ga0207428_10008383 | Ga0207428_100083837 | 154 |
| 420 | 3300027907 | Ga0207428_10058793 | Ga0207428_100587934 | 154 |
| 421 | 3300027907 | Ga0207428_10942401 | Ga0207428_109424011 | 154 |
| 422 | 3300028379 | Ga0268266_10797775 | Ga0268266_107977752 | 154 |
| 423 | 3300028380 | Ga0268265_10004006 | Ga0268265_100040066 | 154 |
| 424 | 3300028380 | Ga0268265_10030648 | Ga0268265_100306483 | 154 |
| 425 | 3300028380 | Ga0268265_10154862 | Ga0268265_101548622 | 154 |
| 426 | 3300028380 | Ga0268265_10195042 | Ga0268265_101950422 | 154 |
| 427 | 3300028380 | Ga0268265_10352745 | Ga0268265_103527451 | 154 |
| 428 | 3300028381 | Ga0268264_10128495 | Ga0268264_101284953 | 154 |
| 429 | 3300028381 | Ga0268264_10142874 | Ga0268264_101428742 | 154 |
| 430 | 3300028381 | Ga0268264_10168656 | Ga0268264_101686562 | 154 |
| 431 | 3300028381 | Ga0268264_11202200 | Ga0268264_112022001 | 154 |
| 432 | 3300028381 | Ga0268264_11987719 | Ga0268264_119877191 | 154 |
| 433 | 3300028381 | Ga0268264_12128022 | Ga0268264_121280221 | 154 |
| 434 | 3300031344 | Ga0265316_10282318 | Ga0265316_102823181 | 154 |
| 435 | 3300031548 | Ga0307408_100460014 | Ga0307408_1004600142 | 154 |
| 436 | 3300031548 | Ga0307408_100634881 | Ga0307408_1006348811 | 154 |
| 437 | 3300031711 | Ga0265314_10120161 | Ga0265314_101201612 | 154 |
| 438 | 3300031731 | Ga0307405_10551294 | Ga0307405_105512941 | 154 |
| 439 | 3300031824 | Ga0307413_11005855 | Ga0307413_110058551 | 154 |
| 440 | 3300031852 | Ga0307410_10907490 | Ga0307410_109074901 | 154 |
| 441 | 3300031903 | Ga0307407_10253003 | Ga0307407_102530031 | 154 |
| 442 | 3300031903 | Ga0307407_10266700 | Ga0307407_102667001 | 154 |
| 443 | 3300031911 | Ga0307412_11397689 | Ga0307412_113976892 | 154 |
| 444 | 3300032002 | Ga0307416_101080945 | Ga0307416_1010809452 | 154 |
| 445 | 3300032005 | Ga0307411_10015044 | Ga0307411_100150444 | 154 |
| 446 | 3300032005 | Ga0307411_11917682 | Ga0307411_119176821 | 154 |
| 447 | 3300034817 | Ga0373948_0006326 | Ga0373948_0006326_397_867 | 154 |
| 448 | 3300034957 | Ga0373938_0152264 | Ga0373938_0152264_19_489 | 154 |
| 449 | 3300035084 | Ga0373928_0007511 | Ga0373928_0007511_1604_2074 | 154 |
| 450 | 3300035088 | Ga0373940_0271815 | Ga0373940_0271815_46_516 | 154 |
| 451 | 3300035089 | Ga0373944_0149309 | Ga0373944_0149309_10_474 | 154 |
| 452 | 3300035090 | Ga0373949_0002163 | Ga0373949_0002163_1105_1575 | 154 |
| 453 | 3300035091 | Ga0373951_0007755 | Ga0373951_0007755_1122_1592 | 154 |
| 454 | 3300035092 | Ga0373952_0003771 | Ga0373952_0003771_67_537 | 154 |
| 455 | 3300035112 | Ga0373932_0006339 | Ga0373932_0006339_2204_2674 | 154 |
| 456 | 3300035112 | Ga0373932_0167821 | Ga0373932_0167821_263_727 | 154 |
| 457 | 3300035114 | Ga0373939_0015830 | Ga0373939_0015830_769_1239 | 154 |
| 458 | 3300035115 | Ga0373941_0000343 | Ga0373941_0000343_7821_8291 | 154 |
| 459 | 3300035121 | Ga0373960_0001256 | Ga0373960_0001256_4178_4648 | 154 |
| 460 | 3300035171 | Ga0373946_0069755 | Ga0373946_0069755_346_813 | 154 |
| 461 | 3300035241 | Ga0373961_0062944 | Ga0373961_0062944_558_1028 | 154 |
| 462 | 3300035242 | Ga0373962_0001870 | Ga0373962_0001870_50_520 | 154 |
| 463 | 3300035691 | Ga0373931_0001339 | Ga0373931_0001339_2517_2987 | 154 |
| 464 | 3300035691 | Ga0373931_0082457 | Ga0373931_0082457_866_1345 | 154 |
| 465 | 3300035691 | Ga0373931_0120135 | Ga0373931_0120135_894_1361 | 154 |
| 466 | 3300036401 | Ga0373937_0159180 | Ga0373937_0159180_633_1100 | 154 |
| 467 | 3300037068 | Ga0373925_0241361 | Ga0373925_0241361_887_1354 | 154 |
| 468 | 3300041459 | Ga0451800_1621613 | Ga0451800_1621613_60_530 | 154 |
| 469 | 3300045051 | Ga0451576_0010882 | Ga0451576_0010882_7828_8298 | 154 |
| 470 | 3300045051 | Ga0451576_0679933 | Ga0451576_0679933_125_592 | 154 |
| 471 | 3300046454 | Ga0495592_0322612 | Ga0495592_0322612_69_536 | 154 |
| 472 | 3300046472 | Ga0495580_0073772 | Ga0495580_0073772_336_800 | 154 |
| 473 | 3300046477 | Ga0495664_0695675 | Ga0495664_0695675_20_487 | 154 |
| 474 | 3300046506 | Ga0495583_0160906 | Ga0495583_0160906_214_678 | 154 |
| 475 | 3300046517 | Ga0495630_0117208 | Ga0495630_0117208_944_1411 | 154 |
| 476 | 3300046517 | Ga0495630_0177025 | Ga0495630_0177025_740_1207 | 154 |
| 477 | 3300046525 | Ga0495663_0265200 | Ga0495663_0265200_14_484 | 154 |
| 478 | 3300046526 | Ga0495666_0322956 | Ga0495666_0322956_10_477 | 154 |
| 479 | 3300046535 | Ga0495586_0569150 | Ga0495586_0569150_177_641 | 154 |
| 480 | 3300046539 | Ga0495621_0097697 | Ga0495621_0097697_478_945 | 154 |
| 481 | 3300046642 | Ga0495634_0423410 | Ga0495634_0423410_244_711 | 154 |
| 482 | 3300046663 | Ga0495635_0197813 | Ga0495635_0197813_839_1306 | 154 |
| 483 | 3300046681 | Ga0495647_0115562 | Ga0495647_0115562_423_893 | 154 |
| 484 | 3300046681 | Ga0495647_0299780 | Ga0495647_0299780_181_648 | 154 |
| 485 | 3300046683 | Ga0495658_0058218 | Ga0495658_0058218_131_598 | 154 |
| 486 | 3300047319 | Ga0495674_0106880 | Ga0495674_0106880_154_621 | 154 |
| 487 | 3300047322 | Ga0495680_0943251 | Ga0495680_0943251_69_536 | 154 |
| 488 | 3300047471 | Ga0495684_0160441 | Ga0495684_0160441_1109_1576 | 154 |
| 489 | 3300048088 | Ga0495602_0600681 | Ga0495602_0600681_100_567 | 154 |
| 490 | 3300048905 | Ga0496102_0067969 | Ga0496102_0067969_316_780 | 154 |
| 491 | 3300048905 | Ga0496102_0091619 | Ga0496102_0091619_1900_2367 | 154 |
| 492 | 3300048905 | Ga0496102_1415078 | Ga0496102_1415078_44_514 | 154 |
| 493 | 3300048906 | Ga0496103_0316398 | Ga0496103_0316398_372_836 | 154 |
| 494 | 3300048906 | Ga0496103_0750067 | Ga0496103_0750067_85_555 | 154 |
| 495 | 3300048907 | Ga0496104_1590651 | Ga0496104_1590651_57_521 | 154 |
| 496 | 3300048909 | Ga0496106_0776202 | Ga0496106_0776202_110_580 | 154 |
| 497 | 3300048909 | Ga0496106_1183616 | Ga0496106_1183616_113_577 | 154 |
| 498 | 3300048912 | Ga0496109_1098377 | Ga0496109_1098377_13_477 | 154 |
| 499 | 3300048916 | Ga0496113_0354640 | Ga0496113_0354640_342_806 | 154 |
| 500 | 3300049583 | Ga0501067_0625052 | Ga0501067_0625052_124_594 | 154 |
| 501 | 3300049591 | Ga0501075_0077467 | Ga0501075_0077467_1194_1658 | 154 |
| 502 | 3300050507 | nmdc:mga05p37_11228_c1 | nmdc:mga05p37_11228_c1_4875_5342 | 154 |
| 503 | 3300050507 | nmdc:mga05p37_156059_c1 | nmdc:mga05p37_156059_c1_1234_1698 | 154 |
| 504 | 3300050507 | nmdc:mga05p37_32801_c1 | nmdc:mga05p37_32801_c1_871_1341 | 154 |
