F489700
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1082 | 366 | 2164 | 178 |
Family's Representative Sequence
| Representative Sequence | 3300046615|Ga0495656_0021620|Ga0495656_0021620_456_1082 |
| Length | 208 |
| Sequence | MNAGSWRVPAGARGDAGGRLRRPGGDAGQVRAIGVLVSGEGTNLQALVDAGLPVRAVASNRVGARALARAERAGIAAEVFELDSYGSRDERDEAMAAWLASQGVDLVVCAGYMHLLTPAFLDRYPGRIVNVHPSLLPEFPGARAIDDALEAGVETTGVTVHLIDEGLDTGDVIRQEPLPIEPRDTLPARIQAIEHRLLPEVVRELCVH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 194 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 200 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 201 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 202 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 215 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 218 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 219 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 220 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 221 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 222 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 223 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 224 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 226 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 227 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 228 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 229 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 230 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 231 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 232 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 233 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 234 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 235 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 236 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 237 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 238 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 239 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 240 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 241 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 242 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 243 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 244 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 245 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 246 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 247 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 248 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 249 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 303 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 304 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 305 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 306 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 307 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 308 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 311 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 312 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 313 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 314 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 341 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 349 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 366 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.54 |
| Metatranscriptomes | 0.46 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.18 |
| Nodule | 0 |
| Rhizoplane | 10.81 |
| Rhizosphere | 88.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495656_0021620 | 3300046615 | Unclassified | 2507 |
| 2 | JGI24743J22301_10005572 | 3300001991 | Bacteria | 2107 |
| 3 | JGI24743J22301_10005797 | 3300001991 | Bacteria | 2076 |
| 4 | JGI24738J21930_10009489 | 3300002075 | Bacteria | 2188 |
| 5 | JGI24744J21845_10025107 | 3300002077 | Bacteria | 1162 |
| 6 | JGI25406J46586_10058983 | 3300003203 | Bacteria | 1248 |
| 7 | Ga0070658_10060765 | 3300005327 | Bacteria | 3078 |
| 8 | Ga0070676_10110270 | 3300005328 | Bacteria | 1713 |
| 9 | Ga0070676_10151395 | 3300005328 | Bacteria | 1485 |
| 10 | Ga0070683_100011303 | 3300005329 | Bacteria | 7709 |
| 11 | Ga0070683_100040724 | 3300005329 | Bacteria | 4272 |
| 12 | Ga0070683_100046543 | 3300005329 | Bacteria | 4008 |
| 13 | Ga0070683_100172406 | 3300005329 | Bacteria | 2053 |
| 14 | Ga0070683_100336611 | 3300005329 | Bacteria | 1437 |
| 15 | Ga0070683_100339387 | 3300005329 | Bacteria | 1430 |
| 16 | Ga0070683_100416911 | 3300005329 | Bacteria | 1281 |
| 17 | Ga0070683_100557046 | 3300005329 | Bacteria | 1096 |
| 18 | Ga0070683_100574285 | 3300005329 | Bacteria | 1078 |
| 19 | Ga0070683_100946830 | 3300005329 | Bacteria | 826 |
| 20 | Ga0070683_101239251 | 3300005329 | Bacteria | 717 |
| 21 | Ga0070690_100042356 | 3300005330 | Bacteria | 2883 |
| 22 | Ga0070690_100301834 | 3300005330 | Bacteria | 1149 |
| 23 | Ga0068869_100054245 | 3300005334 | Bacteria | 2917 |
| 24 | Ga0068869_100570088 | 3300005334 | Bacteria | 953 |
| 25 | Ga0070666_10064420 | 3300005335 | Bacteria | 2486 |
| 26 | Ga0070666_10206516 | 3300005335 | Bacteria | 1383 |
| 27 | Ga0070680_100005620 | 3300005336 | Bacteria | 9494 |
| 28 | Ga0070680_100278091 | 3300005336 | Bacteria | 1418 |
| 29 | Ga0070680_100736198 | 3300005336 | Bacteria | 849 |
| 30 | Ga0070680_101046726 | 3300005336 | Bacteria | 705 |
| 31 | Ga0070682_100002331 | 3300005337 | Bacteria | 10498 |
| 32 | Ga0070682_100097901 | 3300005337 | Bacteria | 1931 |
| 33 | Ga0070682_100144941 | 3300005337 | Bacteria | 1623 |
| 34 | Ga0070682_100241964 | 3300005337 | Bacteria | 1296 |
| 35 | Ga0068868_100015257 | 3300005338 | Bacteria | 5678 |
| 36 | Ga0068868_100045658 | 3300005338 | Bacteria | 3428 |
| 37 | Ga0068868_100588169 | 3300005338 | Bacteria | 985 |
| 38 | Ga0068868_100843686 | 3300005338 | Bacteria | 829 |
| 39 | Ga0068868_100963878 | 3300005338 | Unclassified | 778 |
| 40 | Ga0070660_100003396 | 3300005339 | Bacteria | 10956 |
| 41 | Ga0070660_100004253 | 3300005339 | Bacteria | 9880 |
| 42 | Ga0070660_100056168 | 3300005339 | Bacteria | 3045 |
| 43 | Ga0070660_100182606 | 3300005339 | Bacteria | 1698 |
| 44 | Ga0070660_100221565 | 3300005339 | Bacteria | 1538 |
| 45 | Ga0070660_100389315 | 3300005339 | Bacteria | 1151 |
| 46 | Ga0070689_100011564 | 3300005340 | Bacteria | 6324 |
| 47 | Ga0070689_100181284 | 3300005340 | Bacteria | 1711 |
| 48 | Ga0070691_10059656 | 3300005341 | Bacteria | 1833 |
| 49 | Ga0070687_100178765 | 3300005343 | Bacteria | 1269 |
| 50 | Ga0070687_100251142 | 3300005343 | Bacteria | 1099 |
| 51 | Ga0070687_100434785 | 3300005343 | Bacteria | 869 |
| 52 | Ga0070687_100859644 | 3300005343 | Unclassified | 647 |
| 53 | Ga0070661_100057489 | 3300005344 | Bacteria | 2850 |
| 54 | Ga0070661_100094629 | 3300005344 | Bacteria | 2214 |
| 55 | Ga0070661_100335969 | 3300005344 | Bacteria | 1182 |
| 56 | Ga0070661_100364852 | 3300005344 | Bacteria | 1136 |
| 57 | Ga0070661_100586610 | 3300005344 | Bacteria | 900 |
| 58 | Ga0070692_10003563 | 3300005345 | Bacteria | 6339 |
| 59 | Ga0070692_10037837 | 3300005345 | Bacteria | 2455 |
| 60 | Ga0070692_10069093 | 3300005345 | Bacteria | 1878 |
| 61 | Ga0070668_100013432 | 3300005347 | Bacteria | 6113 |
| 62 | Ga0070668_100674835 | 3300005347 | Bacteria | 910 |
| 63 | Ga0070668_100949297 | 3300005347 | Bacteria | 771 |
| 64 | Ga0070668_101203109 | 3300005347 | Bacteria | 687 |
| 65 | Ga0070675_100008011 | 3300005354 | Bacteria | 8190 |
| 66 | Ga0070675_100036827 | 3300005354 | Bacteria | 3983 |
| 67 | Ga0070675_100151229 | 3300005354 | Bacteria | 1990 |
| 68 | Ga0070675_100321560 | 3300005354 | Bacteria | 1367 |
| 69 | Ga0070675_100709369 | 3300005354 | Bacteria | 916 |
| 70 | Ga0070675_100919193 | 3300005354 | Bacteria | 802 |
| 71 | Ga0070671_100021637 | 3300005355 | Bacteria | 5253 |
| 72 | Ga0070671_100048075 | 3300005355 | Bacteria | 3547 |
| 73 | Ga0070671_100318560 | 3300005355 | Archaea | 1325 |
| 74 | Ga0070671_100453384 | 3300005355 | Bacteria | 1100 |
| 75 | Ga0070674_100050635 | 3300005356 | Bacteria | 2859 |
| 76 | Ga0070674_100062552 | 3300005356 | Bacteria | 2601 |
| 77 | Ga0070674_100142539 | 3300005356 | Bacteria | 1800 |
| 78 | Ga0070674_100567374 | 3300005356 | Unclassified | 954 |
| 79 | Ga0070674_100745649 | 3300005356 | Bacteria | 841 |
| 80 | Ga0070673_100036337 | 3300005364 | Bacteria | 3743 |
| 81 | Ga0070673_101264652 | 3300005364 | Unclassified | 692 |
| 82 | Ga0070688_100001743 | 3300005365 | Bacteria | 10860 |
| 83 | Ga0070688_100155261 | 3300005365 | Bacteria | 1567 |
| 84 | Ga0070688_100794852 | 3300005365 | Bacteria | 739 |
| 85 | Ga0070659_100014966 | 3300005366 | Bacteria | 5803 |
| 86 | Ga0070659_100023401 | 3300005366 | Bacteria | 4727 |
| 87 | Ga0070659_100050901 | 3300005366 | Bacteria | 3256 |
| 88 | Ga0070659_100133099 | 3300005366 | Bacteria | 2020 |
| 89 | Ga0070667_100044216 | 3300005367 | Bacteria | 3739 |
| 90 | Ga0070667_100340500 | 3300005367 | Bacteria | 1356 |
| 91 | Ga0070667_101017664 | 3300005367 | Bacteria | 773 |
| 92 | Ga0070703_10005248 | 3300005406 | Bacteria | 3621 |
| 93 | Ga0070709_10009858 | 3300005434 | Bacteria | 5278 |
| 94 | Ga0070709_10312376 | 3300005434 | Bacteria | 1151 |
| 95 | Ga0070714_100393538 | 3300005435 | Bacteria | 1308 |
| 96 | Ga0070714_100520108 | 3300005435 | Bacteria | 1136 |
| 97 | Ga0070713_100055508 | 3300005436 | Bacteria | 3292 |
| 98 | Ga0070710_10005240 | 3300005437 | Bacteria | 6144 |
| 99 | Ga0070710_10117159 | 3300005437 | Bacteria | 1607 |
| 100 | Ga0070701_10005453 | 3300005438 | Bacteria | 5259 |
| 101 | Ga0070701_10006793 | 3300005438 | Bacteria | 4838 |
| 102 | Ga0070711_100135244 | 3300005439 | Bacteria | 1841 |
| 103 | Ga0070711_100200624 | 3300005439 | Bacteria | 1539 |
| 104 | Ga0070711_100288713 | 3300005439 | Bacteria | 1300 |
| 105 | Ga0070705_100009369 | 3300005440 | Bacteria | 4867 |
| 106 | Ga0070705_100017042 | 3300005440 | Bacteria | 3784 |
| 107 | Ga0070705_100026272 | 3300005440 | Bacteria | 3167 |
| 108 | Ga0070705_100304779 | 3300005440 | Bacteria | 1143 |
| 109 | Ga0070700_100036094 | 3300005441 | Bacteria | 2996 |
| 110 | Ga0070700_100225102 | 3300005441 | Bacteria | 1331 |
| 111 | Ga0070700_100236296 | 3300005441 | Bacteria | 1303 |
| 112 | Ga0070700_100427417 | 3300005441 | Bacteria | 1002 |
| 113 | Ga0070700_100552378 | 3300005441 | Bacteria | 895 |
| 114 | Ga0070700_100571323 | 3300005441 | Bacteria | 881 |
| 115 | Ga0070700_100586827 | 3300005441 | Unclassified | 871 |
| 116 | Ga0070700_100595831 | 3300005441 | Bacteria | 865 |
| 117 | Ga0070700_100985164 | 3300005441 | Bacteria | 692 |
| 118 | Ga0070694_100013842 | 3300005444 | Bacteria | 5045 |
| 119 | Ga0070694_100090801 | 3300005444 | Bacteria | 2142 |
| 120 | Ga0070694_100751029 | 3300005444 | Bacteria | 797 |
| 121 | Ga0070663_100437513 | 3300005455 | Unclassified | 1075 |
| 122 | Ga0070663_100517069 | 3300005455 | Bacteria | 993 |
| 123 | Ga0070678_100012221 | 3300005456 | Bacteria | 5327 |
| 124 | Ga0070678_100237344 | 3300005456 | Bacteria | 1523 |
| 125 | Ga0070678_100313838 | 3300005456 | Bacteria | 1337 |
| 126 | Ga0070678_100317990 | 3300005456 | Bacteria | 1328 |
| 127 | Ga0070678_100338260 | 3300005456 | Bacteria | 1290 |
| 128 | Ga0070678_100347777 | 3300005456 | Unclassified | 1274 |
| 129 | Ga0070678_101013739 | 3300005456 | Bacteria | 763 |
| 130 | Ga0070662_100016137 | 3300005457 | Bacteria | 5011 |
| 131 | Ga0070662_100017748 | 3300005457 | Bacteria | 4801 |
| 132 | Ga0070662_100048961 | 3300005457 | Bacteria | 3047 |
| 133 | Ga0070662_100901306 | 3300005457 | Unclassified | 754 |
| 134 | Ga0070681_10009307 | 3300005458 | Bacteria | 9663 |
| 135 | Ga0070681_10022112 | 3300005458 | Bacteria | 6383 |
| 136 | Ga0070681_10062368 | 3300005458 | Bacteria | 3701 |
| 137 | Ga0070681_10177554 | 3300005458 | Bacteria | 2051 |
| 138 | Ga0070681_10264879 | 3300005458 | Bacteria | 1630 |
| 139 | Ga0068867_100011424 | 3300005459 | Bacteria | 6266 |
| 140 | Ga0068867_100047753 | 3300005459 | Bacteria | 3148 |
| 141 | Ga0068867_100236631 | 3300005459 | Bacteria | 1479 |
| 142 | Ga0068867_100985105 | 3300005459 | Bacteria | 763 |
| 143 | Ga0070685_10000906 | 3300005466 | Bacteria | 15926 |
| 144 | Ga0070685_10007842 | 3300005466 | Bacteria | 5467 |
| 145 | Ga0070685_10126548 | 3300005466 | Bacteria | 1592 |
| 146 | Ga0070706_100031877 | 3300005467 | Bacteria | 4859 |
| 147 | Ga0070707_100000570 | 3300005468 | Bacteria | 37054 |
| 148 | Ga0070707_100096210 | 3300005468 | Bacteria | 2868 |
| 149 | Ga0070699_100030146 | 3300005518 | Bacteria | 4681 |
| 150 | Ga0070699_100388923 | 3300005518 | Bacteria | 1260 |
| 151 | Ga0070679_100010388 | 3300005530 | Bacteria | 8830 |
| 152 | Ga0070679_100020579 | 3300005530 | Bacteria | 6434 |
| 153 | Ga0070679_100023275 | 3300005530 | Bacteria | 6061 |
| 154 | Ga0070679_100243505 | 3300005530 | Bacteria | 1755 |
| 155 | Ga0070679_100288463 | 3300005530 | Bacteria | 1593 |
| 156 | Ga0070679_101066196 | 3300005530 | Bacteria | 752 |
| 157 | Ga0070679_101176687 | 3300005530 | Bacteria | 712 |
| 158 | Ga0070684_100000634 | 3300005535 | Bacteria | 24130 |
| 159 | Ga0070684_100011665 | 3300005535 | Bacteria | 7007 |
| 160 | Ga0070684_100024133 | 3300005535 | Bacteria | 5098 |
| 161 | Ga0070684_100029406 | 3300005535 | Bacteria | 4656 |
| 162 | Ga0070684_100198038 | 3300005535 | Bacteria | 1829 |
| 163 | Ga0070684_100342306 | 3300005535 | Bacteria | 1375 |
| 164 | Ga0070684_101267447 | 3300005535 | Bacteria | 693 |
| 165 | Ga0070697_100150866 | 3300005536 | Bacteria | 1959 |
| 166 | Ga0068853_100031095 | 3300005539 | Bacteria | 4514 |
| 167 | Ga0068853_100070321 | 3300005539 | Bacteria | 3046 |
| 168 | Ga0068853_100104917 | 3300005539 | Bacteria | 2503 |
| 169 | Ga0068853_100545371 | 3300005539 | Bacteria | 1098 |
| 170 | Ga0070672_100012733 | 3300005543 | Bacteria | 5921 |
| 171 | Ga0070672_100047840 | 3300005543 | Bacteria | 3320 |
| 172 | Ga0070672_100061149 | 3300005543 | Bacteria | 2968 |
| 173 | Ga0070686_100006796 | 3300005544 | Bacteria | 6368 |
| 174 | Ga0070686_100241485 | 3300005544 | Bacteria | 1315 |
| 175 | Ga0070695_100029877 | 3300005545 | Bacteria | 3389 |
| 176 | Ga0070695_100031918 | 3300005545 | Bacteria | 3290 |
| 177 | Ga0070696_100028797 | 3300005546 | Bacteria | 3790 |
| 178 | Ga0070696_100218863 | 3300005546 | Bacteria | 1428 |
| 179 | Ga0070696_100738378 | 3300005546 | Bacteria | 805 |
| 180 | Ga0070693_100103112 | 3300005547 | Bacteria | 1741 |
| 181 | Ga0070693_100113908 | 3300005547 | Bacteria | 1668 |
| 182 | Ga0070693_100135874 | 3300005547 | Bacteria | 1542 |
| 183 | Ga0070693_100466625 | 3300005547 | Bacteria | 889 |
| 184 | Ga0070665_100143887 | 3300005548 | Bacteria | 2387 |
| 185 | Ga0070665_100239330 | 3300005548 | Bacteria | 1816 |
| 186 | Ga0070665_100545571 | 3300005548 | Bacteria | 1171 |
| 187 | Ga0070704_100015880 | 3300005549 | Bacteria | 4742 |
| 188 | Ga0070704_100036602 | 3300005549 | Bacteria | 3346 |
| 189 | Ga0070704_100399269 | 3300005549 | Unclassified | 1173 |
| 190 | Ga0070704_100412297 | 3300005549 | Unclassified | 1155 |
| 191 | Ga0070704_100659290 | 3300005549 | Bacteria | 924 |
| 192 | Ga0068855_100107593 | 3300005563 | Bacteria | 3203 |
| 193 | Ga0068855_100651087 | 3300005563 | Bacteria | 1131 |
| 194 | Ga0070664_100049663 | 3300005564 | Bacteria | 3548 |
| 195 | Ga0070664_100072406 | 3300005564 | Bacteria | 2955 |
| 196 | Ga0070664_100226947 | 3300005564 | Bacteria | 1673 |
| 197 | Ga0070664_100399411 | 3300005564 | Bacteria | 1257 |
| 198 | Ga0070664_100412135 | 3300005564 | Bacteria | 1237 |
| 199 | Ga0070664_100604104 | 3300005564 | Bacteria | 1017 |
| 200 | Ga0070664_101410841 | 3300005564 | Bacteria | 658 |
| 201 | Ga0068857_100050538 | 3300005577 | Bacteria | 3687 |
| 202 | Ga0068857_100622894 | 3300005577 | Unclassified | 1021 |
| 203 | Ga0068854_100038806 | 3300005578 | Bacteria | 3351 |
| 204 | Ga0068856_100005850 | 3300005614 | Bacteria | 12119 |
| 205 | Ga0068856_100025213 | 3300005614 | Bacteria | 5793 |
| 206 | Ga0068856_100189955 | 3300005614 | Bacteria | 2068 |
| 207 | Ga0068856_100269155 | 3300005614 | Bacteria | 1719 |
| 208 | Ga0070702_100012908 | 3300005615 | Bacteria | 4206 |
| 209 | Ga0070702_100199097 | 3300005615 | Bacteria | 1324 |
| 210 | Ga0068852_100001457 | 3300005616 | Bacteria | 15978 |
| 211 | Ga0068852_100059585 | 3300005616 | Bacteria | 3311 |
| 212 | Ga0068852_100074511 | 3300005616 | Bacteria | 2990 |
| 213 | Ga0068852_100150197 | 3300005616 | Bacteria | 2166 |
| 214 | Ga0068852_100207699 | 3300005616 | Bacteria | 1856 |
| 215 | Ga0068859_100081137 | 3300005617 | Bacteria | 3285 |
| 216 | Ga0068859_100096319 | 3300005617 | Bacteria | 3012 |
| 217 | Ga0068859_100378757 | 3300005617 | Bacteria | 1511 |
| 218 | Ga0068864_100355285 | 3300005618 | Bacteria | 1384 |
| 219 | Ga0068866_10003460 | 3300005718 | Bacteria | 6464 |
| 220 | Ga0068866_10057442 | 3300005718 | Bacteria | 2005 |
| 221 | Ga0068866_10091732 | 3300005718 | Bacteria | 1656 |
| 222 | Ga0068866_10185367 | 3300005718 | Bacteria | 1232 |
| 223 | Ga0068866_10777641 | 3300005718 | Bacteria | 663 |
| 224 | Ga0068861_100076801 | 3300005719 | Bacteria | 2604 |
| 225 | Ga0068861_100249784 | 3300005719 | Bacteria | 1513 |
| 226 | Ga0068861_100441244 | 3300005719 | Bacteria | 1164 |
| 227 | Ga0068861_100676235 | 3300005719 | Bacteria | 956 |
| 228 | Ga0068870_10022271 | 3300005840 | Bacteria | 3111 |
| 229 | Ga0068870_10203691 | 3300005840 | Bacteria | 1201 |
| 230 | Ga0068863_100059180 | 3300005841 | Bacteria | 3625 |
| 231 | Ga0068863_101613326 | 3300005841 | Bacteria | 658 |
| 232 | Ga0068858_100080417 | 3300005842 | Bacteria | 3028 |
| 233 | Ga0068860_100057257 | 3300005843 | Bacteria | 3705 |
| 234 | Ga0068860_100723162 | 3300005843 | Bacteria | 1006 |
| 235 | Ga0068862_100092345 | 3300005844 | Bacteria | 2638 |
| 236 | Ga0068862_100176542 | 3300005844 | Bacteria | 1915 |
| 237 | Ga0068862_100188608 | 3300005844 | Bacteria | 1854 |
| 238 | Ga0081455_10048423 | 3300005937 | Bacteria | 3673 |
| 239 | Ga0081455_10062523 | 3300005937 | Bacteria | 3129 |
| 240 | Ga0081455_10172657 | 3300005937 | Bacteria | 1645 |
| 241 | Ga0081539_10000171 | 3300005985 | Bacteria | 152572 |
| 242 | Ga0081539_10002475 | 3300005985 | Bacteria | 25990 |
| 243 | Ga0081539_10019265 | 3300005985 | Bacteria | 4680 |
| 244 | Ga0075365_10220650 | 3300006038 | Bacteria | 1330 |
| 245 | Ga0075432_10001317 | 3300006058 | Bacteria | 8020 |
| 246 | Ga0075432_10197256 | 3300006058 | Bacteria | 795 |
| 247 | Ga0070715_10166198 | 3300006163 | Bacteria | 1095 |
| 248 | Ga0070716_100177238 | 3300006173 | Bacteria | 1396 |
| 249 | Ga0070712_100011978 | 3300006175 | Bacteria | 5513 |
| 250 | Ga0070712_100050752 | 3300006175 | Bacteria | 2887 |
| 251 | Ga0070712_100666910 | 3300006175 | Bacteria | 885 |
| 252 | Ga0097621_100023192 | 3300006237 | Bacteria | 4828 |
| 253 | Ga0097621_100226364 | 3300006237 | Bacteria | 1631 |
| 254 | Ga0097621_100352929 | 3300006237 | Bacteria | 1308 |
| 255 | Ga0068871_100118754 | 3300006358 | Bacteria | 2231 |
| 256 | Ga0068871_100536120 | 3300006358 | Bacteria | 1059 |
| 257 | Ga0068871_100573292 | 3300006358 | Bacteria | 1024 |
| 258 | Ga0068871_100971887 | 3300006358 | Bacteria | 790 |
| 259 | Ga0075428_100003867 | 3300006844 | Bacteria | 16450 |
| 260 | Ga0075428_100031645 | 3300006844 | Bacteria | 5846 |
| 261 | Ga0075428_101045104 | 3300006844 | Unclassified | 864 |
| 262 | Ga0075430_100003220 | 3300006846 | Bacteria | 13674 |
| 263 | Ga0075430_100052536 | 3300006846 | Bacteria | 3433 |
| 264 | Ga0075431_100001247 | 3300006847 | Bacteria | 23120 |
| 265 | Ga0075431_100065932 | 3300006847 | Bacteria | 3738 |
| 266 | Ga0075433_10017222 | 3300006852 | Bacteria | 5980 |
| 267 | Ga0075433_10227278 | 3300006852 | Bacteria | 1657 |
| 268 | Ga0075434_100048775 | 3300006871 | Bacteria | 4202 |
| 269 | Ga0075434_100142588 | 3300006871 | Bacteria | 2416 |
| 270 | Ga0075434_100774292 | 3300006871 | Bacteria | 976 |
| 271 | Ga0075434_100780808 | 3300006871 | Unclassified | 972 |
| 272 | Ga0075429_100034988 | 3300006880 | Bacteria | 4366 |
| 273 | Ga0075429_100075005 | 3300006880 | Bacteria | 2946 |
| 274 | Ga0068865_100002544 | 3300006881 | Bacteria | 10808 |
| 275 | Ga0068865_100016384 | 3300006881 | Bacteria | 4742 |
| 276 | Ga0068865_100049535 | 3300006881 | Bacteria | 2896 |
| 277 | Ga0068865_101262863 | 3300006881 | Unclassified | 655 |
| 278 | Ga0075436_100038314 | 3300006914 | Bacteria | 3309 |
| 279 | Ga0075436_100351145 | 3300006914 | Unclassified | 1063 |
| 280 | Ga0097620_100081141 | 3300006931 | Bacteria | 3285 |
| 281 | Ga0097620_100096324 | 3300006931 | Bacteria | 3012 |
| 282 | Ga0097620_100378741 | 3300006931 | Bacteria | 1511 |
| 283 | Ga0075435_100052082 | 3300007076 | Bacteria | 3299 |
| 284 | Ga0075435_100089179 | 3300007076 | Bacteria | 2542 |
| 285 | Ga0075435_100404014 | 3300007076 | Bacteria | 1175 |
| 286 | Ga0075435_101134814 | 3300007076 | Bacteria | 683 |
| 287 | Ga0105244_10217989 | 3300009036 | Bacteria | 896 |
| 288 | Ga0105240_10020003 | 3300009093 | Bacteria | 8937 |
| 289 | Ga0105240_10128114 | 3300009093 | Bacteria | 3047 |
| 290 | Ga0105240_10237940 | 3300009093 | Bacteria | 2112 |
| 291 | Ga0111539_10004209 | 3300009094 | Bacteria | 18879 |
| 292 | Ga0111539_10004392 | 3300009094 | Bacteria | 18444 |
| 293 | Ga0111539_10022303 | 3300009094 | Bacteria | 7782 |
| 294 | Ga0111539_10054760 | 3300009094 | Bacteria | 4745 |
| 295 | Ga0111539_10117881 | 3300009094 | Bacteria | 3111 |
| 296 | Ga0111539_10196070 | 3300009094 | Bacteria | 2355 |
| 297 | Ga0111539_10512172 | 3300009094 | Bacteria | 1398 |
| 298 | Ga0111539_11000798 | 3300009094 | Bacteria | 972 |
| 299 | Ga0111539_11324215 | 3300009094 | Bacteria | 836 |
| 300 | Ga0105245_10001410 | 3300009098 | Bacteria | 21797 |
| 301 | Ga0105245_10009307 | 3300009098 | Bacteria | 8566 |
| 302 | Ga0105245_10094598 | 3300009098 | Bacteria | 2755 |
| 303 | Ga0105245_10133513 | 3300009098 | Bacteria | 2330 |
| 304 | Ga0105245_10232857 | 3300009098 | Bacteria | 1782 |
| 305 | Ga0105245_10509603 | 3300009098 | Bacteria | 1220 |
| 306 | Ga0105245_10798509 | 3300009098 | Bacteria | 982 |
| 307 | Ga0105245_11061616 | 3300009098 | Bacteria | 856 |
| 308 | Ga0105245_11636117 | 3300009098 | Bacteria | 696 |
| 309 | Ga0105245_12002927 | 3300009098 | Bacteria | 632 |
| 310 | Ga0105247_10018183 | 3300009101 | Bacteria | 4216 |
| 311 | Ga0114129_10033703 | 3300009147 | Bacteria | 7236 |
| 312 | Ga0114129_10088860 | 3300009147 | Bacteria | 4284 |
| 313 | Ga0114129_10200380 | 3300009147 | Bacteria | 2704 |
| 314 | Ga0114129_10284330 | 3300009147 | Bacteria | 2209 |
| 315 | Ga0114129_10657613 | 3300009147 | Bacteria | 1352 |
| 316 | Ga0114129_11060973 | 3300009147 | Bacteria | 1017 |