| 505 | 3300050507 | nmdc:mga05p37_386041_c1 | nmdc:mga05p37_386041_c1_550_1017 | 154 |
| 506 | 3300050507 | nmdc:mga05p37_47284_c1 | nmdc:mga05p37_47284_c1_574_1044 | 154 |
| 507 | 3300050508 | nmdc:mga09592_76446_c1 | nmdc:mga09592_76446_c1_42_515 | 154 |
| 508 | 3300050510 | nmdc:mga06r32_337151_c1 | nmdc:mga06r32_337151_c1_649_1119 | 154 |
| 509 | 3300050511 | nmdc:mga08y16_168554_c1 | nmdc:mga08y16_168554_c1_1419_1892 | 154 |
| 510 | 3300050511 | nmdc:mga08y16_19092_c1 | nmdc:mga08y16_19092_c1_6672_7142 | 154 |
| 511 | 3300050511 | nmdc:mga08y16_683_c1 | nmdc:mga08y16_683_c1_19710_20177 | 154 |
| 512 | 3300050511 | nmdc:mga08y16_800102_c1 | nmdc:mga08y16_800102_c1_408_881 | 154 |
| 513 | 3300050512 | nmdc:mga0n895_357886_c1 | nmdc:mga0n895_357886_c1_214_684 | 154 |
| 514 | 3300050512 | nmdc:mga0n895_42983_c1 | nmdc:mga0n895_42983_c1_2468_2938 | 154 |
| 515 | 3300050512 | nmdc:mga0n895_454300_c1 | nmdc:mga0n895_454300_c1_729_1199 | 154 |
| 516 | 3300050512 | nmdc:mga0n895_632267_c1 | nmdc:mga0n895_632267_c1_132_602 | 154 |
| 517 | 3300050512 | nmdc:mga0n895_71935_c1 | nmdc:mga0n895_71935_c1_2576_3046 | 154 |
| 518 | 3300050513 | nmdc:mga0rr50_10783_c1 | nmdc:mga0rr50_10783_c1_10_480 | 154 |
| 519 | 3300050513 | nmdc:mga0rr50_1258634_c1 | nmdc:mga0rr50_1258634_c1_64_531 | 154 |
| 520 | 3300050513 | nmdc:mga0rr50_321957_c1 | nmdc:mga0rr50_321957_c1_531_995 | 154 |
| 521 | 3300050513 | nmdc:mga0rr50_373910_c1 | nmdc:mga0rr50_373910_c1_646_1113 | 154 |
| 522 | 3300050513 | nmdc:mga0rr50_49091_c1 | nmdc:mga0rr50_49091_c1_1478_1948 | 154 |
| 523 | 3300050513 | nmdc:mga0rr50_690846_c1 | nmdc:mga0rr50_690846_c1_187_657 | 154 |
| 524 | 3300050514 | nmdc:mga08x19_150702_c1 | nmdc:mga08x19_150702_c1_724_1191 | 154 |
| 525 | 3300050514 | nmdc:mga08x19_245572_c1 | nmdc:mga08x19_245572_c1_87_557 | 154 |
| 526 | 3300050514 | nmdc:mga08x19_422416_c1 | nmdc:mga08x19_422416_c1_218_682 | 154 |
| 527 | 3300050514 | nmdc:mga08x19_8172_c1 | nmdc:mga08x19_8172_c1_1131_1601 | 154 |
| 528 | 3300050514 | nmdc:mga08x19_88202_c1 | nmdc:mga08x19_88202_c1_48_518 | 154 |
| 529 | 3300050515 | nmdc:mga0a205_1005171_c1 | nmdc:mga0a205_1005171_c1_114_587 | 154 |
| 530 | 3300050515 | nmdc:mga0a205_154044_c1 | nmdc:mga0a205_154044_c1_1720_2184 | 154 |
| 531 | 3300050515 | nmdc:mga0a205_818286_c1 | nmdc:mga0a205_818286_c1_85_555 | 154 |
| 532 | 3300053077 | Ga0495601_0498053 | Ga0495601_0498053_252_719 | 154 |
| 533 | 3300053085 | Ga0495619_0008562 | Ga0495619_0008562_2826_3293 | 154 |
| 534 | 3300059424 | Ga0590075_045219 | Ga0590075_045219_147_626 | 154 |
| 535 | 3300059426 | Ga0590077_091703 | Ga0590077_091703_73_552 | 154 |
| 536 | 3300000044 | ARSoilOldRDRAFT_c005815 | ARSoilOldRDRAFT_0058151 | 155 |
| 537 | 3300001977 | JGI24746J21847_1000635 | JGI24746J21847_10006352 | 155 |
| 538 | 3300003320 | rootH2_10206308 | rootH2_102063082 | 155 |
| 539 | 3300004798 | Ga0058859_11634508 | Ga0058859_116345081 | 155 |
| 540 | 3300004801 | Ga0058860_12130943 | Ga0058860_121309431 | 155 |
| 541 | 3300005288 | Ga0065714_10021748 | Ga0065714_100217482 | 155 |
| 542 | 3300005289 | Ga0065704_10014277 | Ga0065704_100142772 | 155 |
| 543 | 3300005290 | Ga0065712_10000373 | Ga0065712_1000037310 | 155 |
| 544 | 3300005290 | Ga0065712_10008353 | Ga0065712_100083533 | 155 |
| 545 | 3300005290 | Ga0065712_10080010 | Ga0065712_100800103 | 155 |
| 546 | 3300005290 | Ga0065712_10086798 | Ga0065712_100867982 | 155 |
| 547 | 3300005290 | Ga0065712_10119676 | Ga0065712_101196762 | 155 |
| 548 | 3300005290 | Ga0065712_10369363 | Ga0065712_103693632 | 155 |
| 549 | 3300005293 | Ga0065715_10089661 | Ga0065715_100896617 | 155 |
| 550 | 3300005293 | Ga0065715_10094316 | Ga0065715_100943163 | 155 |
| 551 | 3300005293 | Ga0065715_10137491 | Ga0065715_101374912 | 155 |
| 552 | 3300005293 | Ga0065715_10283272 | Ga0065715_102832721 | 155 |
| 553 | 3300005295 | Ga0065707_10107323 | Ga0065707_101073231 | 155 |
| 554 | 3300005295 | Ga0065707_10107853 | Ga0065707_101078531 | 155 |
| 555 | 3300005295 | Ga0065707_10195881 | Ga0065707_101958812 | 155 |
| 556 | 3300005295 | Ga0065707_10342578 | Ga0065707_103425781 | 155 |
| 557 | 3300005295 | Ga0065707_10847730 | Ga0065707_108477301 | 155 |
| 558 | 3300005328 | Ga0070676_10115721 | Ga0070676_101157211 | 155 |
| 559 | 3300005328 | Ga0070676_10169845 | Ga0070676_101698451 | 155 |
| 560 | 3300005328 | Ga0070676_11239471 | Ga0070676_112394711 | 155 |
| 561 | 3300005330 | Ga0070690_100047569 | Ga0070690_1000475692 | 155 |
| 562 | 3300005330 | Ga0070690_100071050 | Ga0070690_1000710502 | 155 |
| 563 | 3300005330 | Ga0070690_100194594 | Ga0070690_1001945942 | 155 |
| 564 | 3300005330 | Ga0070690_100803169 | Ga0070690_1008031691 | 155 |
| 565 | 3300005331 | Ga0070670_100068895 | Ga0070670_1000688952 | 155 |
| 566 | 3300005331 | Ga0070670_100073656 | Ga0070670_1000736562 | 155 |
| 567 | 3300005331 | Ga0070670_100190877 | Ga0070670_1001908772 | 155 |
| 568 | 3300005331 | Ga0070670_100387010 | Ga0070670_1003870102 | 155 |
| 569 | 3300005333 | Ga0070677_10004638 | Ga0070677_100046383 | 155 |
| 570 | 3300005333 | Ga0070677_10071396 | Ga0070677_100713962 | 155 |
| 571 | 3300005333 | Ga0070677_10105968 | Ga0070677_101059681 | 155 |
| 572 | 3300005333 | Ga0070677_10213751 | Ga0070677_102137512 | 155 |
| 573 | 3300005334 | Ga0068869_100008204 | Ga0068869_1000082044 | 155 |
| 574 | 3300005334 | Ga0068869_100358631 | Ga0068869_1003586312 | 155 |
| 575 | 3300005335 | Ga0070666_10332421 | Ga0070666_103324211 | 155 |
| 576 | 3300005335 | Ga0070666_10575274 | Ga0070666_105752741 | 155 |
| 577 | 3300005336 | Ga0070680_100906617 | Ga0070680_1009066171 | 155 |
| 578 | 3300005336 | Ga0070680_101818216 | Ga0070680_1018182161 | 155 |
| 579 | 3300005338 | Ga0068868_100630411 | Ga0068868_1006304111 | 155 |
| 580 | 3300005338 | Ga0068868_101039303 | Ga0068868_1010393031 | 155 |
| 581 | 3300005339 | Ga0070660_100154283 | Ga0070660_1001542832 | 155 |
| 582 | 3300005340 | Ga0070689_100092599 | Ga0070689_1000925992 | 155 |
| 583 | 3300005340 | Ga0070689_100211104 | Ga0070689_1002111042 | 155 |
| 584 | 3300005340 | Ga0070689_100357903 | Ga0070689_1003579032 | 155 |
| 585 | 3300005340 | Ga0070689_100368543 | Ga0070689_1003685432 | 155 |
| 586 | 3300005343 | Ga0070687_100003556 | Ga0070687_1000035564 | 155 |
| 587 | 3300005344 | Ga0070661_100027569 | Ga0070661_1000275694 | 155 |