| 317 | Ga0105243_10004978 | 3300009148 | Bacteria | 10414 |
| 318 | Ga0105243_10063858 | 3300009148 | Bacteria | 2952 |
| 319 | Ga0105243_10095348 | 3300009148 | Bacteria | 2459 |
| 320 | Ga0105243_10171191 | 3300009148 | Bacteria | 1881 |
| 321 | Ga0105243_10368726 | 3300009148 | Bacteria | 1324 |
| 322 | Ga0105243_10422594 | 3300009148 | Bacteria | 1244 |
| 323 | Ga0105243_10605758 | 3300009148 | Bacteria | 1055 |
| 324 | Ga0105243_11320497 | 3300009148 | Bacteria | 739 |
| 325 | Ga0105243_11576266 | 3300009148 | Unclassified | 683 |
| 326 | Ga0105241_10052789 | 3300009174 | Bacteria | 3105 |
| 327 | Ga0105241_10064497 | 3300009174 | Bacteria | 2828 |
| 328 | Ga0105241_10830990 | 3300009174 | Bacteria | 853 |
| 329 | Ga0105242_10024948 | 3300009176 | Bacteria | 4726 |
| 330 | Ga0105242_10056670 | 3300009176 | Bacteria | 3207 |
| 331 | Ga0105242_10075756 | 3300009176 | Bacteria | 2802 |
| 332 | Ga0105242_10109621 | 3300009176 | Bacteria | 2351 |
| 333 | Ga0105242_10115588 | 3300009176 | Bacteria | 2294 |
| 334 | Ga0105242_10316738 | 3300009176 | Bacteria | 1429 |
| 335 | Ga0105242_10390436 | 3300009176 | Bacteria | 1296 |
| 336 | Ga0105242_10741417 | 3300009176 | Bacteria | 966 |
| 337 | Ga0105242_11752794 | 3300009176 | Bacteria | 658 |
| 338 | Ga0105248_10011713 | 3300009177 | Bacteria | 9669 |
| 339 | Ga0105248_10103763 | 3300009177 | Bacteria | 3205 |
| 340 | Ga0105248_10262543 | 3300009177 | Bacteria | 1944 |
| 341 | Ga0105248_10336692 | 3300009177 | Bacteria | 1699 |
| 342 | Ga0105248_10651293 | 3300009177 | Bacteria | 1189 |
| 343 | Ga0105237_10383679 | 3300009545 | Bacteria | 1410 |
| 344 | Ga0105238_10084078 | 3300009551 | Bacteria | 3172 |
| 345 | Ga0105238_10142405 | 3300009551 | Bacteria | 2374 |
| 346 | Ga0105238_10859604 | 3300009551 | Bacteria | 924 |
| 347 | Ga0105249_10006912 | 3300009553 | Bacteria | 9893 |
| 348 | Ga0105249_10107016 | 3300009553 | Bacteria | 2639 |
| 349 | Ga0105249_10269695 | 3300009553 | Bacteria | 1695 |
| 350 | Ga0105249_10443777 | 3300009553 | Unclassified | 1335 |
| 351 | Ga0105249_12097845 | 3300009553 | Bacteria | 638 |
| 352 | Ga0105239_10021863 | 3300010375 | Bacteria | 7051 |
| 353 | Ga0105239_10047682 | 3300010375 | Bacteria | 4695 |
| 354 | Ga0105239_10048190 | 3300010375 | Bacteria | 4672 |
| 355 | Ga0105239_10167984 | 3300010375 | Bacteria | 2453 |
| 356 | Ga0105239_10306318 | 3300010375 | Bacteria | 1790 |
| 357 | Ga0105239_10871679 | 3300010375 | Bacteria | 1033 |
| 358 | Ga0105246_10102111 | 3300011119 | Bacteria | 2090 |
| 359 | Ga0105246_10271431 | 3300011119 | Bacteria | 1356 |
| 360 | Ga0105246_10681203 | 3300011119 | Unclassified | 899 |
| 361 | Ga0157373_10262194 | 3300013100 | Bacteria | 1223 |
| 362 | Ga0157371_10137265 | 3300013102 | Bacteria | 1741 |
| 363 | Ga0157370_10008006 | 3300013104 | Bacteria | 11450 |
| 364 | Ga0157370_10140694 | 3300013104 | Bacteria | 2249 |
| 365 | Ga0157370_10285596 | 3300013104 | Bacteria | 1524 |
| 366 | Ga0157369_10041209 | 3300013105 | Bacteria | 5040 |
| 367 | Ga0157369_10088101 | 3300013105 | Bacteria | 3313 |
| 368 | Ga0157369_10296965 | 3300013105 | Bacteria | 1681 |
| 369 | Ga0157369_10545256 | 3300013105 | Bacteria | 1199 |
| 370 | Ga0157374_10003624 | 3300013296 | Bacteria | 12994 |
| 371 | Ga0157374_10113014 | 3300013296 | Bacteria | 2614 |
| 372 | Ga0157374_10534663 | 3300013296 | Bacteria | 1179 |
| 373 | Ga0157378_10047180 | 3300013297 | Bacteria | 3829 |
| 374 | Ga0157378_10100448 | 3300013297 | Bacteria | 2641 |
| 375 | Ga0157378_12105278 | 3300013297 | Bacteria | 615 |
| 376 | Ga0163162_10009652 | 3300013306 | Bacteria | 9384 |
| 377 | Ga0163162_10119361 | 3300013306 | Bacteria | 2740 |
| 378 | Ga0157372_10026673 | 3300013307 | Bacteria | 6287 |
| 379 | Ga0157372_10035981 | 3300013307 | Bacteria | 5453 |
| 380 | Ga0157372_10508224 | 3300013307 | Bacteria | 1405 |
| 381 | Ga0157372_10660762 | 3300013307 | Bacteria | 1217 |
| 382 | Ga0157372_10699759 | 3300013307 | Bacteria | 1179 |
| 383 | Ga0157372_10980931 | 3300013307 | Unclassified | 979 |
| 384 | Ga0157375_10004528 | 3300013308 | Bacteria | 12077 |
| 385 | Ga0157375_10325016 | 3300013308 | Bacteria | 1703 |
| 386 | Ga0157375_10540364 | 3300013308 | Bacteria | 1328 |
| 387 | Ga0157375_10942063 | 3300013308 | Unclassified | 1006 |
| 388 | Ga0157375_11258140 | 3300013308 | Bacteria | 869 |
| 389 | Ga0157375_11406067 | 3300013308 | Bacteria | 822 |
| 390 | Ga0163163_11029622 | 3300014325 | Bacteria | 887 |
| 391 | Ga0163163_11147477 | 3300014325 | Bacteria | 840 |
| 392 | Ga0163163_11763544 | 3300014325 | Bacteria | 679 |
| 393 | Ga0157380_10010543 | 3300014326 | Bacteria | 6649 |
| 394 | Ga0157380_10010900 | 3300014326 | Bacteria | 6554 |
| 395 | Ga0157380_10188720 | 3300014326 | Bacteria | 1818 |
| 396 | Ga0157380_10932301 | 3300014326 | Bacteria | 897 |
| 397 | Ga0182008_10196722 | 3300014497 | Bacteria | 1024 |
| 398 | Ga0157377_10013489 | 3300014745 | Bacteria | 4136 |
| 399 | Ga0157377_10107788 | 3300014745 | Bacteria | 1670 |
| 400 | Ga0157377_10288389 | 3300014745 | Bacteria | 1079 |
| 401 | Ga0157379_10051692 | 3300014968 | Bacteria | 3670 |
| 402 | Ga0157379_10249268 | 3300014968 | Bacteria | 1612 |
| 403 | Ga0157376_10416727 | 3300014969 | Bacteria | 1302 |
| 404 | Ga0163161_10026238 | 3300017792 | Bacteria | 4127 |
| 405 | Ga0163161_10098814 | 3300017792 | Bacteria | 2170 |
| 406 | Ga0197907_10539662 | 3300020069 | Bacteria | 3237 |
| 407 | Ga0206356_11217405 | 3300020070 | Bacteria | 3061 |
| 408 | Ga0206354_10913791 | 3300020081 | Bacteria | 5007 |
| 409 | Ga0206353_11304487 | 3300020082 | Bacteria | 5337 |
| 410 | Ga0206353_11639839 | 3300020082 | Bacteria | 1643 |
| 411 | Ga0207653_10003328 | 3300025885 | Bacteria | 5076 |
| 412 | Ga0207653_10014014 | 3300025885 | Bacteria | 2513 |
| 413 | Ga0207653_10066133 | 3300025885 | Bacteria | 1228 |
| 414 | Ga0207682_10086863 | 3300025893 | Bacteria | 1350 |
| 415 | Ga0207642_10001672 | 3300025899 | Bacteria | 6846 |
| 416 | Ga0207642_10067726 | 3300025899 | Bacteria | 1686 |
| 417 | Ga0207642_10148826 | 3300025899 | Bacteria | 1243 |
| 418 | Ga0207688_10007450 | 3300025901 | Bacteria | 5950 |
| 419 | Ga0207688_10033979 | 3300025901 | Bacteria | 2822 |
| 420 | Ga0207680_10026351 | 3300025903 | Bacteria | 3222 |
| 421 | Ga0207647_10431373 | 3300025904 | Unclassified | 740 |
| 422 | Ga0207685_10122696 | 3300025905 | Bacteria | 1143 |
| 423 | Ga0207699_10018463 | 3300025906 | Bacteria | 3696 |
| 424 | Ga0207699_10178810 | 3300025906 | Bacteria | 1424 |
| 425 | Ga0207699_10349497 | 3300025906 | Bacteria | 1043 |
| 426 | Ga0207645_10101095 | 3300025907 | Bacteria | 1860 |
| 427 | Ga0207643_10131296 | 3300025908 | Bacteria | 1491 |
| 428 | Ga0207705_10031496 | 3300025909 | Bacteria | 3787 |
| 429 | Ga0207705_10105055 | 3300025909 | Bacteria | 2081 |
| 430 | Ga0207705_10481549 | 3300025909 | Unclassified | 963 |
| 431 | Ga0207654_10403349 | 3300025911 | Bacteria | 951 |
| 432 | Ga0207654_10550638 | 3300025911 | Bacteria | 819 |
| 433 | Ga0207707_10006681 | 3300025912 | Bacteria | 10063 |
| 434 | Ga0207707_10016082 | 3300025912 | Bacteria | 6526 |
| 435 | Ga0207707_10081719 | 3300025912 | Bacteria | 2821 |
| 436 | Ga0207707_10456452 | 3300025912 | Bacteria | 1093 |
| 437 | Ga0207695_10105754 | 3300025913 | Bacteria | 2801 |
| 438 | Ga0207695_10176920 | 3300025913 | Bacteria | 2056 |
| 439 | Ga0207671_10106991 | 3300025914 | Bacteria | 2124 |
| 440 | Ga0207671_10193710 | 3300025914 | Bacteria | 1585 |
| 441 | Ga0207693_10000406 | 3300025915 | Bacteria | 39259 |
| 442 | Ga0207693_10006070 | 3300025915 | Bacteria | 10005 |
| 443 | Ga0207693_10322848 | 3300025915 | Unclassified | 1208 |
| 444 | Ga0207663_10015925 | 3300025916 | Bacteria | 4160 |
| 445 | Ga0207660_10076124 | 3300025917 | Bacteria | 2453 |
| 446 | Ga0207660_10137997 | 3300025917 | Bacteria | 1862 |
| 447 | Ga0207660_10139274 | 3300025917 | Bacteria | 1854 |
| 448 | Ga0207660_10635389 | 3300025917 | Bacteria | 870 |
| 449 | Ga0207660_11164017 | 3300025917 | Bacteria | 628 |
| 450 | Ga0207662_10061124 | 3300025918 | Bacteria | 2261 |
| 451 | Ga0207662_10200495 | 3300025918 | Bacteria | 1291 |
| 452 | Ga0207662_10234148 | 3300025918 | Bacteria | 1200 |
| 453 | Ga0207662_10621003 | 3300025918 | Unclassified | 753 |
| 454 | Ga0207657_10000073 | 3300025919 | Bacteria | 93299 |
| 455 | Ga0207657_10005637 | 3300025919 | Bacteria | 13064 |
| 456 | Ga0207657_10011355 | 3300025919 | Bacteria | 8847 |
| 457 | Ga0207657_10021284 | 3300025919 | Bacteria | 6108 |
| 458 | Ga0207657_10106882 | 3300025919 | Bacteria | 2315 |
| 459 | Ga0207657_10196081 | 3300025919 | Bacteria | 1627 |
| 460 | Ga0207657_10293084 | 3300025919 | Bacteria | 1290 |
| 461 | Ga0207649_10046264 | 3300025920 | Bacteria | 2672 |
| 462 | Ga0207649_10094244 | 3300025920 | Bacteria | 1967 |
| 463 | Ga0207649_10337826 | 3300025920 | Bacteria | 1111 |
| 464 | Ga0207649_10893965 | 3300025920 | Bacteria | 696 |
| 465 | Ga0207652_10149358 | 3300025921 | Bacteria | 2092 |
| 466 | Ga0207652_10192008 | 3300025921 | Bacteria | 1837 |
| 467 | Ga0207652_10601995 | 3300025921 | Unclassified | 985 |
| 468 | Ga0207646_10000371 | 3300025922 | Bacteria | 59994 |
| 469 | Ga0207681_10263677 | 3300025923 | Bacteria | 1350 |
| 470 | Ga0207681_10342077 | 3300025923 | Bacteria | 1195 |
| 471 | Ga0207694_10394833 | 3300025924 | Bacteria | 1150 |
| 472 | Ga0207694_10444961 | 3300025924 | Bacteria | 1081 |
| 473 | Ga0207694_10608050 | 3300025924 | Bacteria | 919 |
| 474 | Ga0207650_10523668 | 3300025925 | Bacteria | 992 |
| 475 | Ga0207659_10021037 | 3300025926 | Bacteria | 4324 |
| 476 | Ga0207659_10133716 | 3300025926 | Bacteria | 1918 |
| 477 | Ga0207659_10143509 | 3300025926 | Bacteria | 1856 |
| 478 | Ga0207659_10397553 | 3300025926 | Bacteria | 1152 |
| 479 | Ga0207659_10490243 | 3300025926 | Bacteria | 1039 |
| 480 | Ga0207687_10012420 | 3300025927 | Bacteria | 5564 |
| 481 | Ga0207687_10085812 | 3300025927 | Bacteria | 2285 |
| 482 | Ga0207687_10108012 | 3300025927 | Bacteria | 2060 |
| 483 | Ga0207687_10133288 | 3300025927 | Bacteria | 1876 |
| 484 | Ga0207687_10138016 | 3300025927 | Bacteria | 1846 |
| 485 | Ga0207687_10184651 | 3300025927 | Bacteria | 1618 |
| 486 | Ga0207687_10322555 | 3300025927 | Bacteria | 1251 |
| 487 | Ga0207687_10682587 | 3300025927 | Bacteria | 871 |
| 488 | Ga0207687_10686773 | 3300025927 | Bacteria | 868 |
| 489 | Ga0207687_11011545 | 3300025927 | Archaea | 713 |
| 490 | Ga0207700_10208321 | 3300025928 | Bacteria | 1651 |
| 491 | Ga0207664_10360711 | 3300025929 | Bacteria | 1287 |
| 492 | Ga0207644_10083311 | 3300025931 | Bacteria | 2368 |
| 493 | Ga0207644_11108226 | 3300025931 | Bacteria | 665 |
| 494 | Ga0207690_10077295 | 3300025932 | Bacteria | 2313 |
| 495 | Ga0207690_10085152 | 3300025932 | Bacteria | 2218 |
| 496 | Ga0207690_10106185 | 3300025932 | Bacteria | 2015 |
| 497 | Ga0207690_10363845 | 3300025932 | Bacteria | 1146 |
| 498 | Ga0207690_10731447 | 3300025932 | Bacteria | 815 |
| 499 | Ga0207706_10006048 | 3300025933 | Bacteria | 11256 |
| 500 | Ga0207706_10027149 | 3300025933 | Bacteria | 5121 |
| 501 | Ga0207706_10117640 | 3300025933 | Bacteria | 2337 |
| 502 | Ga0207706_10341074 | 3300025933 | Bacteria | 1303 |
| 503 | Ga0207686_10048544 | 3300025934 | Bacteria | 2630 |
| 504 | Ga0207686_10199040 | 3300025934 | Bacteria | 1433 |
| 505 | Ga0207686_10222230 | 3300025934 | Bacteria | 1364 |
| 506 | Ga0207686_10291750 | 3300025934 | Bacteria | 1208 |
| 507 | Ga0207686_10327884 | 3300025934 | Bacteria | 1146 |
| 508 | Ga0207686_10693909 | 3300025934 | Bacteria | 809 |
| 509 | Ga0207686_10747661 | 3300025934 | Bacteria | 780 |
| 510 | Ga0207686_11167262 | 3300025934 | Bacteria | 629 |
| 511 | Ga0207709_10005915 | 3300025935 | Bacteria | 6901 |
| 512 | Ga0207709_10023341 | 3300025935 | Bacteria | 3520 |
| 513 | Ga0207709_10089416 | 3300025935 | Bacteria | 2008 |
| 514 | Ga0207709_10140656 | 3300025935 | Bacteria | 1658 |
| 515 | Ga0207709_10296268 | 3300025935 | Bacteria | 1201 |
| 516 | Ga0207709_10930163 | 3300025935 | Unclassified | 708 |
| 517 | Ga0207669_10018239 | 3300025937 | Bacteria | 3622 |
| 518 | Ga0207669_10035642 | 3300025937 | Bacteria | 2834 |
| 519 | Ga0207669_10082370 | 3300025937 | Bacteria | 2065 |
| 520 | Ga0207669_10107322 | 3300025937 | Bacteria | 1862 |
| 521 | Ga0207669_10581661 | 3300025937 | Bacteria | 908 |
| 522 | Ga0207704_10010042 | 3300025938 | Bacteria | 4597 |
| 523 | Ga0207704_10022947 | 3300025938 | Bacteria | 3354 |
| 524 | Ga0207704_10075273 | 3300025938 | Bacteria | 2158 |
| 525 | Ga0207704_10093357 | 3300025938 | Bacteria | 1983 |
| 526 | Ga0207704_10106081 | 3300025938 | Bacteria | 1886 |
| 527 | Ga0207665_10027352 | 3300025939 | Bacteria | 3768 |
| 528 | Ga0207665_10683337 | 3300025939 | Bacteria | 806 |
| 529 | Ga0207691_10012106 | 3300025940 | Bacteria | 8269 |
| 530 | Ga0207691_10020746 | 3300025940 | Bacteria | 6212 |
| 531 | Ga0207711_10071375 | 3300025941 | Bacteria | 3013 |
| 532 | Ga0207711_10073998 | 3300025941 | Bacteria | 2962 |
| 533 | Ga0207711_10342124 | 3300025941 | Bacteria | 1384 |
| 534 | Ga0207711_10370784 | 3300025941 | Bacteria | 1327 |
| 535 | Ga0207689_10510072 | 3300025942 | Bacteria | 1008 |
| 536 | Ga0207689_10661583 | 3300025942 | Bacteria | 880 |
| 537 | Ga0207689_10870371 | 3300025942 | Bacteria | 760 |
| 538 | Ga0207689_11071065 | 3300025942 | Bacteria | 680 |
| 539 | Ga0207661_10000400 | 3300025944 | Bacteria | 28071 |
| 540 | Ga0207661_10001504 | 3300025944 | Bacteria | 15791 |
| 541 | Ga0207661_10045319 | 3300025944 | Bacteria | 3480 |
| 542 | Ga0207661_10057322 | 3300025944 | Bacteria | 3132 |
| 543 | Ga0207661_10153477 | 3300025944 | Bacteria | 1992 |
| 544 | Ga0207661_10230763 | 3300025944 | Bacteria | 1639 |
| 545 | Ga0207661_10307900 | 3300025944 | Unclassified | 1421 |
| 546 | Ga0207661_10308889 | 3300025944 | Bacteria | 1419 |
| 547 | Ga0207661_10331093 | 3300025944 | Bacteria | 1371 |
| 548 | Ga0207661_10394192 | 3300025944 | Bacteria | 1255 |
| 549 | Ga0207661_10769699 | 3300025944 | Bacteria | 886 |
| 550 | Ga0207661_10964535 | 3300025944 | Bacteria | 785 |
| 551 | Ga0207661_11252104 | 3300025944 | Bacteria | 682 |
| 552 | Ga0207679_10023009 | 3300025945 | Bacteria | 4253 |
| 553 | Ga0207679_10183150 | 3300025945 | Bacteria | 1734 |
| 554 | Ga0207679_11176588 | 3300025945 | Bacteria | 704 |
| 555 | Ga0207667_10192884 | 3300025949 | Bacteria | 2090 |
| 556 | Ga0207667_10215571 | 3300025949 | Bacteria | 1967 |
| 557 | Ga0207667_10513440 | 3300025949 | Bacteria | 1214 |
| 558 | Ga0207667_10547421 | 3300025949 | Bacteria | 1171 |
| 559 | Ga0207667_11592184 | 3300025949 | Bacteria | 622 |
| 560 | Ga0207712_10352720 | 3300025961 | Bacteria | 1224 |
| 561 | Ga0207668_10064071 | 3300025972 | Bacteria | 2596 |
| 562 | Ga0207668_10105540 | 3300025972 | Bacteria | 2103 |
| 563 | Ga0207668_11106661 | 3300025972 | Bacteria | 710 |
| 564 | Ga0207640_10043230 | 3300025981 | Bacteria | 2879 |
| 565 | Ga0207640_10076778 | 3300025981 | Bacteria | 2269 |
| 566 | Ga0207640_10092498 | 3300025981 | Bacteria | 2098 |
| 567 | Ga0207658_10505242 | 3300025986 | Bacteria | 1077 |
| 568 | Ga0207677_10071822 | 3300026023 | Bacteria | 2444 |
| 569 | Ga0207677_10315707 | 3300026023 | Bacteria | 1297 |
| 570 | Ga0207703_10183672 | 3300026035 | Bacteria | 1847 |
| 571 | Ga0207703_11066225 | 3300026035 | Bacteria | 776 |
| 572 | Ga0207639_10032742 | 3300026041 | Bacteria | 3829 |
| 573 | Ga0207639_10077237 | 3300026041 | Bacteria | 2624 |
| 574 | Ga0207639_10365310 | 3300026041 | Bacteria | 1292 |
| 575 | Ga0207639_10397327 | 3300026041 | Bacteria | 1241 |
| 576 | Ga0207678_10017335 | 3300026067 | Bacteria | 6322 |
| 577 | Ga0207678_10317258 | 3300026067 | Bacteria | 1341 |
| 578 | Ga0207708_10007363 | 3300026075 | Bacteria | 8133 |
| 579 | Ga0207708_10030929 | 3300026075 | Bacteria | 4062 |
| 580 | Ga0207708_10058257 | 3300026075 | Bacteria | 2947 |
| 581 | Ga0207708_10327575 | 3300026075 | Bacteria | 1251 |
| 582 | Ga0207708_10386165 | 3300026075 | Bacteria | 1155 |
| 583 | Ga0207702_10021463 | 3300026078 | Bacteria | 5347 |
| 584 | Ga0207702_10164360 | 3300026078 | Bacteria | 2029 |
| 585 | Ga0207702_10352284 | 3300026078 | Bacteria | 1409 |
| 586 | Ga0207702_10361894 | 3300026078 | Bacteria | 1391 |
| 587 | Ga0207641_10368419 | 3300026088 | Bacteria | 1373 |
| 588 | Ga0207641_11217483 | 3300026088 | Bacteria | 753 |
| 589 | Ga0207648_10001155 | 3300026089 | Bacteria | 29566 |
| 590 | Ga0207648_10084594 | 3300026089 | Bacteria | 2767 |
| 591 | Ga0207648_10127528 | 3300026089 | Bacteria | 2238 |
| 592 | Ga0207648_10294676 | 3300026089 | Unclassified | 1453 |
| 593 | Ga0207676_10126455 | 3300026095 | Bacteria | 2165 |
| 594 | Ga0207676_10284405 | 3300026095 | Bacteria | 1503 |
| 595 | Ga0207674_10041905 | 3300026116 | Bacteria | 4732 |
| 596 | Ga0207674_10385540 | 3300026116 | Unclassified | 1355 |
| 597 | Ga0207674_11116331 | 3300026116 | Unclassified | 758 |
| 598 | Ga0207675_100039062 | 3300026118 | Bacteria | 4429 |
| 599 | Ga0207675_100108178 | 3300026118 | Bacteria | 2622 |
| 600 | Ga0207675_100673689 | 3300026118 | Bacteria | 1042 |
| 601 | Ga0207683_10001368 | 3300026121 | Bacteria | 22057 |
| 602 | Ga0207683_10028085 | 3300026121 | Bacteria | 4865 |
| 603 | Ga0207683_10071199 | 3300026121 | Bacteria | 3073 |
| 604 | Ga0207683_10082690 | 3300026121 | Bacteria | 2853 |
| 605 | Ga0207683_10144814 | 3300026121 | Bacteria | 2142 |
| 606 | Ga0207683_10383886 | 3300026121 | Bacteria | 1291 |
| 607 | Ga0207683_10725849 | 3300026121 | Bacteria | 921 |
| 608 | Ga0207683_11095619 | 3300026121 | Bacteria | 739 |
| 609 | Ga0207683_11296415 | 3300026121 | Bacteria | 674 |
| 610 | Ga0207698_10025256 | 3300026142 | Bacteria | 4182 |
| 611 | Ga0207698_10039363 | 3300026142 | Bacteria | 3502 |
| 612 | Ga0207698_10225989 | 3300026142 | Bacteria | 1695 |
| 613 | Ga0207428_10000104 | 3300027907 | Bacteria | 116036 |
| 614 | Ga0207428_10014814 | 3300027907 | Bacteria | 6754 |
| 615 | Ga0207428_10036344 | 3300027907 | Bacteria | 4018 |
| 616 | Ga0207428_10058751 | 3300027907 | Bacteria | 3051 |
| 617 | Ga0207428_10081818 | 3300027907 | Bacteria | 2521 |
| 618 | Ga0268266_10097009 | 3300028379 | Bacteria | 2592 |
| 619 | Ga0268266_10682479 | 3300028379 | Bacteria | 989 |
| 620 | Ga0268266_11326520 | 3300028379 | Bacteria | 695 |
| 621 | Ga0268265_11059754 | 3300028380 | Bacteria | 803 |
| 622 | Ga0268265_11125818 | 3300028380 | Unclassified | 780 |
| 623 | Ga0265319_1157582 | 3300028563 | Bacteria | 702 |
| 624 | Ga0265338_10040350 | 3300028800 | Bacteria | 4386 |
| 625 | Ga0265320_10038208 | 3300031240 | Bacteria | 2411 |
| 626 | Ga0307405_10491583 | 3300031731 | Bacteria | 982 |
| 627 | Ga0307416_100318555 | 3300032002 | Bacteria | 1556 |
| 628 | Ga0307415_100384176 | 3300032126 | Bacteria | 1193 |
| 629 | Ga0373938_0051382 | 3300034957 | Bacteria | 943 |
| 630 | Ga0373928_0012834 | 3300035084 | Bacteria | 1676 |
| 631 | Ga0373928_0037916 | 3300035084 | Bacteria | 1095 |
| 632 | Ga0373929_0002704 | 3300035085 | Bacteria | 3239 |
| 633 | Ga0373934_0080054 | 3300035086 | Bacteria | 1312 |
| 634 | Ga0373951_0003373 | 3300035091 | Bacteria | 3893 |
| 635 | Ga0373932_0018558 | 3300035112 | Bacteria | 1800 |
| 636 | Ga0373936_0053726 | 3300035113 | Bacteria | 1634 |
| 637 | Ga0373945_0081818 | 3300035116 | Bacteria | 1238 |
| 638 | Ga0373956_0028383 | 3300035119 | Bacteria | 2435 |
| 639 | Ga0373960_0017029 | 3300035121 | Bacteria | 1877 |
| 640 | Ga0373943_0004585 | 3300035170 | Bacteria | 6243 |
| 641 | Ga0373943_0178015 | 3300035170 | Bacteria | 1167 |
| 642 | Ga0373946_0002729 | 3300035171 | Bacteria | 6241 |
| 643 | Ga0373946_0118303 | 3300035171 | Bacteria | 1207 |
| 644 | Ga0373942_0012882 | 3300035207 | Bacteria | 2004 |
| 645 | Ga0373931_0020831 | 3300035691 | Bacteria | 3283 |
| 646 | Ga0373931_0105519 | 3300035691 | Bacteria | 1591 |
| 647 | Ga0373931_0378200 | 3300035691 | Unclassified | 892 |
| 648 | Ga0373935_0070061 | 3300035692 | Bacteria | 2260 |
| 649 | Ga0373935_0519477 | 3300035692 | Bacteria | 866 |
| 650 | Ga0373947_0002186 | 3300035725 | Bacteria | 11857 |
| 651 | Ga0373947_0002329 | 3300035725 | Bacteria | 11488 |
| 652 | Ga0373937_0000107 | 3300036401 | Bacteria | 79333 |
| 653 | Ga0373925_0008600 | 3300037068 | Bacteria | 7438 |
| 654 | Ga0373925_0022467 | 3300037068 | Bacteria | 4600 |
| 655 | Ga0395899_0027247 | 3300037312 | Bacteria | 4309 |
| 656 | Ga0395899_0056713 | 3300037312 | Bacteria | 2894 |
| 657 | Ga0395899_0134020 | 3300037312 | Bacteria | 1767 |
| 658 | Ga0395899_0332480 | 3300037312 | Bacteria | 1021 |
| 659 | Ga0395900_0005659 | 3300037418 | Bacteria | 13066 |
| 660 | Ga0395900_0039282 | 3300037418 | Bacteria | 4875 |
| 661 | Ga0395900_0360969 | 3300037418 | Bacteria | 1424 |
| 662 | Ga0395900_0401138 | 3300037418 | Bacteria | 1335 |
| 663 | Ga0395900_0465795 | 3300037418 | Bacteria | 1218 |
| 664 | Ga0395898_0118417 | 3300037466 | Bacteria | 2537 |
| 665 | Ga0395898_0118828 | 3300037466 | Bacteria | 2532 |
| 666 | Ga0395898_0443953 | 3300037466 | Bacteria | 1236 |
| 667 | Ga0395898_0456511 | 3300037466 | Bacteria | 1216 |
| 668 | Ga0395898_0730065 | 3300037466 | Bacteria | 932 |
| 669 | Ga0395898_0997116 | 3300037466 | Unclassified | 773 |
| 670 | Ga0395905_0063928 | 3300037471 | Bacteria | 3443 |
| 671 | Ga0395905_0070232 | 3300037471 | Bacteria | 3281 |
| 672 | Ga0395905_0164971 | 3300037471 | Bacteria | 2081 |
| 673 | Ga0395905_0370196 | 3300037471 | Bacteria | 1326 |
| 674 | Ga0395905_0413104 | 3300037471 | Bacteria | 1245 |
| 675 | Ga0395905_0535275 | 3300037471 | Bacteria | 1072 |
| 676 | Ga0395901_0000904 | 3300038443 | Bacteria | 32610 |
| 677 | Ga0395901_0037785 | 3300038443 | Bacteria | 4993 |
| 678 | Ga0395901_0112527 | 3300038443 | Bacteria | 2859 |
| 679 | Ga0395901_0136416 | 3300038443 | Bacteria | 2578 |
| 680 | Ga0395901_0316153 | 3300038443 | Bacteria | 1616 |
| 681 | Ga0395901_0743655 | 3300038443 | Bacteria | 974 |
| 682 | Ga0395901_1601125 | 3300038443 | Bacteria | 605 |
| 683 | Ga0439436_0032405 | 3300041404 | Bacteria | 1515 |
| 684 | Ga0439439_0012614 | 3300041406 | Bacteria | 2045 |
| 685 | Ga0451793_0221238 | 3300041452 | Bacteria | 1141 |
| 686 | Ga0451853_0598836 | 3300041512 | Bacteria | 2172 |
| 687 | Ga0451853_2862716 | 3300041512 | Bacteria | 801 |
| 688 | Ga0439433_0001393 | 3300041999 | Bacteria | 4966 |
| 689 | Ga0439437_017806 | 3300042000 | Bacteria | 846 |
| 690 | Ga0439442_033676 | 3300042002 | Bacteria | 1071 |
| 691 | Ga0439448_0084263 | 3300042005 | Bacteria | 1070 |
| 692 | Ga0439449_0028363 | 3300042007 | Bacteria | 2087 |
| 693 | Ga0439450_021016 | 3300042008 | Bacteria | 1398 |
| 694 | Ga0439451_001707 | 3300042009 | Bacteria | 4377 |