| 588 | 3300005344 | Ga0070661_100276763 | Ga0070661_1002767632 | 155 |
| 589 | 3300005344 | Ga0070661_101115107 | Ga0070661_1011151071 | 155 |
| 590 | 3300005347 | Ga0070668_100100000 | Ga0070668_1001000002 | 155 |
| 591 | 3300005347 | Ga0070668_100148140 | Ga0070668_1001481402 | 155 |
| 592 | 3300005347 | Ga0070668_100177775 | Ga0070668_1001777752 | 155 |
| 593 | 3300005347 | Ga0070668_101486300 | Ga0070668_1014863001 | 155 |
| 594 | 3300005347 | Ga0070668_102072717 | Ga0070668_1020727171 | 155 |
| 595 | 3300005353 | Ga0070669_100004321 | Ga0070669_1000043213 | 155 |
| 596 | 3300005353 | Ga0070669_100146488 | Ga0070669_1001464882 | 155 |
| 597 | 3300005353 | Ga0070669_100192345 | Ga0070669_1001923452 | 155 |
| 598 | 3300005353 | Ga0070669_100202752 | Ga0070669_1002027522 | 155 |
| 599 | 3300005353 | Ga0070669_100304132 | Ga0070669_1003041321 | 155 |
| 600 | 3300005353 | Ga0070669_100897182 | Ga0070669_1008971821 | 155 |
| 601 | 3300005354 | Ga0070675_100011134 | Ga0070675_1000111344 | 155 |
| 602 | 3300005354 | Ga0070675_100015561 | Ga0070675_1000155613 | 155 |
| 603 | 3300005354 | Ga0070675_100104614 | Ga0070675_1001046142 | 155 |
| 604 | 3300005354 | Ga0070675_100141512 | Ga0070675_1001415122 | 155 |
| 605 | 3300005354 | Ga0070675_100259780 | Ga0070675_1002597802 | 155 |
| 606 | 3300005354 | Ga0070675_100999716 | Ga0070675_1009997162 | 155 |
| 607 | 3300005355 | Ga0070671_100242860 | Ga0070671_1002428602 | 155 |
| 608 | 3300005356 | Ga0070674_100001261 | Ga0070674_10000126111 | 155 |
| 609 | 3300005356 | Ga0070674_100110747 | Ga0070674_1001107471 | 155 |
| 610 | 3300005356 | Ga0070674_100843913 | Ga0070674_1008439131 | 155 |
| 611 | 3300005356 | Ga0070674_101630815 | Ga0070674_1016308151 | 155 |
| 612 | 3300005356 | Ga0070674_101822367 | Ga0070674_1018223671 | 155 |
| 613 | 3300005364 | Ga0070673_100006876 | Ga0070673_1000068763 | 155 |
| 614 | 3300005364 | Ga0070673_100179758 | Ga0070673_1001797582 | 155 |
| 615 | 3300005364 | Ga0070673_100348781 | Ga0070673_1003487811 | 155 |
| 616 | 3300005364 | Ga0070673_100373137 | Ga0070673_1003731372 | 155 |
| 617 | 3300005364 | Ga0070673_100425224 | Ga0070673_1004252242 | 155 |
| 618 | 3300005364 | Ga0070673_100863626 | Ga0070673_1008636261 | 155 |
| 619 | 3300005365 | Ga0070688_100069819 | Ga0070688_1000698192 | 155 |
| 620 | 3300005365 | Ga0070688_100071597 | Ga0070688_1000715972 | 155 |
| 621 | 3300005365 | Ga0070688_100073223 | Ga0070688_1000732232 | 155 |
| 622 | 3300005365 | Ga0070688_100108645 | Ga0070688_1001086452 | 155 |
| 623 | 3300005365 | Ga0070688_100162799 | Ga0070688_1001627992 | 155 |
| 624 | 3300005365 | Ga0070688_100325846 | Ga0070688_1003258461 | 155 |
| 625 | 3300005365 | Ga0070688_100353396 | Ga0070688_1003533962 | 155 |
| 626 | 3300005365 | Ga0070688_100796916 | Ga0070688_1007969161 | 155 |
| 627 | 3300005366 | Ga0070659_100355655 | Ga0070659_1003556552 | 155 |
| 628 | 3300005367 | Ga0070667_100028388 | Ga0070667_1000283884 | 155 |
| 629 | 3300005367 | Ga0070667_100091938 | Ga0070667_1000919382 | 155 |
| 630 | 3300005367 | Ga0070667_100430202 | Ga0070667_1004302021 | 155 |
| 631 | 3300005438 | Ga0070701_10006936 | Ga0070701_100069365 | 155 |
| 632 | 3300005438 | Ga0070701_10040039 | Ga0070701_100400392 | 155 |
| 633 | 3300005438 | Ga0070701_10045069 | Ga0070701_100450692 | 155 |
| 634 | 3300005438 | Ga0070701_10345288 | Ga0070701_103452882 | 155 |
| 635 | 3300005440 | Ga0070705_100057678 | Ga0070705_1000576782 | 155 |
| 636 | 3300005440 | Ga0070705_100653574 | Ga0070705_1006535742 | 155 |
| 637 | 3300005441 | Ga0070700_100015844 | Ga0070700_1000158442 | 155 |
| 638 | 3300005441 | Ga0070700_100047841 | Ga0070700_1000478412 | 155 |
| 639 | 3300005441 | Ga0070700_100060756 | Ga0070700_1000607562 | 155 |
| 640 | 3300005441 | Ga0070700_100106558 | Ga0070700_1001065582 | 155 |
| 641 | 3300005441 | Ga0070700_100519330 | Ga0070700_1005193301 | 155 |
| 642 | 3300005441 | Ga0070700_100827293 | Ga0070700_1008272931 | 155 |
| 643 | 3300005444 | Ga0070694_100373610 | Ga0070694_1003736102 | 155 |
| 644 | 3300005445 | Ga0070708_100211381 | Ga0070708_1002113812 | 155 |
| 645 | 3300005455 | Ga0070663_100680321 | Ga0070663_1006803212 | 155 |
| 646 | 3300005456 | Ga0070678_100028346 | Ga0070678_1000283463 | 155 |
| 647 | 3300005456 | Ga0070678_100561889 | Ga0070678_1005618891 | 155 |
| 648 | 3300005456 | Ga0070678_102356987 | Ga0070678_1023569871 | 155 |
| 649 | 3300005457 | Ga0070662_100028176 | Ga0070662_1000281762 | 155 |
| 650 | 3300005457 | Ga0070662_100148813 | Ga0070662_1001488131 | 155 |
| 651 | 3300005457 | Ga0070662_100180495 | Ga0070662_1001804951 | 155 |
| 652 | 3300005457 | Ga0070662_100268608 | Ga0070662_1002686081 | 155 |
| 653 | 3300005459 | Ga0068867_100082617 | Ga0068867_1000826172 | 155 |
| 654 | 3300005459 | Ga0068867_100410134 | Ga0068867_1004101342 | 155 |
| 655 | 3300005459 | Ga0068867_100650980 | Ga0068867_1006509801 | 155 |
| 656 | 3300005459 | Ga0068867_100867712 | Ga0068867_1008677122 | 155 |
| 657 | 3300005459 | Ga0068867_101540035 | Ga0068867_1015400351 | 155 |
| 658 | 3300005466 | Ga0070685_10068966 | Ga0070685_100689662 | 155 |
| 659 | 3300005466 | Ga0070685_10085415 | Ga0070685_100854151 | 155 |
| 660 | 3300005466 | Ga0070685_10221116 | Ga0070685_102211162 | 155 |
| 661 | 3300005466 | Ga0070685_10363763 | Ga0070685_103637632 | 155 |
| 662 | 3300005466 | Ga0070685_10815907 | Ga0070685_108159071 | 155 |
| 663 | 3300005466 | Ga0070685_10842732 | Ga0070685_108427321 | 155 |
| 664 | 3300005468 | Ga0070707_100035611 | Ga0070707_1000356113 | 155 |
| 665 | 3300005518 | Ga0070699_100705653 | Ga0070699_1007056531 | 155 |
| 666 | 3300005530 | Ga0070679_101868748 | Ga0070679_1018687481 | 155 |
| 667 | 3300005536 | Ga0070697_100327541 | Ga0070697_1003275411 | 155 |
| 668 | 3300005543 | Ga0070672_100043187 | Ga0070672_1000431872 | 155 |
| 669 | 3300005543 | Ga0070672_100063994 | Ga0070672_1000639942 | 155 |
| 670 | 3300005543 | Ga0070672_100199170 | Ga0070672_1001991702 | 155 |
| 671 | 3300005543 | Ga0070672_100784755 | Ga0070672_1007847552 | 155 |
| 672 | 3300005543 | Ga0070672_100790618 | Ga0070672_1007906181 | 155 |
| 673 | 3300005544 | Ga0070686_100031463 | Ga0070686_1000314632 | 155 |
| 674 | 3300005544 | Ga0070686_100085056 | Ga0070686_1000850562 | 155 |
| 675 | 3300005545 | Ga0070695_100016243 | Ga0070695_1000162434 | 155 |
| 676 | 3300005545 | Ga0070695_100961961 | Ga0070695_1009619611 | 155 |
| 677 | 3300005548 | Ga0070665_100322689 | Ga0070665_1003226892 | 155 |
| 678 | 3300005549 | Ga0070704_100119305 | Ga0070704_1001193052 | 155 |
| 679 | 3300005549 | Ga0070704_100654531 | Ga0070704_1006545312 | 155 |
| 680 | 3300005549 | Ga0070704_101049520 | Ga0070704_1010495202 | 155 |
| 681 | 3300005564 | Ga0070664_100024009 | Ga0070664_1000240094 | 155 |
| 682 | 3300005564 | Ga0070664_100118928 | Ga0070664_1001189282 | 155 |
| 683 | 3300005564 | Ga0070664_100134973 | Ga0070664_1001349731 | 155 |
| 684 | 3300005564 | Ga0070664_100269325 | Ga0070664_1002693252 | 155 |
| 685 | 3300005577 | Ga0068857_100102707 | Ga0068857_1001027072 | 155 |
| 686 | 3300005577 | Ga0068857_100120998 | Ga0068857_1001209982 | 155 |
| 687 | 3300005577 | Ga0068857_100510647 | Ga0068857_1005106472 | 155 |
| 688 | 3300005577 | Ga0068857_100558327 | Ga0068857_1005583272 | 155 |
| 689 | 3300005577 | Ga0068857_100978243 | Ga0068857_1009782431 | 155 |
| 690 | 3300005615 | Ga0070702_100431735 | Ga0070702_1004317351 | 155 |
| 691 | 3300005615 | Ga0070702_100434359 | Ga0070702_1004343591 | 155 |
| 692 | 3300005616 | Ga0068852_100166490 | Ga0068852_1001664902 | 155 |
| 693 | 3300005617 | Ga0068859_100002669 | Ga0068859_1000026698 | 155 |
| 694 | 3300005617 | Ga0068859_100128259 | Ga0068859_1001282591 | 155 |
| 695 | 3300005617 | Ga0068859_100160182 | Ga0068859_1001601822 | 155 |
| 696 | 3300005617 | Ga0068859_100420487 | Ga0068859_1004204871 | 155 |
| 697 | 3300005617 | Ga0068859_100982350 | Ga0068859_1009823502 | 155 |
| 698 | 3300005618 | Ga0068864_100040716 | Ga0068864_1000407163 | 155 |
| 699 | 3300005618 | Ga0068864_100167280 | Ga0068864_1001672802 | 155 |
| 700 | 3300005718 | Ga0068866_10160996 | Ga0068866_101609962 | 155 |
| 701 | 3300005718 | Ga0068866_10731106 | Ga0068866_107311062 | 155 |
| 702 | 3300005719 | Ga0068861_100023735 | Ga0068861_1000237353 | 155 |
| 703 | 3300005719 | Ga0068861_100038017 | Ga0068861_1000380171 | 155 |
| 704 | 3300005719 | Ga0068861_100410940 | Ga0068861_1004109402 | 155 |
| 705 | 3300005719 | Ga0068861_101831395 | Ga0068861_1018313951 | 155 |
| 706 | 3300005840 | Ga0068870_10397874 | Ga0068870_103978742 | 155 |
| 707 | 3300005841 | Ga0068863_100040460 | Ga0068863_1000404602 | 155 |
| 708 | 3300005841 | Ga0068863_100227413 | Ga0068863_1002274132 | 155 |
| 709 | 3300005841 | Ga0068863_100343678 | Ga0068863_1003436782 | 155 |
| 710 | 3300005842 | Ga0068858_100097573 | Ga0068858_1000975732 | 155 |
| 711 | 3300005842 | Ga0068858_100482562 | Ga0068858_1004825622 | 155 |
| 712 | 3300005843 | Ga0068860_100440932 | Ga0068860_1004409322 | 155 |
| 713 | 3300005843 | Ga0068860_101159720 | Ga0068860_1011597202 | 155 |
| 714 | 3300005843 | Ga0068860_101219834 | Ga0068860_1012198341 | 155 |
| 715 | 3300005844 | Ga0068862_100050972 | Ga0068862_1000509724 | 155 |
| 716 | 3300005844 | Ga0068862_100135111 | Ga0068862_1001351112 | 155 |
| 717 | 3300005844 | Ga0068862_100167788 | Ga0068862_1001677882 | 155 |
| 718 | 3300005844 | Ga0068862_100415906 | Ga0068862_1004159062 | 155 |
| 719 | 3300005844 | Ga0068862_100963408 | Ga0068862_1009634082 | 155 |
| 720 | 3300005844 | Ga0068862_101190193 | Ga0068862_1011901931 | 155 |
| 721 | 3300005985 | Ga0081539_10059806 | Ga0081539_100598062 | 155 |
| 722 | 3300005985 | Ga0081539_10100662 | Ga0081539_101006622 | 155 |
| 723 | 3300006175 | Ga0070712_100096486 | Ga0070712_1000964862 | 155 |
| 724 | 3300006237 | Ga0097621_100020345 | Ga0097621_1000203453 | 155 |
| 725 | 3300006237 | Ga0097621_101280509 | Ga0097621_1012805091 | 155 |
| 726 | 3300006358 | Ga0068871_100089251 | Ga0068871_1000892512 | 155 |
| 727 | 3300006358 | Ga0068871_100242880 | Ga0068871_1002428802 | 155 |
| 728 | 3300006358 | Ga0068871_100291792 | Ga0068871_1002917922 | 155 |
| 729 | 3300006358 | Ga0068871_100400444 | Ga0068871_1004004442 | 155 |
| 730 | 3300006844 | Ga0075428_100003764 | Ga0075428_1000037645 | 155 |
| 731 | 3300006844 | Ga0075428_100008503 | Ga0075428_1000085037 | 155 |
| 732 | 3300006844 | Ga0075428_100029789 | Ga0075428_1000297894 | 155 |
| 733 | 3300006844 | Ga0075428_100070369 | Ga0075428_1000703693 | 155 |
| 734 | 3300006844 | Ga0075428_100698484 | Ga0075428_1006984842 | 155 |
| 735 | 3300006844 | Ga0075428_100926372 | Ga0075428_1009263722 | 155 |
| 736 | 3300006844 | Ga0075428_101725272 | Ga0075428_1017252721 | 155 |
| 737 | 3300006846 | Ga0075430_100002827 | Ga0075430_10000282710 | 155 |
| 738 | 3300006846 | Ga0075430_100009055 | Ga0075430_1000090551 | 155 |
| 739 | 3300006846 | Ga0075430_100025724 | Ga0075430_1000257242 | 155 |
| 740 | 3300006846 | Ga0075430_100423544 | Ga0075430_1004235442 | 155 |
| 741 | 3300006846 | Ga0075430_100535947 | Ga0075430_1005359472 | 155 |
| 742 | 3300006846 | Ga0075430_101643218 | Ga0075430_1016432181 | 155 |
| 743 | 3300006847 | Ga0075431_100002521 | Ga0075431_1000025218 | 155 |
| 744 | 3300006847 | Ga0075431_100043740 | Ga0075431_1000437402 | 155 |
| 745 | 3300006847 | Ga0075431_100203614 | Ga0075431_1002036142 | 155 |
| 746 | 3300006847 | Ga0075431_100399090 | Ga0075431_1003990902 | 155 |
| 747 | 3300006847 | Ga0075431_101340746 | Ga0075431_1013407461 | 155 |
| 748 | 3300006852 | Ga0075433_10000719 | Ga0075433_1000071913 | 155 |
| 749 | 3300006852 | Ga0075433_10003035 | Ga0075433_100030357 | 155 |
| 750 | 3300006852 | Ga0075433_10046914 | Ga0075433_100469142 | 155 |
| 751 | 3300006852 | Ga0075433_11372447 | Ga0075433_113724471 | 155 |
| 752 | 3300006871 | Ga0075434_100009384 | Ga0075434_1000093843 | 155 |
| 753 | 3300006871 | Ga0075434_100014191 | Ga0075434_1000141913 | 155 |
| 754 | 3300006871 | Ga0075434_100019206 | Ga0075434_1000192065 | 155 |
| 755 | 3300006871 | Ga0075434_101053817 | Ga0075434_1010538172 | 155 |
| 756 | 3300006880 | Ga0075429_100003842 | Ga0075429_10000384210 | 155 |
| 757 | 3300006880 | Ga0075429_100005497 | Ga0075429_1000054979 | 155 |
| 758 | 3300006880 | Ga0075429_100184095 | Ga0075429_1001840952 | 155 |
| 759 | 3300006880 | Ga0075429_100493860 | Ga0075429_1004938602 | 155 |
| 760 | 3300006880 | Ga0075429_100680130 | Ga0075429_1006801301 | 155 |
| 761 | 3300006881 | Ga0068865_100033189 | Ga0068865_1000331891 | 155 |
| 762 | 3300006931 | Ga0097620_100002669 | Ga0097620_1000026698 | 155 |
| 763 | 3300006931 | Ga0097620_100128263 | Ga0097620_1001282631 | 155 |