| 695 | Ga0439454_067487 | 3300042011 | Bacteria | 630 |
| 696 | Ga0439462_0006260 | 3300042015 | Bacteria | 2954 |
| 697 | Ga0439446_0001540 | 3300042156 | Bacteria | 5289 |
| 698 | Ga0439446_0004290 | 3300042156 | Bacteria | 3605 |
| 699 | Ga0439434_0010858 | 3300042435 | Bacteria | 2689 |
| 700 | Ga0439434_0042199 | 3300042435 | Bacteria | 1402 |
| 701 | Ga0466969_0004681 | 3300044656 | Bacteria | 7289 |
| 702 | Ga0466969_0328705 | 3300044656 | Bacteria | 692 |
| 703 | Ga0466965_0030583 | 3300044683 | Bacteria | 2624 |
| 704 | Ga0466966_0011395 | 3300044684 | Bacteria | 5897 |
| 705 | Ga0466966_0090554 | 3300044684 | Bacteria | 1899 |
| 706 | Ga0466961_0005030 | 3300044693 | Bacteria | 8315 |
| 707 | Ga0466961_0014159 | 3300044693 | Bacteria | 5117 |
| 708 | Ga0466963_0004897 | 3300044694 | Bacteria | 7808 |
| 709 | Ga0466963_0041040 | 3300044694 | Bacteria | 3033 |
| 710 | Ga0466963_0049382 | 3300044694 | Bacteria | 2782 |
| 711 | Ga0466963_0126306 | 3300044694 | Bacteria | 1763 |
| 712 | Ga0466963_0221403 | 3300044694 | Bacteria | 1325 |
| 713 | Ga0466963_0339622 | 3300044694 | Bacteria | 1057 |
| 714 | Ga0466963_0640005 | 3300044694 | Archaea | 751 |
| 715 | Ga0466964_0001421 | 3300044706 | Bacteria | 8171 |
| 716 | Ga0466971_0000768 | 3300044719 | Bacteria | 12889 |
| 717 | Ga0466971_0006213 | 3300044719 | Bacteria | 5192 |
| 718 | Ga0466970_0144565 | 3300044765 | Bacteria | 1311 |
| 719 | Ga0466957_0005752 | 3300044842 | Bacteria | 6964 |
| 720 | Ga0466957_0044589 | 3300044842 | Bacteria | 2687 |
| 721 | Ga0466957_0451197 | 3300044842 | Bacteria | 886 |
| 722 | Ga0466957_0602604 | 3300044842 | Archaea | 769 |
| 723 | Ga0466959_0004630 | 3300045049 | Bacteria | 9248 |
| 724 | Ga0466959_0257965 | 3300045049 | Bacteria | 1200 |
| 725 | Ga0466958_0006279 | 3300045836 | Bacteria | 6456 |
| 726 | Ga0466958_0019366 | 3300045836 | Bacteria | 3961 |
| 727 | Ga0466958_0161079 | 3300045836 | Bacteria | 1417 |
| 728 | Ga0466967_0005862 | 3300045976 | Bacteria | 8597 |
| 729 | Ga0466967_0012698 | 3300045976 | Bacteria | 6463 |
| 730 | Ga0466967_0017608 | 3300045976 | Bacteria | 5680 |
| 731 | Ga0466967_0027407 | 3300045976 | Bacteria | 4739 |
| 732 | Ga0466967_0054062 | 3300045976 | Bacteria | 3532 |
| 733 | Ga0466967_0109005 | 3300045976 | Bacteria | 2541 |
| 734 | Ga0495592_0000089 | 3300046454 | Bacteria | 80990 |
| 735 | Ga0495603_0002404 | 3300046455 | Bacteria | 11005 |
| 736 | Ga0495603_0016845 | 3300046455 | Bacteria | 4422 |
| 737 | Ga0495603_0038673 | 3300046455 | Bacteria | 2861 |
| 738 | Ga0495603_0564792 | 3300046455 | Bacteria | 651 |
| 739 | Ga0495603_0657930 | 3300046455 | Bacteria | 599 |
| 740 | Ga0495629_0119635 | 3300046459 | Bacteria | 1835 |
| 741 | Ga0495629_0332740 | 3300046459 | Bacteria | 1037 |
| 742 | Ga0495641_0002430 | 3300046461 | Bacteria | 14716 |
| 743 | Ga0495641_0138364 | 3300046461 | Bacteria | 1087 |
| 744 | Ga0495651_0000057 | 3300046462 | Bacteria | 82943 |
| 745 | Ga0495651_0314617 | 3300046462 | Bacteria | 1046 |
| 746 | Ga0495653_0028354 | 3300046463 | Bacteria | 4476 |
| 747 | Ga0495653_0072567 | 3300046463 | Bacteria | 2570 |
| 748 | Ga0495582_0024097 | 3300046473 | Bacteria | 3328 |
| 749 | Ga0495582_0079585 | 3300046473 | Bacteria | 1819 |
| 750 | Ga0495582_0215921 | 3300046473 | Bacteria | 1097 |
| 751 | Ga0495582_0222962 | 3300046473 | Bacteria | 1079 |
| 752 | Ga0495605_0217372 | 3300046474 | Unclassified | 827 |
| 753 | Ga0495639_0004511 | 3300046475 | Bacteria | 5973 |
| 754 | Ga0495662_0255175 | 3300046476 | Unclassified | 863 |
| 755 | Ga0495584_0315172 | 3300046491 | Bacteria | 794 |
| 756 | Ga0495584_0432491 | 3300046491 | Bacteria | 669 |
| 757 | Ga0495594_0001407 | 3300046499 | Bacteria | 12492 |
| 758 | Ga0495594_0054381 | 3300046499 | Bacteria | 2206 |
| 759 | Ga0495594_0060162 | 3300046499 | Bacteria | 2101 |
| 760 | Ga0495596_0110667 | 3300046500 | Bacteria | 1067 |
| 761 | Ga0495608_0002880 | 3300046511 | Bacteria | 12324 |
| 762 | Ga0495608_0327686 | 3300046511 | Bacteria | 945 |
| 763 | Ga0495616_0104136 | 3300046513 | Bacteria | 1327 |
| 764 | Ga0495618_0137110 | 3300046514 | Bacteria | 1565 |
| 765 | Ga0495618_0367806 | 3300046514 | Bacteria | 884 |
| 766 | Ga0495628_0000066 | 3300046516 | Bacteria | 85699 |
| 767 | Ga0495630_0341511 | 3300046517 | Bacteria | 1146 |
| 768 | Ga0495630_0453667 | 3300046517 | Bacteria | 983 |
| 769 | Ga0495644_0078581 | 3300046523 | Bacteria | 1243 |
| 770 | Ga0495663_0250864 | 3300046525 | Archaea | 628 |
| 771 | Ga0495642_0116086 | 3300046528 | Bacteria | 1147 |
| 772 | Ga0495652_0000118 | 3300046529 | Bacteria | 85706 |
| 773 | Ga0495652_0907627 | 3300046529 | Unclassified | 581 |
| 774 | Ga0495665_0026926 | 3300046531 | Bacteria | 3087 |
| 775 | Ga0495587_0000096 | 3300046536 | Bacteria | 68520 |
| 776 | Ga0495598_0054577 | 3300046537 | Bacteria | 1214 |
| 777 | Ga0495609_0228987 | 3300046538 | Bacteria | 770 |
| 778 | Ga0495645_0000052 | 3300046543 | Bacteria | 86470 |
| 779 | Ga0495633_0388066 | 3300046558 | Archaea | 632 |
| 780 | Ga0495667_0394618 | 3300046559 | Bacteria | 872 |
| 781 | Ga0495656_0137837 | 3300046615 | Bacteria | 1167 |
| 782 | Ga0495656_0197163 | 3300046615 | Bacteria | 997 |
| 783 | Ga0495656_0211048 | 3300046615 | Bacteria | 967 |
| 784 | Ga0495668_0266921 | 3300046616 | Unclassified | 937 |
| 785 | Ga0495668_0494276 | 3300046616 | Bacteria | 674 |
| 786 | Ga0495634_0106206 | 3300046642 | Bacteria | 1810 |
| 787 | Ga0495634_0119858 | 3300046642 | Bacteria | 1685 |
| 788 | Ga0495659_0042279 | 3300046664 | Bacteria | 1631 |
| 789 | Ga0495588_0000537 | 3300046674 | Bacteria | 18303 |
| 790 | Ga0495588_0078247 | 3300046674 | Bacteria | 1725 |
| 791 | Ga0495657_0084489 | 3300046675 | Bacteria | 2047 |
| 792 | Ga0495599_0000046 | 3300046678 | Bacteria | 85727 |
| 793 | Ga0495623_0000061 | 3300046679 | Bacteria | 67279 |
| 794 | Ga0495647_0022214 | 3300046681 | Unclassified | 2291 |
| 795 | Ga0495647_0028454 | 3300046681 | Bacteria | 2061 |
| 796 | Ga0495647_0043763 | 3300046681 | Bacteria | 1715 |
| 797 | Ga0495647_0118600 | 3300046681 | Bacteria | 1111 |
| 798 | Ga0495658_0008228 | 3300046683 | Bacteria | 5167 |
| 799 | Ga0495658_0062724 | 3300046683 | Bacteria | 2137 |
| 800 | Ga0495658_0103844 | 3300046683 | Bacteria | 1700 |
| 801 | Ga0495658_0466230 | 3300046683 | Unclassified | 807 |
| 802 | Ga0495613_0062181 | 3300046689 | Bacteria | 2733 |
| 803 | Ga0495613_0127887 | 3300046689 | Bacteria | 1821 |
| 804 | Ga0495624_0056812 | 3300046690 | Bacteria | 2462 |
| 805 | Ga0495624_0524635 | 3300046690 | Bacteria | 708 |
| 806 | Ga0495670_0260281 | 3300046691 | Bacteria | 926 |
| 807 | Ga0495589_0060698 | 3300046794 | Bacteria | 1857 |
| 808 | Ga0495581_0022119 | 3300047315 | Bacteria | 3684 |
| 809 | Ga0495581_0028818 | 3300047315 | Bacteria | 3219 |
| 810 | Ga0495604_0000075 | 3300047317 | Bacteria | 85370 |
| 811 | Ga0495676_0003263 | 3300047321 | Bacteria | 14659 |
| 812 | Ga0495676_0039225 | 3300047321 | Bacteria | 3925 |
| 813 | Ga0495676_0364282 | 3300047321 | Bacteria | 964 |
| 814 | Ga0495680_0013423 | 3300047322 | Bacteria | 7148 |
| 815 | Ga0495675_0000089 | 3300047444 | Bacteria | 64853 |
| 816 | Ga0495677_0068840 | 3300047445 | Bacteria | 1318 |
| 817 | Ga0495679_083981 | 3300047446 | Bacteria | 901 |
| 818 | Ga0495602_0000140 | 3300048088 | Bacteria | 68037 |
| 819 | Ga0495614_0046979 | 3300048089 | Bacteria | 1851 |
| 820 | Ga0496100_0026516 | 3300048903 | Bacteria | 3554 |
| 821 | Ga0496100_0054076 | 3300048903 | Bacteria | 2617 |
| 822 | Ga0496100_0086727 | 3300048903 | Bacteria | 2127 |
| 823 | Ga0496100_0120442 | 3300048903 | Bacteria | 1835 |
| 824 | Ga0496100_0130199 | 3300048903 | Bacteria | 1771 |
| 825 | Ga0496100_0215854 | 3300048903 | Bacteria | 1406 |
| 826 | Ga0496100_0286468 | 3300048903 | Bacteria | 1229 |
| 827 | Ga0496100_0486834 | 3300048903 | Bacteria | 949 |
| 828 | Ga0496100_1036887 | 3300048903 | Bacteria | 646 |
| 829 | Ga0496100_1159414 | 3300048903 | Bacteria | 609 |
| 830 | Ga0496101_0036240 | 3300048904 | Bacteria | 3493 |
| 831 | Ga0496101_0080064 | 3300048904 | Bacteria | 2412 |
| 832 | Ga0496101_0095325 | 3300048904 | Bacteria | 2219 |
| 833 | Ga0496101_0194165 | 3300048904 | Bacteria | 1567 |
| 834 | Ga0496101_0197157 | 3300048904 | Bacteria | 1556 |
| 835 | Ga0496101_0262766 | 3300048904 | Bacteria | 1346 |
| 836 | Ga0496101_0264364 | 3300048904 | Bacteria | 1342 |
| 837 | Ga0496101_0279652 | 3300048904 | Bacteria | 1304 |
| 838 | Ga0496101_0444790 | 3300048904 | Unclassified | 1022 |
| 839 | Ga0496101_0606522 | 3300048904 | Bacteria | 865 |
| 840 | Ga0496102_0001619 | 3300048905 | Bacteria | 19836 |
| 841 | Ga0496102_0013494 | 3300048905 | Bacteria | 7077 |
| 842 | Ga0496102_0043574 | 3300048905 | Bacteria | 4070 |
| 843 | Ga0496102_0145421 | 3300048905 | Bacteria | 2225 |
| 844 | Ga0496102_0165137 | 3300048905 | Bacteria | 2083 |
| 845 | Ga0496102_0295843 | 3300048905 | Bacteria | 1526 |
| 846 | Ga0496102_0330262 | 3300048905 | Bacteria | 1436 |
| 847 | Ga0496102_0341745 | 3300048905 | Bacteria | 1409 |
| 848 | Ga0496102_1166362 | 3300048905 | Bacteria | 690 |
| 849 | Ga0496103_0001460 | 3300048906 | Bacteria | 15825 |
| 850 | Ga0496103_0065986 | 3300048906 | Bacteria | 2259 |
| 851 | Ga0496103_0080681 | 3300048906 | Bacteria | 2046 |
| 852 | Ga0496103_0120652 | 3300048906 | Bacteria | 1670 |
| 853 | Ga0496103_0328935 | 3300048906 | Bacteria | 983 |
| 854 | Ga0496103_0439962 | 3300048906 | Bacteria | 836 |
| 855 | Ga0496103_0508007 | 3300048906 | Unclassified | 771 |
| 856 | Ga0496103_0577906 | 3300048906 | Bacteria | 716 |
| 857 | Ga0496104_0009894 | 3300048907 | Bacteria | 8513 |
| 858 | Ga0496104_0052779 | 3300048907 | Bacteria | 3840 |
| 859 | Ga0496104_0062319 | 3300048907 | Bacteria | 3536 |
| 860 | Ga0496104_0114998 | 3300048907 | Bacteria | 2581 |
| 861 | Ga0496104_0201091 | 3300048907 | Bacteria | 1904 |
| 862 | Ga0496104_0225117 | 3300048907 | Bacteria | 1788 |
| 863 | Ga0496104_0316886 | 3300048907 | Bacteria | 1473 |
| 864 | Ga0496104_0783256 | 3300048907 | Bacteria | 860 |
| 865 | Ga0496105_0008640 | 3300048908 | Bacteria | 7920 |
| 866 | Ga0496105_0034180 | 3300048908 | Bacteria | 4180 |
| 867 | Ga0496105_0073616 | 3300048908 | Bacteria | 2822 |
| 868 | Ga0496105_0113873 | 3300048908 | Bacteria | 2231 |
| 869 | Ga0496105_0138118 | 3300048908 | Bacteria | 2007 |
| 870 | Ga0496105_0210771 | 3300048908 | Bacteria | 1584 |
| 871 | Ga0496105_0464371 | 3300048908 | Bacteria | 998 |
| 872 | Ga0496106_0029799 | 3300048909 | Bacteria | 4068 |
| 873 | Ga0496106_0109176 | 3300048909 | Bacteria | 2153 |
| 874 | Ga0496106_0205076 | 3300048909 | Bacteria | 1570 |
| 875 | Ga0496107_0011180 | 3300048910 | Bacteria | 6249 |
| 876 | Ga0496107_0013676 | 3300048910 | Bacteria | 5675 |
| 877 | Ga0496107_0150306 | 3300048910 | Bacteria | 1722 |
| 878 | Ga0496107_0152424 | 3300048910 | Bacteria | 1710 |
| 879 | Ga0496107_0187471 | 3300048910 | Bacteria | 1536 |
| 880 | Ga0496107_0274623 | 3300048910 | Bacteria | 1254 |
| 881 | Ga0496108_0002875 | 3300048911 | Bacteria | 13812 |
| 882 | Ga0496108_0030921 | 3300048911 | Bacteria | 4438 |
| 883 | Ga0496108_0040203 | 3300048911 | Bacteria | 3897 |
| 884 | Ga0496108_0075844 | 3300048911 | Bacteria | 2841 |
| 885 | Ga0496108_0235070 | 3300048911 | Bacteria | 1594 |
| 886 | Ga0496108_0368577 | 3300048911 | Bacteria | 1254 |
| 887 | Ga0496108_0678203 | 3300048911 | Bacteria | 895 |
| 888 | Ga0496109_0000954 | 3300048912 | Bacteria | 23913 |
| 889 | Ga0496109_0008233 | 3300048912 | Bacteria | 8851 |
| 890 | Ga0496109_0017433 | 3300048912 | Bacteria | 6296 |
| 891 | Ga0496109_0151250 | 3300048912 | Bacteria | 2173 |
| 892 | Ga0496109_0159293 | 3300048912 | Bacteria | 2115 |
| 893 | Ga0496109_0236077 | 3300048912 | Bacteria | 1720 |
| 894 | Ga0496109_0268766 | 3300048912 | Bacteria | 1606 |
| 895 | Ga0496109_0438853 | 3300048912 | Bacteria | 1233 |
| 896 | Ga0496110_0001816 | 3300048913 | Bacteria | 15730 |
| 897 | Ga0496110_0013023 | 3300048913 | Bacteria | 6861 |
| 898 | Ga0496110_0020582 | 3300048913 | Bacteria | 5572 |
| 899 | Ga0496110_0249246 | 3300048913 | Bacteria | 1616 |
| 900 | Ga0496110_0409429 | 3300048913 | Bacteria | 1236 |
| 901 | Ga0496110_0657013 | 3300048913 | Bacteria | 948 |
| 902 | Ga0496110_0919741 | 3300048913 | Bacteria | 781 |
| 903 | Ga0496110_1084653 | 3300048913 | Bacteria | 709 |
| 904 | Ga0496111_0003517 | 3300048914 | Bacteria | 9693 |
| 905 | Ga0496111_0038137 | 3300048914 | Bacteria | 3442 |
| 906 | Ga0496111_0057286 | 3300048914 | Bacteria | 2821 |
| 907 | Ga0496111_0313834 | 3300048914 | Bacteria | 1161 |
| 908 | Ga0496111_0340451 | 3300048914 | Bacteria | 1110 |
| 909 | Ga0496112_0000293 | 3300048915 | Bacteria | 32490 |
| 910 | Ga0496112_0028386 | 3300048915 | Bacteria | 5400 |
| 911 | Ga0496112_0051790 | 3300048915 | Bacteria | 4027 |
| 912 | Ga0496112_0077211 | 3300048915 | Bacteria | 3294 |
| 913 | Ga0496112_0476246 | 3300048915 | Bacteria | 1185 |
| 914 | Ga0496113_0008471 | 3300048916 | Bacteria | 6701 |
| 915 | Ga0496113_0020678 | 3300048916 | Bacteria | 4633 |
| 916 | Ga0496113_0091498 | 3300048916 | Bacteria | 2345 |
| 917 | Ga0496113_0100291 | 3300048916 | Bacteria | 2243 |
| 918 | Ga0496113_0104717 | 3300048916 | Bacteria | 2196 |
| 919 | Ga0496113_0368894 | 3300048916 | Bacteria | 1152 |
| 920 | Ga0496113_0526946 | 3300048916 | Bacteria | 948 |
| 921 | Ga0496114_0042927 | 3300048917 | Bacteria | 3749 |
| 922 | Ga0496114_0071351 | 3300048917 | Bacteria | 2919 |
| 923 | Ga0496114_0079020 | 3300048917 | Bacteria | 2776 |
| 924 | Ga0496114_0094330 | 3300048917 | Bacteria | 2545 |
| 925 | Ga0496114_0177951 | 3300048917 | Bacteria | 1856 |
| 926 | Ga0496114_0311809 | 3300048917 | Bacteria | 1390 |
| 927 | Ga0496114_0328665 | 3300048917 | Bacteria | 1351 |
| 928 | Ga0496114_0426136 | 3300048917 | Bacteria | 1175 |
| 929 | Ga0496114_0495719 | 3300048917 | Bacteria | 1080 |
| 930 | Ga0496114_0705014 | 3300048917 | Bacteria | 885 |
| 931 | Ga0496115_0005787 | 3300048918 | Bacteria | 9000 |
| 932 | Ga0496115_0011507 | 3300048918 | Bacteria | 6634 |
| 933 | Ga0496115_0018951 | 3300048918 | Bacteria | 5293 |
| 934 | Ga0496115_0041527 | 3300048918 | Bacteria | 3661 |
| 935 | Ga0496115_0417631 | 3300048918 | Bacteria | 1087 |
| 936 | Ga0501031_0031652 | 3300049568 | Bacteria | 3451 |
| 937 | Ga0501031_0086672 | 3300049568 | Bacteria | 2042 |
| 938 | Ga0501032_0206415 | 3300049569 | Bacteria | 1282 |
| 939 | Ga0501033_0128216 | 3300049570 | Bacteria | 1839 |
| 940 | Ga0501034_0012275 | 3300049571 | Bacteria | 8854 |
| 941 | Ga0501034_0500596 | 3300049571 | Bacteria | 1129 |
| 942 | Ga0501036_0480183 | 3300049572 | Bacteria | 1035 |
| 943 | Ga0501037_0250529 | 3300049573 | Bacteria | 1239 |
| 944 | Ga0501037_0521122 | 3300049573 | Bacteria | 805 |
| 945 | Ga0501038_0059683 | 3300049574 | Bacteria | 3266 |
| 946 | Ga0501038_0132762 | 3300049574 | Bacteria | 2042 |
| 947 | Ga0501038_0300939 | 3300049574 | Bacteria | 1259 |
| 948 | Ga0501038_0389313 | 3300049574 | Bacteria | 1080 |
| 949 | Ga0501039_0093273 | 3300049575 | Unclassified | 2346 |
| 950 | Ga0501039_0256231 | 3300049575 | Bacteria | 1375 |
| 951 | Ga0501039_0788160 | 3300049575 | Bacteria | 742 |
| 952 | Ga0501040_0023239 | 3300049576 | Bacteria | 4156 |
| 953 | Ga0501040_0025213 | 3300049576 | Bacteria | 3998 |
| 954 | Ga0501040_0046978 | 3300049576 | Bacteria | 2947 |
| 955 | Ga0501040_0550869 | 3300049576 | Bacteria | 832 |
| 956 | Ga0501041_0039904 | 3300049577 | Bacteria | 2848 |
| 957 | Ga0501041_0093474 | 3300049577 | Bacteria | 1857 |
| 958 | Ga0501041_0238002 | 3300049577 | Bacteria | 1144 |
| 959 | Ga0501041_0415644 | 3300049577 | Bacteria | 853 |
| 960 | Ga0501042_0037252 | 3300049578 | Bacteria | 3452 |
| 961 | Ga0501042_0097356 | 3300049578 | Bacteria | 2114 |
| 962 | Ga0501042_0133879 | 3300049578 | Bacteria | 1787 |
| 963 | Ga0501042_0452867 | 3300049578 | Bacteria | 931 |
| 964 | Ga0501043_0065071 | 3300049579 | Bacteria | 2863 |
| 965 | Ga0501043_0443932 | 3300049579 | Bacteria | 976 |
| 966 | Ga0501046_0069719 | 3300049580 | Bacteria | 2735 |
| 967 | Ga0501046_0104361 | 3300049580 | Bacteria | 2172 |
| 968 | Ga0501046_0106806 | 3300049580 | Bacteria | 2142 |
| 969 | Ga0501048_0028573 | 3300049582 | Bacteria | 4048 |
| 970 | Ga0501048_0029137 | 3300049582 | Bacteria | 4005 |
| 971 | Ga0501048_0890904 | 3300049582 | Bacteria | 640 |
| 972 | Ga0501068_0108540 | 3300049584 | Bacteria | 1724 |
| 973 | Ga0501068_0727162 | 3300049584 | Bacteria | 649 |
| 974 | Ga0501069_0315979 | 3300049585 | Unclassified | 917 |
| 975 | Ga0501069_0662638 | 3300049585 | Bacteria | 628 |
| 976 | Ga0501070_0035068 | 3300049586 | Bacteria | 4193 |
| 977 | Ga0501071_0063220 | 3300049587 | Bacteria | 2683 |
| 978 | Ga0501071_0064700 | 3300049587 | Bacteria | 2653 |
| 979 | Ga0501071_0086068 | 3300049587 | Bacteria | 2305 |
| 980 | Ga0501071_0140932 | 3300049587 | Bacteria | 1795 |
| 981 | Ga0501071_0370092 | 3300049587 | Bacteria | 1092 |
| 982 | Ga0501072_0001406 | 3300049588 | Bacteria | 18115 |
| 983 | Ga0501072_0027847 | 3300049588 | Bacteria | 4409 |
| 984 | Ga0501072_0139224 | 3300049588 | Bacteria | 1935 |
| 985 | Ga0501072_0161624 | 3300049588 | Bacteria | 1787 |
| 986 | Ga0501072_0503857 | 3300049588 | Bacteria | 958 |
| 987 | Ga0501072_0605598 | 3300049588 | Bacteria | 863 |
| 988 | Ga0501073_0094635 | 3300049589 | Bacteria | 2075 |
| 989 | Ga0501074_0042398 | 3300049590 | Bacteria | 3293 |
| 990 | Ga0501074_0050253 | 3300049590 | Bacteria | 3010 |
| 991 | Ga0501074_0079091 | 3300049590 | Bacteria | 2359 |
| 992 | Ga0501074_0265539 | 3300049590 | Bacteria | 1220 |
| 993 | Ga0501074_0747837 | 3300049590 | Bacteria | 689 |
| 994 | Ga0501075_0016117 | 3300049591 | Bacteria | 5378 |
| 995 | Ga0501075_0050018 | 3300049591 | Bacteria | 3141 |
| 996 | Ga0501075_0063124 | 3300049591 | Bacteria | 2793 |
| 997 | Ga0501075_0075716 | 3300049591 | Bacteria | 2545 |
| 998 | Ga0501075_0522474 | 3300049591 | Bacteria | 906 |
| 999 | Ga0501076_0008719 | 3300049592 | Bacteria | 7447 |
| 1000 | Ga0501076_0015983 | 3300049592 | Bacteria | 5681 |
| 1001 | Ga0501076_0068957 | 3300049592 | Bacteria | 2825 |
| 1002 | Ga0501076_0076520 | 3300049592 | Bacteria | 2684 |
| 1003 | Ga0501076_0250841 | 3300049592 | Bacteria | 1448 |
| 1004 | Ga0501076_0282987 | 3300049592 | Bacteria | 1358 |
| 1005 | Ga0501077_0003452 | 3300049593 | Bacteria | 9487 |
| 1006 | Ga0501077_0024418 | 3300049593 | Bacteria | 3839 |
| 1007 | Ga0501077_0046480 | 3300049593 | Bacteria | 2757 |
| 1008 | Ga0501077_0515432 | 3300049593 | Bacteria | 767 |
| 1009 | Ga0501216_097487 | 3300049660 | Bacteria | 644 |
| 1010 | Ga0501079_0049513 | 3300049741 | Bacteria | 3243 |
| 1011 | Ga0501079_0050704 | 3300049741 | Bacteria | 3203 |
| 1012 | Ga0501079_0143395 | 3300049741 | Bacteria | 1861 |
| 1013 | Ga0501079_0482033 | 3300049741 | Bacteria | 975 |
| 1014 | Ga0501079_0583577 | 3300049741 | Bacteria | 879 |
| 1015 | Ga0501079_0757753 | 3300049741 | Bacteria | 764 |
| 1016 | Ga0501080_0003102 | 3300049742 | Bacteria | 14670 |
| 1017 | Ga0501080_0014392 | 3300049742 | Bacteria | 7286 |
| 1018 | Ga0501080_0019569 | 3300049742 | Bacteria | 6272 |
| 1019 | Ga0501080_0601551 | 3300049742 | Bacteria | 976 |
| 1020 | Ga0501080_1030443 | 3300049742 | Bacteria | 713 |
| 1021 | Ga0501081_0058946 | 3300049743 | Bacteria | 2657 |
| 1022 | Ga0501081_0076627 | 3300049743 | Bacteria | 2335 |
| 1023 | Ga0501081_0115374 | 3300049743 | Bacteria | 1909 |
| 1024 | Ga0501081_0260651 | 3300049743 | Bacteria | 1267 |
| 1025 | Ga0501081_0755045 | 3300049743 | Bacteria | 731 |
| 1026 | Ga0501083_0072558 | 3300049744 | Bacteria | 2288 |
| 1027 | Ga0501083_0075522 | 3300049744 | Bacteria | 2238 |
| 1028 | Ga0501035_0020176 | 3300049822 | Bacteria | 6121 |
| 1029 | Ga0501035_0110887 | 3300049822 | Bacteria | 2405 |
| 1030 | Ga0501044_0400982 | 3300049823 | Unclassified | 1284 |
| 1031 | Ga0501045_0085690 | 3300049824 | Bacteria | 2325 |
| 1032 | Ga0501045_0097721 | 3300049824 | Bacteria | 2172 |
| 1033 | nmdc:mga0yw44_502155_c1 | 3300050492 | Bacteria | 823 |
| 1034 | nmdc:mga05p37_160234_c1 | 3300050507 | Bacteria | 2749 |
| 1035 | nmdc:mga05p37_247498_c1 | 3300050507 | Bacteria | 2140 |
| 1036 | nmdc:mga05p37_713479_c1 | 3300050507 | Bacteria | 1112 |
| 1037 | nmdc:mga09592_57341_c1 | 3300050508 | Bacteria | 3292 |
| 1038 | nmdc:mga09592_80779_c1 | 3300050508 | Bacteria | 2769 |
| 1039 | nmdc:mga0qj67_204564_c1 | 3300050509 | Bacteria | 1604 |
| 1040 | nmdc:mga06r32_540672_c1 | 3300050510 | Bacteria | 1140 |
| 1041 | nmdc:mga08y16_100400_c1 | 3300050511 | Bacteria | 3013 |
| 1042 | nmdc:mga08y16_65697_c1 | 3300050511 | Bacteria | 3787 |
| 1043 | nmdc:mga08y16_68549_c1 | 3300050511 | Bacteria | 3699 |
| 1044 | nmdc:mga08y16_86703_c1 | 3300050511 | Bacteria | 3263 |
| 1045 | nmdc:mga0n895_1183861_c1 | 3300050512 | Unclassified | 739 |
| 1046 | nmdc:mga0n895_15149_c1 | 3300050512 | Bacteria | 7026 |
| 1047 | nmdc:mga0n895_639846_c1 | 3300050512 | Bacteria | 1063 |
| 1048 | nmdc:mga0n895_96856_c1 | 3300050512 | Bacteria | 2956 |
| 1049 | nmdc:mga0rr50_55781_c1 | 3300050513 | Bacteria | 2949 |
| 1050 | nmdc:mga0rr50_592323_c1 | 3300050513 | Bacteria | 945 |
| 1051 | nmdc:mga08x19_12257_c1 | 3300050514 | Bacteria | 5161 |
| 1052 | nmdc:mga08x19_99535_c1 | 3300050514 | Bacteria | 1928 |
| 1053 | nmdc:mga0a205_113983_c1 | 3300050515 | Bacteria | 2602 |
| 1054 | nmdc:mga0a205_246783_c1 | 3300050515 | Bacteria | 1666 |
| 1055 | Ga0495601_0000273 | 3300053077 | Bacteria | 28075 |
| 1056 | Ga0495601_0351130 | 3300053077 | Bacteria | 959 |
| 1057 | Ga0495612_0091343 | 3300053078 | Bacteria | 1289 |
| 1058 | Ga0495655_0133444 | 3300053083 | Bacteria | 767 |
| 1059 | Ga0495595_0016131 | 3300053084 | Bacteria | 3191 |
| 1060 | Ga0495595_0119272 | 3300053084 | Bacteria | 1284 |
| 1061 | Ga0495619_0000123 | 3300053085 | Bacteria | 57052 |
| 1062 | Ga0495619_0064465 | 3300053085 | Bacteria | 2443 |
| 1063 | Ga0495619_0334442 | 3300053085 | Bacteria | 1048 |
| 1064 | Ga0501084_0002565 | 3300054114 | Bacteria | 14640 |
| 1065 | Ga0501084_0029462 | 3300054114 | Bacteria | 4592 |
| 1066 | Ga0501084_0032747 | 3300054114 | Bacteria | 4349 |
| 1067 | Ga0501084_0049299 | 3300054114 | Bacteria | 3525 |
| 1068 | Ga0501084_0160722 | 3300054114 | Bacteria | 1895 |
| 1069 | Ga0501084_0217161 | 3300054114 | Bacteria | 1613 |
| 1070 | Ga0501084_0661911 | 3300054114 | Bacteria | 881 |
| 1071 | Ga0501084_0786383 | 3300054114 | Bacteria | 802 |
| 1072 | Ga0501084_0872458 | 3300054114 | Bacteria | 757 |
| 1073 | Ga0501082_0019671 | 3300060353 | Bacteria | 5821 |
| 1074 | Ga0501082_0077187 | 3300060353 | Bacteria | 2872 |
| 1075 | Ga0501082_0377151 | 3300060353 | Bacteria | 1237 |