| 764 | 3300006931 | Ga0097620_100160182 | Ga0097620_1001601822 | 155 |
| 765 | 3300006931 | Ga0097620_100420494 | Ga0097620_1004204942 | 155 |
| 766 | 3300006931 | Ga0097620_100982294 | Ga0097620_1009822942 | 155 |
| 767 | 3300007076 | Ga0075435_100024515 | Ga0075435_1000245155 | 155 |
| 768 | 3300007076 | Ga0075435_100025018 | Ga0075435_1000250184 | 155 |
| 769 | 3300009094 | Ga0111539_10001096 | Ga0111539_1000109613 | 155 |
| 770 | 3300009094 | Ga0111539_10001535 | Ga0111539_1000153517 | 155 |
| 771 | 3300009094 | Ga0111539_10002877 | Ga0111539_1000287711 | 155 |
| 772 | 3300009094 | Ga0111539_10007218 | Ga0111539_1000721816 | 155 |
| 773 | 3300009094 | Ga0111539_10021062 | Ga0111539_100210622 | 155 |
| 774 | 3300009094 | Ga0111539_10040375 | Ga0111539_100403753 | 155 |
| 775 | 3300009094 | Ga0111539_10223930 | Ga0111539_102239302 | 155 |
| 776 | 3300009094 | Ga0111539_10464300 | Ga0111539_104643002 | 155 |
| 777 | 3300009094 | Ga0111539_10635646 | Ga0111539_106356462 | 155 |
| 778 | 3300009094 | Ga0111539_11087557 | Ga0111539_110875572 | 155 |
| 779 | 3300009094 | Ga0111539_11087991 | Ga0111539_110879911 | 155 |
| 780 | 3300009147 | Ga0114129_10034096 | Ga0114129_100340966 | 155 |
| 781 | 3300009147 | Ga0114129_10044082 | Ga0114129_100440822 | 155 |
| 782 | 3300009147 | Ga0114129_10196868 | Ga0114129_101968682 | 155 |
| 783 | 3300009147 | Ga0114129_10373398 | Ga0114129_103733982 | 155 |
| 784 | 3300009147 | Ga0114129_10633000 | Ga0114129_106330001 | 155 |
| 785 | 3300009147 | Ga0114129_10765889 | Ga0114129_107658892 | 155 |
| 786 | 3300009147 | Ga0114129_11368504 | Ga0114129_113685042 | 155 |
| 787 | 3300009147 | Ga0114129_11563707 | Ga0114129_115637072 | 155 |
| 788 | 3300009177 | Ga0105248_10058517 | Ga0105248_100585171 | 155 |
| 789 | 3300009553 | Ga0105249_10064382 | Ga0105249_100643821 | 155 |
| 790 | 3300009553 | Ga0105249_10234697 | Ga0105249_102346972 | 155 |
| 791 | 3300009553 | Ga0105249_10950119 | Ga0105249_109501191 | 155 |
| 792 | 3300009553 | Ga0105249_11674273 | Ga0105249_116742731 | 155 |
| 793 | 3300009553 | Ga0105249_12884872 | Ga0105249_128848721 | 155 |
| 794 | 3300009553 | Ga0105249_12992665 | Ga0105249_129926651 | 155 |
| 795 | 3300012508 | Ga0157315_1020076 | Ga0157315_10200761 | 155 |
| 796 | 3300013296 | Ga0157374_10275837 | Ga0157374_102758372 | 155 |
| 797 | 3300013296 | Ga0157374_10367168 | Ga0157374_103671682 | 155 |
| 798 | 3300013306 | Ga0163162_10034885 | Ga0163162_100348854 | 155 |
| 799 | 3300013306 | Ga0163162_10173920 | Ga0163162_101739201 | 155 |
| 800 | 3300013306 | Ga0163162_10869929 | Ga0163162_108699291 | 155 |
| 801 | 3300013308 | Ga0157375_10070818 | Ga0157375_100708181 | 155 |
| 802 | 3300013308 | Ga0157375_11348247 | Ga0157375_113482471 | 155 |
| 803 | 3300014325 | Ga0163163_10049669 | Ga0163163_100496692 | 155 |
| 804 | 3300014326 | Ga0157380_10007481 | Ga0157380_100074815 | 155 |
| 805 | 3300014326 | Ga0157380_10013472 | Ga0157380_100134725 | 155 |
| 806 | 3300014326 | Ga0157380_10092262 | Ga0157380_100922622 | 155 |
| 807 | 3300014326 | Ga0157380_10095680 | Ga0157380_100956802 | 155 |
| 808 | 3300014326 | Ga0157380_10605065 | Ga0157380_106050652 | 155 |
| 809 | 3300014326 | Ga0157380_10763339 | Ga0157380_107633392 | 155 |
| 810 | 3300014326 | Ga0157380_11430781 | Ga0157380_114307811 | 155 |
| 811 | 3300014326 | Ga0157380_12140741 | Ga0157380_121407412 | 155 |
| 812 | 3300014745 | Ga0157377_10011536 | Ga0157377_100115362 | 155 |
| 813 | 3300014745 | Ga0157377_10031760 | Ga0157377_100317602 | 155 |
| 814 | 3300014745 | Ga0157377_10220772 | Ga0157377_102207722 | 155 |
| 815 | 3300014745 | Ga0157377_10319348 | Ga0157377_103193481 | 155 |
| 816 | 3300014745 | Ga0157377_10328638 | Ga0157377_103286382 | 155 |
| 817 | 3300014968 | Ga0157379_10048906 | Ga0157379_100489064 | 155 |
| 818 | 3300014969 | Ga0157376_10154267 | Ga0157376_101542672 | 155 |
| 819 | 3300014969 | Ga0157376_12272039 | Ga0157376_122720391 | 155 |
| 820 | 3300017792 | Ga0163161_10054592 | Ga0163161_100545922 | 155 |
| 821 | 3300025290 | Ga0207673_1004444 | Ga0207673_10044442 | 155 |
| 822 | 3300025315 | Ga0207697_10006229 | Ga0207697_100062294 | 155 |
| 823 | 3300025315 | Ga0207697_10014857 | Ga0207697_100148573 | 155 |
| 824 | 3300025315 | Ga0207697_10057159 | Ga0207697_100571592 | 155 |
| 825 | 3300025315 | Ga0207697_10062782 | Ga0207697_100627821 | 155 |
| 826 | 3300025315 | Ga0207697_10100761 | Ga0207697_101007612 | 155 |
| 827 | 3300025885 | Ga0207653_10042479 | Ga0207653_100424792 | 155 |
| 828 | 3300025893 | Ga0207682_10025689 | Ga0207682_100256892 | 155 |
| 829 | 3300025893 | Ga0207682_10044666 | Ga0207682_100446662 | 155 |
| 830 | 3300025893 | Ga0207682_10084505 | Ga0207682_100845052 | 155 |
| 831 | 3300025893 | Ga0207682_10100194 | Ga0207682_101001942 | 155 |
| 832 | 3300025899 | Ga0207642_10193415 | Ga0207642_101934151 | 155 |
| 833 | 3300025899 | Ga0207642_10420664 | Ga0207642_104206642 | 155 |
| 834 | 3300025901 | Ga0207688_10001167 | Ga0207688_100011672 | 155 |
| 835 | 3300025903 | Ga0207680_10575620 | Ga0207680_105756201 | 155 |
| 836 | 3300025907 | Ga0207645_10006799 | Ga0207645_100067998 | 155 |
| 837 | 3300025907 | Ga0207645_10035884 | Ga0207645_100358842 | 155 |
| 838 | 3300025907 | Ga0207645_10262055 | Ga0207645_102620552 | 155 |
| 839 | 3300025908 | Ga0207643_10000421 | Ga0207643_1000042122 | 155 |
| 840 | 3300025908 | Ga0207643_10003973 | Ga0207643_100039736 | 155 |
| 841 | 3300025908 | Ga0207643_10137132 | Ga0207643_101371322 | 155 |
| 842 | 3300025908 | Ga0207643_10225562 | Ga0207643_102255622 | 155 |
| 843 | 3300025910 | Ga0207684_10086680 | Ga0207684_100866802 | 155 |
| 844 | 3300025915 | Ga0207693_10176989 | Ga0207693_101769892 | 155 |
| 845 | 3300025917 | Ga0207660_10402687 | Ga0207660_104026872 | 155 |
| 846 | 3300025918 | Ga0207662_10008088 | Ga0207662_100080881 | 155 |
| 847 | 3300025918 | Ga0207662_10596891 | Ga0207662_105968912 | 155 |
| 848 | 3300025920 | Ga0207649_10034873 | Ga0207649_100348732 | 155 |
| 849 | 3300025920 | Ga0207649_10690565 | Ga0207649_106905651 | 155 |
| 850 | 3300025920 | Ga0207649_10808486 | Ga0207649_108084861 | 155 |
| 851 | 3300025920 | Ga0207649_11101091 | Ga0207649_111010911 | 155 |
| 852 | 3300025922 | Ga0207646_10063922 | Ga0207646_100639222 | 155 |
| 853 | 3300025923 | Ga0207681_10014583 | Ga0207681_100145832 | 155 |
| 854 | 3300025923 | Ga0207681_10027511 | Ga0207681_100275113 | 155 |
| 855 | 3300025923 | Ga0207681_10187241 | Ga0207681_101872412 | 155 |
| 856 | 3300025923 | Ga0207681_10574473 | Ga0207681_105744731 | 155 |
| 857 | 3300025923 | Ga0207681_11234983 | Ga0207681_112349832 | 155 |
| 858 | 3300025925 | Ga0207650_10023131 | Ga0207650_100231314 | 155 |
| 859 | 3300025925 | Ga0207650_10110013 | Ga0207650_101100132 | 155 |
| 860 | 3300025925 | Ga0207650_10218521 | Ga0207650_102185211 | 155 |
| 861 | 3300025926 | Ga0207659_10014101 | Ga0207659_100141013 | 155 |
| 862 | 3300025926 | Ga0207659_10082191 | Ga0207659_100821911 | 155 |
| 863 | 3300025926 | Ga0207659_10117411 | Ga0207659_101174112 | 155 |
| 864 | 3300025926 | Ga0207659_10249523 | Ga0207659_102495232 | 155 |
| 865 | 3300025926 | Ga0207659_10299663 | Ga0207659_102996632 | 155 |
| 866 | 3300025932 | Ga0207690_10073740 | Ga0207690_100737402 | 155 |
| 867 | 3300025933 | Ga0207706_10013947 | Ga0207706_100139477 | 155 |
| 868 | 3300025933 | Ga0207706_10016745 | Ga0207706_100167454 | 155 |
| 869 | 3300025933 | Ga0207706_10094059 | Ga0207706_100940593 | 155 |
| 870 | 3300025936 | Ga0207670_10093496 | Ga0207670_100934962 | 155 |
| 871 | 3300025936 | Ga0207670_10098961 | Ga0207670_100989612 | 155 |
| 872 | 3300025936 | Ga0207670_10167320 | Ga0207670_101673201 | 155 |
| 873 | 3300025936 | Ga0207670_10216198 | Ga0207670_102161982 | 155 |
| 874 | 3300025936 | Ga0207670_10440253 | Ga0207670_104402532 | 155 |
| 875 | 3300025937 | Ga0207669_10004678 | Ga0207669_100046783 | 155 |
| 876 | 3300025937 | Ga0207669_10118812 | Ga0207669_101188122 | 155 |
| 877 | 3300025937 | Ga0207669_10377140 | Ga0207669_103771402 | 155 |
| 878 | 3300025937 | Ga0207669_11131837 | Ga0207669_111318371 | 155 |
| 879 | 3300025938 | Ga0207704_10599289 | Ga0207704_105992892 | 155 |
| 880 | 3300025938 | Ga0207704_10773359 | Ga0207704_107733591 | 155 |
| 881 | 3300025940 | Ga0207691_10011048 | Ga0207691_100110489 | 155 |
| 882 | 3300025940 | Ga0207691_10037771 | Ga0207691_100377712 | 155 |
| 883 | 3300025940 | Ga0207691_10052143 | Ga0207691_100521434 | 155 |
| 884 | 3300025940 | Ga0207691_10101756 | Ga0207691_101017562 | 155 |
| 885 | 3300025940 | Ga0207691_10192560 | Ga0207691_101925602 | 155 |
| 886 | 3300025940 | Ga0207691_10220937 | Ga0207691_102209372 | 155 |
| 887 | 3300025940 | Ga0207691_10232816 | Ga0207691_102328161 | 155 |
| 888 | 3300025940 | Ga0207691_10265102 | Ga0207691_102651023 | 155 |
| 889 | 3300025942 | Ga0207689_10009631 | Ga0207689_100096314 | 155 |
| 890 | 3300025942 | Ga0207689_10012411 | Ga0207689_100124117 | 155 |
| 891 | 3300025942 | Ga0207689_10365702 | Ga0207689_103657022 | 155 |
| 892 | 3300025942 | Ga0207689_10426007 | Ga0207689_104260071 | 155 |
| 893 | 3300025945 | Ga0207679_10007458 | Ga0207679_100074584 | 155 |
| 894 | 3300025945 | Ga0207679_10021997 | Ga0207679_100219973 | 155 |
| 895 | 3300025945 | Ga0207679_10106162 | Ga0207679_101061622 | 155 |
| 896 | 3300025945 | Ga0207679_10196205 | Ga0207679_101962052 | 155 |
| 897 | 3300025945 | Ga0207679_10306941 | Ga0207679_103069412 | 155 |
| 898 | 3300025945 | Ga0207679_10594375 | Ga0207679_105943752 | 155 |
| 899 | 3300025945 | Ga0207679_10710492 | Ga0207679_107104921 | 155 |
| 900 | 3300025960 | Ga0207651_10026837 | Ga0207651_100268372 | 155 |
| 901 | 3300025960 | Ga0207651_10045179 | Ga0207651_100451792 | 155 |
| 902 | 3300025960 | Ga0207651_10048143 | Ga0207651_100481431 | 155 |
| 903 | 3300025960 | Ga0207651_10566373 | Ga0207651_105663731 | 155 |
| 904 | 3300025961 | Ga0207712_11686813 | Ga0207712_116868131 | 155 |
| 905 | 3300025972 | Ga0207668_10039855 | Ga0207668_100398552 | 155 |
| 906 | 3300025972 | Ga0207668_10179344 | Ga0207668_101793442 | 155 |
| 907 | 3300025972 | Ga0207668_10372496 | Ga0207668_103724962 | 155 |
| 908 | 3300025972 | Ga0207668_10669683 | Ga0207668_106696832 | 155 |
| 909 | 3300025981 | Ga0207640_10880173 | Ga0207640_108801731 | 155 |
| 910 | 3300025981 | Ga0207640_11902215 | Ga0207640_119022151 | 155 |
| 911 | 3300025986 | Ga0207658_10520492 | Ga0207658_105204922 | 155 |
| 912 | 3300025986 | Ga0207658_10714620 | Ga0207658_107146202 | 155 |
| 913 | 3300025986 | Ga0207658_11066660 | Ga0207658_110666601 | 155 |
| 914 | 3300026023 | Ga0207677_10118776 | Ga0207677_101187762 | 155 |
| 915 | 3300026023 | Ga0207677_11499156 | Ga0207677_114991561 | 155 |
| 916 | 3300026035 | Ga0207703_10085378 | Ga0207703_100853782 | 155 |
| 917 | 3300026041 | Ga0207639_11013193 | Ga0207639_110131931 | 155 |
| 918 | 3300026067 | Ga0207678_10441441 | Ga0207678_104414411 | 155 |
| 919 | 3300026075 | Ga0207708_10013130 | Ga0207708_100131305 | 155 |
| 920 | 3300026075 | Ga0207708_10039098 | Ga0207708_100390982 | 155 |
| 921 | 3300026075 | Ga0207708_10179488 | Ga0207708_101794882 | 155 |
| 922 | 3300026075 | Ga0207708_10186032 | Ga0207708_101860322 | 155 |
| 923 | 3300026075 | Ga0207708_11408974 | Ga0207708_114089741 | 155 |
| 924 | 3300026088 | Ga0207641_10142894 | Ga0207641_101428942 | 155 |
| 925 | 3300026088 | Ga0207641_10437360 | Ga0207641_104373602 | 155 |
| 926 | 3300026089 | Ga0207648_10073765 | Ga0207648_100737652 | 155 |
| 927 | 3300026089 | Ga0207648_10142645 | Ga0207648_101426452 | 155 |
| 928 | 3300026089 | Ga0207648_10160602 | Ga0207648_101606022 | 155 |
| 929 | 3300026089 | Ga0207648_10624495 | Ga0207648_106244951 | 155 |
| 930 | 3300026089 | Ga0207648_10742489 | Ga0207648_107424892 | 155 |
| 931 | 3300026089 | Ga0207648_10931739 | Ga0207648_109317392 | 155 |
| 932 | 3300026095 | Ga0207676_10181467 | Ga0207676_101814672 | 155 |
| 933 | 3300026116 | Ga0207674_10076334 | Ga0207674_100763343 | 155 |
| 934 | 3300026116 | Ga0207674_10172945 | Ga0207674_101729452 | 155 |
| 935 | 3300026116 | Ga0207674_11073421 | Ga0207674_110734212 | 155 |
| 936 | 3300026118 | Ga0207675_100030876 | Ga0207675_1000308762 | 155 |
| 937 | 3300026118 | Ga0207675_100039233 | Ga0207675_1000392332 | 155 |
| 938 | 3300026118 | Ga0207675_100308482 | Ga0207675_1003084822 | 155 |
| 939 | 3300026118 | Ga0207675_100453834 | Ga0207675_1004538341 | 155 |
| 940 | 3300026118 | Ga0207675_101009548 | Ga0207675_1010095481 | 155 |
| 941 | 3300026121 | Ga0207683_10042430 | Ga0207683_100424303 | 155 |
| 942 | 3300026121 | Ga0207683_10051914 | Ga0207683_100519143 | 155 |
| 943 | 3300026121 | Ga0207683_10153964 | Ga0207683_101539642 | 155 |
| 944 | 3300026121 | Ga0207683_10532556 | Ga0207683_105325562 | 155 |