| 1076 | Ga0501082_0512355 | 3300060353 | Bacteria | 1049 |
| 1077 | Ga0501082_0529948 | 3300060353 | Bacteria | 1030 |
| 1078 | Ga0501082_0765836 | 3300060353 | Bacteria | 845 |
| 1079 | Ga0466962_0002035 | 3300061719 | Bacteria | 9553 |
| 1080 | Ga0530510_0034871 | 3300061734 | Bacteria | 3625 |
| 1081 | Ga0530510_0097496 | 3300061734 | Bacteria | 2149 |
| 1082 | Ga0530510_0437648 | 3300061734 | Bacteria | 988 |
| 1083 | Ga0495656_0021620 | |||
| 1084 | JGI24743J22301_10005572 | |||
| 1085 | JGI24743J22301_10005797 | |||
| 1086 | JGI24738J21930_10009489 | |||
| 1087 | JGI24744J21845_10025107 | |||
| 1088 | JGI25406J46586_10058983 | |||
| 1089 | Ga0070658_10060765 | |||
| 1090 | Ga0070676_10110270 | |||
| 1091 | Ga0070676_10151395 | |||
| 1092 | Ga0070683_100011303 | |||
| 1093 | Ga0070683_100040724 | |||
| 1094 | Ga0070683_100046543 | |||
| 1095 | Ga0070683_100172406 | |||
| 1096 | Ga0070683_100336611 | |||
| 1097 | Ga0070683_100339387 | |||
| 1098 | Ga0070683_100416911 | |||
| 1099 | Ga0070683_100557046 | |||
| 1100 | Ga0070683_100574285 | |||
| 1101 | Ga0070683_100946830 | |||
| 1102 | Ga0070683_101239251 | |||
| 1103 | Ga0070690_100042356 | |||
| 1104 | Ga0070690_100301834 | |||
| 1105 | Ga0068869_100054245 | |||
| 1106 | Ga0068869_100570088 | |||
| 1107 | Ga0070666_10064420 | |||
| 1108 | Ga0070666_10206516 | |||
| 1109 | Ga0070680_100005620 | |||
| 1110 | Ga0070680_100278091 | |||
| 1111 | Ga0070680_100736198 | |||
| 1112 | Ga0070680_101046726 | |||
| 1113 | Ga0070682_100002331 | |||
| 1114 | Ga0070682_100097901 | |||
| 1115 | Ga0070682_100144941 | |||
| 1116 | Ga0070682_100241964 | |||
| 1117 | Ga0068868_100015257 | |||
| 1118 | Ga0068868_100045658 | |||
| 1119 | Ga0068868_100588169 | |||
| 1120 | Ga0068868_100843686 | |||
| 1121 | Ga0068868_100963878 | |||
| 1122 | Ga0070660_100003396 | |||
| 1123 | Ga0070660_100004253 | |||
| 1124 | Ga0070660_100056168 | |||
| 1125 | Ga0070660_100182606 | |||
| 1126 | Ga0070660_100221565 | |||
| 1127 | Ga0070660_100389315 | |||
| 1128 | Ga0070689_100011564 | |||
| 1129 | Ga0070689_100181284 | |||
| 1130 | Ga0070691_10059656 | |||
| 1131 | Ga0070687_100178765 | |||
| 1132 | Ga0070687_100251142 | |||
| 1133 | Ga0070687_100434785 | |||
| 1134 | Ga0070687_100859644 | |||
| 1135 | Ga0070661_100057489 | |||
| 1136 | Ga0070661_100094629 | |||
| 1137 | Ga0070661_100335969 | |||
| 1138 | Ga0070661_100364852 | |||
| 1139 | Ga0070661_100586610 | |||
| 1140 | Ga0070692_10003563 | |||
| 1141 | Ga0070692_10037837 | |||
| 1142 | Ga0070692_10069093 | |||
| 1143 | Ga0070668_100013432 | |||
| 1144 | Ga0070668_100674835 | |||
| 1145 | Ga0070668_100949297 | |||
| 1146 | Ga0070668_101203109 | |||
| 1147 | Ga0070675_100008011 | |||
| 1148 | Ga0070675_100036827 | |||
| 1149 | Ga0070675_100151229 | |||
| 1150 | Ga0070675_100321560 | |||
| 1151 | Ga0070675_100709369 | |||
| 1152 | Ga0070675_100919193 | |||
| 1153 | Ga0070671_100021637 | |||
| 1154 | Ga0070671_100048075 | |||
| 1155 | Ga0070671_100318560 | |||
| 1156 | Ga0070671_100453384 | |||
| 1157 | Ga0070674_100050635 | |||
| 1158 | Ga0070674_100062552 | |||
| 1159 | Ga0070674_100142539 | |||
| 1160 | Ga0070674_100567374 | |||
| 1161 | Ga0070674_100745649 | |||
| 1162 | Ga0070673_100036337 | |||
| 1163 | Ga0070673_101264652 | |||
| 1164 | Ga0070688_100001743 | |||
| 1165 | Ga0070688_100155261 | |||
| 1166 | Ga0070688_100794852 | |||
| 1167 | Ga0070659_100014966 | |||
| 1168 | Ga0070659_100023401 | |||
| 1169 | Ga0070659_100050901 | |||
| 1170 | Ga0070659_100133099 | |||
| 1171 | Ga0070667_100044216 | |||
| 1172 | Ga0070667_100340500 | |||
| 1173 | Ga0070667_101017664 | |||
| 1174 | Ga0070703_10005248 | |||
| 1175 | Ga0070709_10009858 | |||
| 1176 | Ga0070709_10312376 | |||
| 1177 | Ga0070714_100393538 | |||
| 1178 | Ga0070714_100520108 | |||
| 1179 | Ga0070713_100055508 | |||
| 1180 | Ga0070710_10005240 | |||
| 1181 | Ga0070710_10117159 | |||
| 1182 | Ga0070701_10005453 | |||
| 1183 | Ga0070701_10006793 | |||
| 1184 | Ga0070711_100135244 | |||
| 1185 | Ga0070711_100200624 | |||
| 1186 | Ga0070711_100288713 | |||
| 1187 | Ga0070705_100009369 | |||
| 1188 | Ga0070705_100017042 | |||
| 1189 | Ga0070705_100026272 | |||
| 1190 | Ga0070705_100304779 | |||
| 1191 | Ga0070700_100036094 | |||
| 1192 | Ga0070700_100225102 | |||
| 1193 | Ga0070700_100236296 | |||
| 1194 | Ga0070700_100427417 | |||
| 1195 | Ga0070700_100552378 | |||
| 1196 | Ga0070700_100571323 | |||
| 1197 | Ga0070700_100586827 | |||
| 1198 | Ga0070700_100595831 | |||
| 1199 | Ga0070700_100985164 | |||
| 1200 | Ga0070694_100013842 | |||
| 1201 | Ga0070694_100090801 | |||
| 1202 | Ga0070694_100751029 | |||
| 1203 | Ga0070663_100437513 | |||
| 1204 | Ga0070663_100517069 | |||
| 1205 | Ga0070678_100012221 | |||
| 1206 | Ga0070678_100237344 | |||
| 1207 | Ga0070678_100313838 | |||
| 1208 | Ga0070678_100317990 | |||
| 1209 | Ga0070678_100338260 | |||
| 1210 | Ga0070678_100347777 | |||
| 1211 | Ga0070678_101013739 | |||
| 1212 | Ga0070662_100016137 | |||
| 1213 | Ga0070662_100017748 | |||
| 1214 | Ga0070662_100048961 | |||
| 1215 | Ga0070662_100901306 | |||
| 1216 | Ga0070681_10009307 | |||
| 1217 | Ga0070681_10022112 | |||
| 1218 | Ga0070681_10062368 | |||
| 1219 | Ga0070681_10177554 | |||
| 1220 | Ga0070681_10264879 | |||
| 1221 | Ga0068867_100011424 | |||
| 1222 | Ga0068867_100047753 | |||
| 1223 | Ga0068867_100236631 | |||
| 1224 | Ga0068867_100985105 | |||
| 1225 | Ga0070685_10000906 | |||
| 1226 | Ga0070685_10007842 | |||
| 1227 | Ga0070685_10126548 | |||
| 1228 | Ga0070706_100031877 | |||
| 1229 | Ga0070707_100000570 | |||
| 1230 | Ga0070707_100096210 | |||
| 1231 | Ga0070699_100030146 | |||
| 1232 | Ga0070699_100388923 | |||
| 1233 | Ga0070679_100010388 | |||
| 1234 | Ga0070679_100020579 | |||
| 1235 | Ga0070679_100023275 | |||
| 1236 | Ga0070679_100243505 | |||
| 1237 | Ga0070679_100288463 | |||
| 1238 | Ga0070679_101066196 | |||
| 1239 | Ga0070679_101176687 | |||
| 1240 | Ga0070684_100000634 | |||
| 1241 | Ga0070684_100011665 | |||
| 1242 | Ga0070684_100024133 | |||
| 1243 | Ga0070684_100029406 | |||
| 1244 | Ga0070684_100198038 | |||
| 1245 | Ga0070684_100342306 | |||
| 1246 | Ga0070684_101267447 | |||
| 1247 | Ga0070697_100150866 | |||
| 1248 | Ga0068853_100031095 | |||
| 1249 | Ga0068853_100070321 | |||
| 1250 | Ga0068853_100104917 | |||
| 1251 | Ga0068853_100545371 | |||
| 1252 | Ga0070672_100012733 | |||
| 1253 | Ga0070672_100047840 | |||
| 1254 | Ga0070672_100061149 | |||
| 1255 | Ga0070686_100006796 | |||
| 1256 | Ga0070686_100241485 | |||
| 1257 | Ga0070695_100029877 | |||
| 1258 | Ga0070695_100031918 | |||
| 1259 | Ga0070696_100028797 | |||
| 1260 | Ga0070696_100218863 | |||
| 1261 | Ga0070696_100738378 | |||
| 1262 | Ga0070693_100103112 | |||
| 1263 | Ga0070693_100113908 | |||
| 1264 | Ga0070693_100135874 | |||
| 1265 | Ga0070693_100466625 | |||
| 1266 | Ga0070665_100143887 | |||
| 1267 | Ga0070665_100239330 | |||
| 1268 | Ga0070665_100545571 | |||
| 1269 | Ga0070704_100015880 | |||
| 1270 | Ga0070704_100036602 | |||
| 1271 | Ga0070704_100399269 | |||
| 1272 | Ga0070704_100412297 | |||
| 1273 | Ga0070704_100659290 | |||
| 1274 | Ga0068855_100107593 | |||
| 1275 | Ga0068855_100651087 | |||
| 1276 | Ga0070664_100049663 | |||
| 1277 | Ga0070664_100072406 | |||
| 1278 | Ga0070664_100226947 | |||
| 1279 | Ga0070664_100399411 | |||
| 1280 | Ga0070664_100412135 | |||
| 1281 | Ga0070664_100604104 | |||
| 1282 | Ga0070664_101410841 | |||
| 1283 | Ga0068857_100050538 | |||
| 1284 | Ga0068857_100622894 | |||
| 1285 | Ga0068854_100038806 | |||
| 1286 | Ga0068856_100005850 | |||
| 1287 | Ga0068856_100025213 | |||
| 1288 | Ga0068856_100189955 | |||
| 1289 | Ga0068856_100269155 | |||
| 1290 | Ga0070702_100012908 | |||
| 1291 | Ga0070702_100199097 | |||
| 1292 | Ga0068852_100001457 | |||
| 1293 | Ga0068852_100059585 | |||
| 1294 | Ga0068852_100074511 | |||
| 1295 | Ga0068852_100150197 | |||
| 1296 | Ga0068852_100207699 | |||
| 1297 | Ga0068859_100081137 | |||
| 1298 | Ga0068859_100096319 | |||
| 1299 | Ga0068859_100378757 | |||
| 1300 | Ga0068864_100355285 | |||
| 1301 | Ga0068866_10003460 | |||
| 1302 | Ga0068866_10057442 | |||
| 1303 | Ga0068866_10091732 | |||
| 1304 | Ga0068866_10185367 | |||
| 1305 | Ga0068866_10777641 | |||
| 1306 | Ga0068861_100076801 | |||
| 1307 | Ga0068861_100249784 | |||
| 1308 | Ga0068861_100441244 | |||
| 1309 | Ga0068861_100676235 | |||
| 1310 | Ga0068870_10022271 | |||
| 1311 | Ga0068870_10203691 | |||
| 1312 | Ga0068863_100059180 | |||
| 1313 | Ga0068863_101613326 | |||
| 1314 | Ga0068858_100080417 | |||
| 1315 | Ga0068860_100057257 | |||
| 1316 | Ga0068860_100723162 | |||
| 1317 | Ga0068862_100092345 | |||
| 1318 | Ga0068862_100176542 | |||
| 1319 | Ga0068862_100188608 | |||
| 1320 | Ga0081455_10048423 | |||
| 1321 | Ga0081455_10062523 | |||
| 1322 | Ga0081455_10172657 | |||
| 1323 | Ga0081539_10000171 | |||
| 1324 | Ga0081539_10002475 | |||
| 1325 | Ga0081539_10019265 | |||
| 1326 | Ga0075365_10220650 | |||
| 1327 | Ga0075432_10001317 | |||
| 1328 | Ga0075432_10197256 | |||
| 1329 | Ga0070715_10166198 | |||
| 1330 | Ga0070716_100177238 | |||
| 1331 | Ga0070712_100011978 | |||
| 1332 | Ga0070712_100050752 | |||
| 1333 | Ga0070712_100666910 | |||
| 1334 | Ga0097621_100023192 | |||
| 1335 | Ga0097621_100226364 | |||
| 1336 | Ga0097621_100352929 | |||
| 1337 | Ga0068871_100118754 | |||
| 1338 | Ga0068871_100536120 | |||
| 1339 | Ga0068871_100573292 | |||
| 1340 | Ga0068871_100971887 | |||
| 1341 | Ga0075428_100003867 | |||
| 1342 | Ga0075428_100031645 | |||
| 1343 | Ga0075428_101045104 | |||
| 1344 | Ga0075430_100003220 | |||
| 1345 | Ga0075430_100052536 | |||
| 1346 | Ga0075431_100001247 | |||
| 1347 | Ga0075431_100065932 | |||
| 1348 | Ga0075433_10017222 | |||
| 1349 | Ga0075433_10227278 | |||
| 1350 | Ga0075434_100048775 | |||
| 1351 | Ga0075434_100142588 | |||
| 1352 | Ga0075434_100774292 | |||
| 1353 | Ga0075434_100780808 | |||
| 1354 | Ga0075429_100034988 | |||
| 1355 | Ga0075429_100075005 | |||
| 1356 | Ga0068865_100002544 | |||
| 1357 | Ga0068865_100016384 | |||
| 1358 | Ga0068865_100049535 | |||
| 1359 | Ga0068865_101262863 | |||
| 1360 | Ga0075436_100038314 | |||
| 1361 | Ga0075436_100351145 | |||
| 1362 | Ga0097620_100081141 | |||
| 1363 | Ga0097620_100096324 | |||
| 1364 | Ga0097620_100378741 | |||
| 1365 | Ga0075435_100052082 | |||
| 1366 | Ga0075435_100089179 | |||
| 1367 | Ga0075435_100404014 | |||
| 1368 | Ga0075435_101134814 | |||
| 1369 | Ga0105244_10217989 | |||
| 1370 | Ga0105240_10020003 | |||
| 1371 | Ga0105240_10128114 | |||
| 1372 | Ga0105240_10237940 | |||
| 1373 | Ga0111539_10004209 | |||
| 1374 | Ga0111539_10004392 | |||
| 1375 | Ga0111539_10022303 | |||
| 1376 | Ga0111539_10054760 | |||
| 1377 | Ga0111539_10117881 | |||
| 1378 | Ga0111539_10196070 | |||
| 1379 | Ga0111539_10512172 | |||
| 1380 | Ga0111539_11000798 | |||
| 1381 | Ga0111539_11324215 | |||
| 1382 | Ga0105245_10001410 | |||
| 1383 | Ga0105245_10009307 | |||
| 1384 | Ga0105245_10094598 | |||
| 1385 | Ga0105245_10133513 | |||
| 1386 | Ga0105245_10232857 | |||
| 1387 | Ga0105245_10509603 | |||
| 1388 | Ga0105245_10798509 | |||
| 1389 | Ga0105245_11061616 | |||
| 1390 | Ga0105245_11636117 | |||
| 1391 | Ga0105245_12002927 | |||
| 1392 | Ga0105247_10018183 | |||
| 1393 | Ga0114129_10033703 | |||
| 1394 | Ga0114129_10088860 | |||
| 1395 | Ga0114129_10200380 | |||
| 1396 | Ga0114129_10284330 | |||
| 1397 | Ga0114129_10657613 | |||
| 1398 | Ga0114129_11060973 | |||
| 1399 | Ga0105243_10004978 | |||
| 1400 | Ga0105243_10063858 | |||
| 1401 | Ga0105243_10095348 | |||
| 1402 | Ga0105243_10171191 | |||
| 1403 | Ga0105243_10368726 | |||
| 1404 | Ga0105243_10422594 | |||
| 1405 | Ga0105243_10605758 | |||
| 1406 | Ga0105243_11320497 | |||
| 1407 | Ga0105243_11576266 | |||
| 1408 | Ga0105241_10052789 | |||
| 1409 | Ga0105241_10064497 | |||
| 1410 | Ga0105241_10830990 | |||
| 1411 | Ga0105242_10024948 | |||
| 1412 | Ga0105242_10056670 | |||
| 1413 | Ga0105242_10075756 | |||
| 1414 | Ga0105242_10109621 | |||
| 1415 | Ga0105242_10115588 | |||
| 1416 | Ga0105242_10316738 | |||
| 1417 | Ga0105242_10390436 | |||
| 1418 | Ga0105242_10741417 | |||
| 1419 | Ga0105242_11752794 | |||
| 1420 | Ga0105248_10011713 | |||
| 1421 | Ga0105248_10103763 | |||
| 1422 | Ga0105248_10262543 | |||
| 1423 | Ga0105248_10336692 | |||
| 1424 | Ga0105248_10651293 | |||
| 1425 | Ga0105237_10383679 | |||
| 1426 | Ga0105238_10084078 | |||
| 1427 | Ga0105238_10142405 | |||
| 1428 | Ga0105238_10859604 | |||
| 1429 | Ga0105249_10006912 | |||
| 1430 | Ga0105249_10107016 | |||
| 1431 | Ga0105249_10269695 | |||
| 1432 | Ga0105249_10443777 | |||
| 1433 | Ga0105249_12097845 | |||
| 1434 | Ga0105239_10021863 | |||
| 1435 | Ga0105239_10047682 | |||
| 1436 | Ga0105239_10048190 | |||
| 1437 | Ga0105239_10167984 | |||
| 1438 | Ga0105239_10306318 | |||
| 1439 | Ga0105239_10871679 | |||
| 1440 | Ga0105246_10102111 | |||
| 1441 | Ga0105246_10271431 | |||
| 1442 | Ga0105246_10681203 | |||
| 1443 | Ga0157373_10262194 | |||
| 1444 | Ga0157371_10137265 | |||
| 1445 | Ga0157370_10008006 | |||
| 1446 | Ga0157370_10140694 | |||
| 1447 | Ga0157370_10285596 | |||
| 1448 | Ga0157369_10041209 | |||
| 1449 | Ga0157369_10088101 | |||
| 1450 | Ga0157369_10296965 | |||
| 1451 | Ga0157369_10545256 | |||
| 1452 | Ga0157374_10003624 | |||
| 1453 | Ga0157374_10113014 | |||
| 1454 | Ga0157374_10534663 | |||
| 1455 | Ga0157378_10047180 | |||
| 1456 | Ga0157378_10100448 | |||
| 1457 | Ga0157378_12105278 | |||
| 1458 | Ga0163162_10009652 | |||
| 1459 | Ga0163162_10119361 | |||
| 1460 | Ga0157372_10026673 | |||
| 1461 | Ga0157372_10035981 | |||
| 1462 | Ga0157372_10508224 | |||
| 1463 | Ga0157372_10660762 | |||
| 1464 | Ga0157372_10699759 | |||
| 1465 | Ga0157372_10980931 | |||
| 1466 | Ga0157375_10004528 | |||
| 1467 | Ga0157375_10325016 | |||
| 1468 | Ga0157375_10540364 | |||
| 1469 | Ga0157375_10942063 | |||
| 1470 | Ga0157375_11258140 | |||
| 1471 | Ga0157375_11406067 | |||
| 1472 | Ga0163163_11029622 | |||
| 1473 | Ga0163163_11147477 | |||
| 1474 | Ga0163163_11763544 | |||
| 1475 | Ga0157380_10010543 | |||
| 1476 | Ga0157380_10010900 | |||
| 1477 | Ga0157380_10188720 | |||
| 1478 | Ga0157380_10932301 | |||
| 1479 | Ga0182008_10196722 | |||
| 1480 | Ga0157377_10013489 | |||
| 1481 | Ga0157377_10107788 | |||
| 1482 | Ga0157377_10288389 | |||
| 1483 | Ga0157379_10051692 | |||
| 1484 | Ga0157379_10249268 | |||
| 1485 | Ga0157376_10416727 | |||
| 1486 | Ga0163161_10026238 | |||
| 1487 | Ga0163161_10098814 | |||
| 1488 | Ga0197907_10539662 | |||
| 1489 | Ga0206356_11217405 | |||
| 1490 | Ga0206354_10913791 | |||
| 1491 | Ga0206353_11304487 | |||
| 1492 | Ga0206353_11639839 | |||
| 1493 | Ga0207653_10003328 | |||
| 1494 | Ga0207653_10014014 | |||
| 1495 | Ga0207653_10066133 | |||
| 1496 | Ga0207682_10086863 | |||
| 1497 | Ga0207642_10001672 | |||
| 1498 | Ga0207642_10067726 | |||
| 1499 | Ga0207642_10148826 | |||
| 1500 | Ga0207688_10007450 | |||
| 1501 | Ga0207688_10033979 | |||
| 1502 | Ga0207680_10026351 | |||
| 1503 | Ga0207647_10431373 | |||
| 1504 | Ga0207685_10122696 | |||
| 1505 | Ga0207699_10018463 | |||
| 1506 | Ga0207699_10178810 | |||
| 1507 | Ga0207699_10349497 | |||
| 1508 | Ga0207645_10101095 | |||
| 1509 | Ga0207643_10131296 | |||
| 1510 | Ga0207705_10031496 | |||
| 1511 | Ga0207705_10105055 | |||
| 1512 | Ga0207705_10481549 | |||
| 1513 | Ga0207654_10403349 | |||
| 1514 | Ga0207654_10550638 | |||
| 1515 | Ga0207707_10006681 | |||
| 1516 | Ga0207707_10016082 | |||
| 1517 | Ga0207707_10081719 | |||
| 1518 | Ga0207707_10456452 | |||
| 1519 | Ga0207695_10105754 | |||
| 1520 | Ga0207695_10176920 | |||
| 1521 | Ga0207671_10106991 | |||
| 1522 | Ga0207671_10193710 | |||
| 1523 | Ga0207693_10000406 | |||
| 1524 | Ga0207693_10006070 | |||
| 1525 | Ga0207693_10322848 | |||
| 1526 | Ga0207663_10015925 | |||
| 1527 | Ga0207660_10076124 | |||
| 1528 | Ga0207660_10137997 | |||
| 1529 | Ga0207660_10139274 | |||
| 1530 | Ga0207660_10635389 | |||
| 1531 | Ga0207660_11164017 | |||
| 1532 | Ga0207662_10061124 | |||
| 1533 | Ga0207662_10200495 | |||
| 1534 | Ga0207662_10234148 | |||
| 1535 | Ga0207662_10621003 | |||
| 1536 | Ga0207657_10000073 | |||
| 1537 | Ga0207657_10005637 | |||
| 1538 | Ga0207657_10011355 | |||
| 1539 | Ga0207657_10021284 | |||
| 1540 | Ga0207657_10106882 | |||
| 1541 | Ga0207657_10196081 | |||
| 1542 | Ga0207657_10293084 | |||
| 1543 | Ga0207649_10046264 | |||
| 1544 | Ga0207649_10094244 | |||
| 1545 | Ga0207649_10337826 | |||
| 1546 | Ga0207649_10893965 | |||
| 1547 | Ga0207652_10149358 | |||
| 1548 | Ga0207652_10192008 | |||
| 1549 | Ga0207652_10601995 | |||
| 1550 | Ga0207646_10000371 | |||
| 1551 | Ga0207681_10263677 | |||
| 1552 | Ga0207681_10342077 | |||
| 1553 | Ga0207694_10394833 | |||
| 1554 | Ga0207694_10444961 | |||
| 1555 | Ga0207694_10608050 | |||
| 1556 | Ga0207650_10523668 | |||
| 1557 | Ga0207659_10021037 | |||
| 1558 | Ga0207659_10133716 | |||
| 1559 | Ga0207659_10143509 | |||
| 1560 | Ga0207659_10397553 | |||
| 1561 | Ga0207659_10490243 | |||
| 1562 | Ga0207687_10012420 | |||
| 1563 | Ga0207687_10085812 | |||
| 1564 | Ga0207687_10108012 | |||
| 1565 | Ga0207687_10133288 | |||
| 1566 | Ga0207687_10138016 | |||
| 1567 | Ga0207687_10184651 | |||
| 1568 | Ga0207687_10322555 | |||
| 1569 | Ga0207687_10682587 | |||
| 1570 | Ga0207687_10686773 | |||
| 1571 | Ga0207687_11011545 | |||
| 1572 | Ga0207700_10208321 | |||
| 1573 | Ga0207664_10360711 | |||
| 1574 | Ga0207644_10083311 | |||
| 1575 | Ga0207644_11108226 | |||
| 1576 | Ga0207690_10077295 | |||
| 1577 | Ga0207690_10085152 | |||
| 1578 | Ga0207690_10106185 | |||
| 1579 | Ga0207690_10363845 | |||
| 1580 | Ga0207690_10731447 | |||
| 1581 | Ga0207706_10006048 | |||
| 1582 | Ga0207706_10027149 | |||
| 1583 | Ga0207706_10117640 | |||
| 1584 | Ga0207706_10341074 | |||
| 1585 | Ga0207686_10048544 | |||
| 1586 | Ga0207686_10199040 | |||
| 1587 | Ga0207686_10222230 | |||
| 1588 | Ga0207686_10291750 | |||
| 1589 | Ga0207686_10327884 | |||
| 1590 | Ga0207686_10693909 | |||
| 1591 | Ga0207686_10747661 | |||
| 1592 | Ga0207686_11167262 | |||
| 1593 | Ga0207709_10005915 | |||
| 1594 | Ga0207709_10023341 | |||
| 1595 | Ga0207709_10089416 | |||
| 1596 | Ga0207709_10140656 | |||
| 1597 | Ga0207709_10296268 | |||
| 1598 | Ga0207709_10930163 | |||
| 1599 | Ga0207669_10018239 | |||
| 1600 | Ga0207669_10035642 | |||
| 1601 | Ga0207669_10082370 | |||
| 1602 | Ga0207669_10107322 | |||
| 1603 | Ga0207669_10581661 | |||
| 1604 | Ga0207704_10010042 | |||
| 1605 | Ga0207704_10022947 | |||
| 1606 | Ga0207704_10075273 | |||
| 1607 | Ga0207704_10093357 | |||
| 1608 | Ga0207704_10106081 | |||
| 1609 | Ga0207665_10027352 | |||
| 1610 | Ga0207665_10683337 | |||
| 1611 | Ga0207691_10012106 | |||
| 1612 | Ga0207691_10020746 | |||
| 1613 | Ga0207711_10071375 | |||
| 1614 | Ga0207711_10073998 | |||
| 1615 | Ga0207711_10342124 | |||
| 1616 | Ga0207711_10370784 | |||
| 1617 | Ga0207689_10510072 | |||
| 1618 | Ga0207689_10661583 | |||
| 1619 | Ga0207689_10870371 | |||
| 1620 | Ga0207689_11071065 | |||
| 1621 | Ga0207661_10000400 | |||
| 1622 | Ga0207661_10001504 | |||
| 1623 | Ga0207661_10045319 | |||
| 1624 | Ga0207661_10057322 | |||
| 1625 | Ga0207661_10153477 | |||
| 1626 | Ga0207661_10230763 | |||
| 1627 | Ga0207661_10307900 | |||
| 1628 | Ga0207661_10308889 | |||
| 1629 | Ga0207661_10331093 | |||
| 1630 | Ga0207661_10394192 | |||
| 1631 | Ga0207661_10769699 | |||
| 1632 | Ga0207661_10964535 | |||
| 1633 | Ga0207661_11252104 | |||
| 1634 | Ga0207679_10023009 | |||
| 1635 | Ga0207679_10183150 | |||
| 1636 | Ga0207679_11176588 | |||
| 1637 | Ga0207667_10192884 | |||
| 1638 | Ga0207667_10215571 | |||
| 1639 | Ga0207667_10513440 | |||
| 1640 | Ga0207667_10547421 | |||
| 1641 | Ga0207667_11592184 | |||
| 1642 | Ga0207712_10352720 | |||
| 1643 | Ga0207668_10064071 | |||
| 1644 | Ga0207668_10105540 | |||
| 1645 | Ga0207668_11106661 | |||
| 1646 | Ga0207640_10043230 | |||
| 1647 | Ga0207640_10076778 | |||
| 1648 | Ga0207640_10092498 | |||
| 1649 | Ga0207658_10505242 | |||
| 1650 | Ga0207677_10071822 | |||
| 1651 | Ga0207677_10315707 | |||
| 1652 | Ga0207703_10183672 | |||
| 1653 | Ga0207703_11066225 | |||
| 1654 | Ga0207639_10032742 | |||
| 1655 | Ga0207639_10077237 | |||
| 1656 | Ga0207639_10365310 | |||
| 1657 | Ga0207639_10397327 | |||
| 1658 | Ga0207678_10017335 | |||
| 1659 | Ga0207678_10317258 | |||
| 1660 | Ga0207708_10007363 | |||
| 1661 | Ga0207708_10030929 | |||
| 1662 | Ga0207708_10058257 | |||
| 1663 | Ga0207708_10327575 | |||
| 1664 | Ga0207708_10386165 | |||
| 1665 | Ga0207702_10021463 | |||
| 1666 | Ga0207702_10164360 | |||
| 1667 | Ga0207702_10352284 | |||
| 1668 | Ga0207702_10361894 | |||
| 1669 | Ga0207641_10368419 | |||
| 1670 | Ga0207641_11217483 | |||
| 1671 | Ga0207648_10001155 | |||
| 1672 | Ga0207648_10084594 | |||
| 1673 | Ga0207648_10127528 | |||
| 1674 | Ga0207648_10294676 | |||
| 1675 | Ga0207676_10126455 | |||
| 1676 | Ga0207676_10284405 | |||
| 1677 | Ga0207674_10041905 | |||
| 1678 | Ga0207674_10385540 | |||
| 1679 | Ga0207674_11116331 | |||
| 1680 | Ga0207675_100039062 | |||
| 1681 | Ga0207675_100108178 | |||
| 1682 | Ga0207675_100673689 | |||
| 1683 | Ga0207683_10001368 | |||
| 1684 | Ga0207683_10028085 | |||
| 1685 | Ga0207683_10071199 | |||
| 1686 | Ga0207683_10082690 | |||
| 1687 | Ga0207683_10144814 | |||
| 1688 | Ga0207683_10383886 | |||
| 1689 | Ga0207683_10725849 | |||
| 1690 | Ga0207683_11095619 | |||
| 1691 | Ga0207683_11296415 | |||
| 1692 | Ga0207698_10025256 | |||
| 1693 | Ga0207698_10039363 | |||
| 1694 | Ga0207698_10225989 | |||
| 1695 | Ga0207428_10000104 | |||
| 1696 | Ga0207428_10014814 | |||
| 1697 | Ga0207428_10036344 | |||
| 1698 | Ga0207428_10058751 | |||
| 1699 | Ga0207428_10081818 | |||
| 1700 | Ga0268266_10097009 | |||
| 1701 | Ga0268266_10682479 | |||
| 1702 | Ga0268266_11326520 | |||
| 1703 | Ga0268265_11059754 | |||
| 1704 | Ga0268265_11125818 | |||
| 1705 | Ga0265319_1157582 | |||
| 1706 | Ga0265338_10040350 | |||
| 1707 | Ga0265320_10038208 | |||
| 1708 | Ga0307405_10491583 | |||
| 1709 | Ga0307416_100318555 | |||
| 1710 | Ga0307415_100384176 | |||
| 1711 | Ga0373938_0051382 | |||
| 1712 | Ga0373928_0012834 | |||
| 1713 | Ga0373928_0037916 | |||
| 1714 | Ga0373929_0002704 | |||
| 1715 | Ga0373934_0080054 | |||
| 1716 | Ga0373951_0003373 | |||
| 1717 | Ga0373932_0018558 | |||
| 1718 | Ga0373936_0053726 | |||
| 1719 | Ga0373945_0081818 | |||
| 1720 | Ga0373956_0028383 | |||
| 1721 | Ga0373960_0017029 | |||
| 1722 | Ga0373943_0004585 | |||
| 1723 | Ga0373943_0178015 | |||
| 1724 | Ga0373946_0002729 | |||
| 1725 | Ga0373946_0118303 | |||
| 1726 | Ga0373942_0012882 | |||
| 1727 | Ga0373931_0020831 | |||
| 1728 | Ga0373931_0105519 | |||
| 1