| 945 | 3300027682 | Ga0209971_1078061 | Ga0209971_10780611 | 155 |
| 946 | 3300027717 | Ga0209998_10055051 | Ga0209998_100550511 | 155 |
| 947 | 3300027876 | Ga0209974_10062413 | Ga0209974_100624132 | 155 |
| 948 | 3300027907 | Ga0207428_10000515 | Ga0207428_1000051519 | 155 |
| 949 | 3300027907 | Ga0207428_10002311 | Ga0207428_1000231110 | 155 |
| 950 | 3300027907 | Ga0207428_10006882 | Ga0207428_100068829 | 155 |
| 951 | 3300027907 | Ga0207428_10327876 | Ga0207428_103278762 | 155 |
| 952 | 3300027907 | Ga0207428_10752096 | Ga0207428_107520961 | 155 |
| 953 | 3300028379 | Ga0268266_10400147 | Ga0268266_104001472 | 155 |
| 954 | 3300028380 | Ga0268265_10188184 | Ga0268265_101881842 | 155 |
| 955 | 3300028380 | Ga0268265_10234290 | Ga0268265_102342902 | 155 |
| 956 | 3300028380 | Ga0268265_10258420 | Ga0268265_102584202 | 155 |
| 957 | 3300028380 | Ga0268265_10389729 | Ga0268265_103897292 | 155 |
| 958 | 3300028380 | Ga0268265_10664087 | Ga0268265_106640872 | 155 |
| 959 | 3300028380 | Ga0268265_10749026 | Ga0268265_107490261 | 155 |
| 960 | 3300028380 | Ga0268265_11165060 | Ga0268265_111650602 | 155 |
| 961 | 3300028381 | Ga0268264_11184763 | Ga0268264_111847631 | 155 |
| 962 | 3300031548 | Ga0307408_100086674 | Ga0307408_1000866742 | 155 |
| 963 | 3300031731 | Ga0307405_10004821 | Ga0307405_100048214 | 155 |
| 964 | 3300031824 | Ga0307413_10126311 | Ga0307413_101263112 | 155 |
| 965 | 3300031852 | Ga0307410_10008571 | Ga0307410_100085712 | 155 |
| 966 | 3300031901 | Ga0307406_10068985 | Ga0307406_100689852 | 155 |
| 967 | 3300031903 | Ga0307407_10003751 | Ga0307407_100037516 | 155 |
| 968 | 3300031911 | Ga0307412_10027611 | Ga0307412_100276112 | 155 |
| 969 | 3300031911 | Ga0307412_10574164 | Ga0307412_105741642 | 155 |
| 970 | 3300031911 | Ga0307412_11605491 | Ga0307412_116054911 | 155 |
| 971 | 3300031995 | Ga0307409_100062413 | Ga0307409_1000624133 | 155 |
| 972 | 3300031995 | Ga0307409_101109911 | Ga0307409_1011099111 | 155 |
| 973 | 3300032002 | Ga0307416_100097463 | Ga0307416_1000974632 | 155 |
| 974 | 3300032005 | Ga0307411_10127862 | Ga0307411_101278622 | 155 |
| 975 | 3300032005 | Ga0307411_10445419 | Ga0307411_104454192 | 155 |
| 976 | 3300032005 | Ga0307411_10819585 | Ga0307411_108195851 | 155 |
| 977 | 3300032126 | Ga0307415_100024282 | Ga0307415_1000242822 | 155 |
| 978 | 3300035112 | Ga0373932_0111103 | Ga0373932_0111103_231_698 | 155 |
| 979 | 3300035115 | Ga0373941_0266422 | Ga0373941_0266422_139_606 | 155 |
| 980 | 3300035121 | Ga0373960_0025199 | Ga0373960_0025199_1051_1518 | 155 |
| 981 | 3300035241 | Ga0373961_0022626 | Ga0373961_0022626_287_754 | 155 |
| 982 | 3300041408 | Ga0439453_0022459 | Ga0439453_0022459_452_1093 | 155 |
| 983 | 3300041999 | Ga0439433_0027879 | Ga0439433_0027879_689_1156 | 155 |
| 984 | 3300042015 | Ga0439462_0199881 | Ga0439462_0199881_61_528 | 155 |
| 985 | 3300042118 | Ga0450914_046764 | Ga0450914_046764_37_504 | 155 |
| 986 | 3300042156 | Ga0439446_0042916 | Ga0439446_0042916_434_901 | 155 |
| 987 | 3300042156 | Ga0439446_0099084 | Ga0439446_0099084_369_836 | 155 |
| 988 | 3300042435 | Ga0439434_0057687 | Ga0439434_0057687_265_732 | 155 |
| 989 | 3300042436 | Ga0439435_0092311 | Ga0439435_0092311_192_659 | 155 |
| 990 | 3300042439 | Ga0439464_0122213 | Ga0439464_0122213_150_617 | 155 |
| 991 | 3300042530 | Ga0450916_024858 | Ga0450916_024858_27_494 | 155 |
| 992 | 3300042993 | Ga0439440_0104953 | Ga0439440_0104953_136_603 | 155 |
| 993 | 3300046499 | Ga0495594_0062966 | Ga0495594_0062966_780_1247 | 155 |
| 994 | 3300046537 | Ga0495598_0179138 | Ga0495598_0179138_37_504 | 155 |
| 995 | 3300046539 | Ga0495621_0054794 | Ga0495621_0054794_331_798 | 155 |
| 996 | 3300046558 | Ga0495633_0143241 | Ga0495633_0143241_215_682 | 155 |
| 997 | 3300046664 | Ga0495659_0488488 | Ga0495659_0488488_41_508 | 155 |
| 998 | 3300046674 | Ga0495588_0254220 | Ga0495588_0254220_52_519 | 155 |
| 999 | 3300046684 | Ga0495669_0207481 | Ga0495669_0207481_334_801 | 155 |
| 1000 | 3300047318 | Ga0495636_0064540 | Ga0495636_0064540_714_1181 | 155 |
| 1001 | 3300048909 | Ga0496106_0485290 | Ga0496106_0485290_211_678 | 155 |
| 1002 | 3300048913 | Ga0496110_0171743 | Ga0496110_0171743_557_1024 | 155 |
| 1003 | 3300048913 | Ga0496110_0680971 | Ga0496110_0680971_346_813 | 155 |
| 1004 | 3300049521 | Ga0501298_030201 | Ga0501298_030201_294_761 | 155 |
| 1005 | 3300049572 | Ga0501036_0101941 | Ga0501036_0101941_447_1019 | 155 |
| 1006 | 3300049572 | Ga0501036_0119187 | Ga0501036_0119187_29_496 | 155 |
| 1007 | 3300049573 | Ga0501037_0372352 | Ga0501037_0372352_318_890 | 155 |
| 1008 | 3300049575 | Ga0501039_0056023 | Ga0501039_0056023_2344_2811 | 155 |
| 1009 | 3300049575 | Ga0501039_0069299 | Ga0501039_0069299_189_761 | 155 |
| 1010 | 3300049576 | Ga0501040_0018432 | Ga0501040_0018432_4093_4560 | 155 |
| 1011 | 3300049576 | Ga0501040_0086204 | Ga0501040_0086204_436_1008 | 155 |
| 1012 | 3300049576 | Ga0501040_0964412 | Ga0501040_0964412_96_563 | 155 |
| 1013 | 3300049577 | Ga0501041_0064651 | Ga0501041_0064651_1280_1852 | 155 |
| 1014 | 3300049577 | Ga0501041_0189559 | Ga0501041_0189559_189_656 | 155 |
| 1015 | 3300049578 | Ga0501042_0025948 | Ga0501042_0025948_13_585 | 155 |
| 1016 | 3300049578 | Ga0501042_0062804 | Ga0501042_0062804_36_503 | 155 |
| 1017 | 3300049580 | Ga0501046_0001085 | Ga0501046_0001085_26163_26630 | 155 |
| 1018 | 3300049582 | Ga0501048_0063991 | Ga0501048_0063991_314_886 | 155 |
| 1019 | 3300049582 | Ga0501048_0088906 | Ga0501048_0088906_24_491 | 155 |
| 1020 | 3300049587 | Ga0501071_0037006 | Ga0501071_0037006_2955_3422 | 155 |
| 1021 | 3300049587 | Ga0501071_0156786 | Ga0501071_0156786_831_1403 | 155 |
| 1022 | 3300049590 | Ga0501074_0658231 | Ga0501074_0658231_47_514 | 155 |
| 1023 | 3300049590 | Ga0501074_1172151 | Ga0501074_1172151_40_507 | 155 |
| 1024 | 3300049591 | Ga0501075_0003591 | Ga0501075_0003591_8944_9516 | 155 |
| 1025 | 3300049591 | Ga0501075_0276180 | Ga0501075_0276180_160_627 | 155 |
| 1026 | 3300049591 | Ga0501075_0480718 | Ga0501075_0480718_411_878 | 155 |
| 1027 | 3300049591 | Ga0501075_0592558 | Ga0501075_0592558_173_640 | 155 |
| 1028 | 3300049592 | Ga0501076_0024232 | Ga0501076_0024232_1992_2564 | 155 |
| 1029 | 3300049592 | Ga0501076_0854306 | Ga0501076_0854306_51_518 | 155 |
| 1030 | 3300049592 | Ga0501076_1162535 | Ga0501076_1162535_68_535 | 155 |
| 1031 | 3300049593 | Ga0501077_0015002 | Ga0501077_0015002_19_486 | 155 |
| 1032 | 3300049593 | Ga0501077_0711413 | Ga0501077_0711413_26_493 | 155 |
| 1033 | 3300049679 | Ga0501249_010075 | Ga0501249_010075_1329_1796 | 155 |
| 1034 | 3300049741 | Ga0501079_0209458 | Ga0501079_0209458_475_942 | 155 |
| 1035 | 3300049743 | Ga0501081_0030039 | Ga0501081_0030039_2603_3175 | 155 |
| 1036 | 3300049743 | Ga0501081_0046932 | Ga0501081_0046932_270_737 | 155 |
| 1037 | 3300049744 | Ga0501083_0218121 | Ga0501083_0218121_485_952 | 155 |
| 1038 | 3300049744 | Ga0501083_0493680 | Ga0501083_0493680_182_652 | 155 |
| 1039 | 3300049823 | Ga0501044_1174262 | Ga0501044_1174262_43_615 | 155 |
| 1040 | 3300049824 | Ga0501045_0056520 | Ga0501045_0056520_930_1502 | 155 |
| 1041 | 3300050507 | nmdc:mga05p37_1035000_c1 | nmdc:mga05p37_1035000_c1_302_769 | 155 |
| 1042 | 3300050507 | nmdc:mga05p37_1363605_c1 | nmdc:mga05p37_1363605_c1_62_529 | 155 |
| 1043 | 3300050507 | nmdc:mga05p37_174100_c1 | nmdc:mga05p37_174100_c1_1764_2237 | 155 |
| 1044 | 3300050507 | nmdc:mga05p37_406896_c1 | nmdc:mga05p37_406896_c1_1106_1573 | 155 |
| 1045 | 3300050507 | nmdc:mga05p37_43511_c1 | nmdc:mga05p37_43511_c1_4884_5351 | 155 |
| 1046 | 3300050507 | nmdc:mga05p37_81153_c2 | nmdc:mga05p37_81153_c2_1194_1661 | 155 |
| 1047 | 3300050507 | nmdc:mga05p37_822700_c1 | nmdc:mga05p37_822700_c1_249_716 | 155 |
| 1048 | 3300050508 | nmdc:mga09592_2456_c1 | nmdc:mga09592_2456_c1_8880_9347 | 155 |
| 1049 | 3300050508 | nmdc:mga09592_290133_c1 | nmdc:mga09592_290133_c1_783_1319 | 155 |
| 1050 | 3300050508 | nmdc:mga09592_3877_c1 | nmdc:mga09592_3877_c1_4085_4552 | 155 |
| 1051 | 3300050508 | nmdc:mga09592_514254_c1 | nmdc:mga09592_514254_c1_391_858 | 155 |
| 1052 | 3300050508 | nmdc:mga09592_54046_c1 | nmdc:mga09592_54046_c1_174_641 | 155 |
| 1053 | 3300050509 | nmdc:mga0qj67_1191813_c1 | nmdc:mga0qj67_1191813_c1_64_531 | 155 |
| 1054 | 3300050509 | nmdc:mga0qj67_15050_c1 | nmdc:mga0qj67_15050_c1_3880_4347 | 155 |
| 1055 | 3300050509 | nmdc:mga0qj67_2494_c1 | nmdc:mga0qj67_2494_c1_7623_8090 | 155 |
| 1056 | 3300050509 | nmdc:mga0qj67_49253_c1 | nmdc:mga0qj67_49253_c1_2812_3279 | 155 |
| 1057 | 3300050509 | nmdc:mga0qj67_585652_c1 | nmdc:mga0qj67_585652_c1_204_671 | 155 |
| 1058 | 3300050510 | nmdc:mga06r32_263642_c1 | nmdc:mga06r32_263642_c1_586_1053 | 155 |
| 1059 | 3300050510 | nmdc:mga06r32_31910_c1 | nmdc:mga06r32_31910_c1_991_1458 | 155 |
| 1060 | 3300050510 | nmdc:mga06r32_41442_c1 | nmdc:mga06r32_41442_c1_2905_3372 | 155 |
| 1061 | 3300050510 | nmdc:mga06r32_6589_c1 | nmdc:mga06r32_6589_c1_4326_4793 | 155 |
| 1062 | 3300050511 | nmdc:mga08y16_1241992_c1 | nmdc:mga08y16_1241992_c1_89_556 | 155 |
| 1063 | 3300050511 | nmdc:mga08y16_1271719_c1 | nmdc:mga08y16_1271719_c1_75_614 | 155 |
| 1064 | 3300050511 | nmdc:mga08y16_3326_c2 | nmdc:mga08y16_3326_c2_4449_4916 | 155 |
| 1065 | 3300050511 | nmdc:mga08y16_37298_c1 | nmdc:mga08y16_37298_c1_1306_1773 | 155 |
| 1066 | 3300050511 | nmdc:mga08y16_43724_c1 | nmdc:mga08y16_43724_c1_1788_2255 | 155 |
| 1067 | 3300050511 | nmdc:mga08y16_48345_c1 | nmdc:mga08y16_48345_c1_2194_2661 | 155 |
| 1068 | 3300050511 | nmdc:mga08y16_526993_c1 | nmdc:mga08y16_526993_c1_698_1165 | 155 |
| 1069 | 3300050511 | nmdc:mga08y16_5474_c1 | nmdc:mga08y16_5474_c1_10921_11442 | 155 |
| 1070 | 3300050511 | nmdc:mga08y16_79251_c1 | nmdc:mga08y16_79251_c1_741_1208 | 155 |
| 1071 | 3300050511 | nmdc:mga08y16_976_c1 | nmdc:mga08y16_976_c1_11376_11843 | 155 |
| 1072 | 3300050512 | nmdc:mga0n895_1176576_c1 | nmdc:mga0n895_1176576_c1_206_679 | 155 |
| 1073 | 3300050512 | nmdc:mga0n895_16886_c1 | nmdc:mga0n895_16886_c1_1490_1957 | 155 |
| 1074 | 3300050512 | nmdc:mga0n895_77894_c1 | nmdc:mga0n895_77894_c1_2773_3240 | 155 |
| 1075 | 3300050512 | nmdc:mga0n895_8913_c1 | nmdc:mga0n895_8913_c1_2425_2892 | 155 |
| 1076 | 3300050513 | nmdc:mga0rr50_118939_c1 | nmdc:mga0rr50_118939_c1_1151_1618 | 155 |
| 1077 | 3300050515 | nmdc:mga0a205_200440_c1 | nmdc:mga0a205_200440_c1_738_1205 | 155 |
| 1078 | 3300050515 | nmdc:mga0a205_5674_c1 | nmdc:mga0a205_5674_c1_9977_10444 | 155 |
| 1079 | 3300050515 | nmdc:mga0a205_894_c1 | nmdc:mga0a205_894_c1_15578_16045 | 155 |
| 1080 | 3300054114 | Ga0501084_0004609 | Ga0501084_0004609_10380_10847 | 155 |
| 1081 | 3300054114 | Ga0501084_0073686 | Ga0501084_0073686_1929_2501 | 155 |
| 1082 | 3300060353 | Ga0501082_0014744 | Ga0501082_0014744_5821_6288 | 155 |
| 1083 | 3300061734 | Ga0530510_0032284 | Ga0530510_0032284_2335_2802 | 155 |
| 1084 | 3300061734 | Ga0530510_1262851 | Ga0530510_1262851_84_551 | 155 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hjp-assembly2.cif.gz_D | the crystal structure of bcp4 from sulfolobus solfataricus | 0.9613 | 3 | 154 |
| 2cx4-assembly4.cif.gz_H | crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the aeropyrum pernix k1 (form-2 crystal) | 0.9608 | 3 | 153 |
| 3hjp-assembly2.cif.gz_D | the crystal structure of bcp4 from sulfolobus solfataricus | 0.9431 | 3 | 154 |
| 2cx4-assembly4.cif.gz_H | crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the aeropyrum pernix k1 (form-2 crystal) | 0.9367 | 3 | 153 |
| 5c04-assembly1.cif.gz_B | crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis | 0.9287 | 1 | 154 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2cx4E00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9435 | 1 | 153 | 3.40.30.10 |
| 2cx4E00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9317 | 1 | 153 | 3.40.30.10 |
| 5id2B00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9189 | 1 | 154 | 3.40.30.10 |
| 4af2A00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9116 | 1 | 154 | 3.40.30.10 |
| 2yzhD00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9101 | 1 | 153 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A818UNV0-F1-model_v4 | Thioredoxin domain-containing protein | 0.9778 | 2 | 153 |
GO:0016209
GO:0016491 |
| AF-A0A7J4AB69-F1-model_v4 | Peroxiredoxin | 0.9769 | 3 | 154 |
GO:0016209
GO:0016491 |
| AF-A0A818UKB0-F1-model_v4 | Thioredoxin domain-containing protein | 0.9768 | 1 | 151 |
GO:0016209
GO:0016491 |
| AF-A0A7C2XF79-F1-model_v4 | Peroxiredoxin | 0.9766 | 3 | 154 |
GO:0016209
GO:0016491 |
| AF-A0A817PIK7-F1-model_v4 | Thioredoxin domain-containing protein | 0.9762 | 1 | 153 |
GO:0016209
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar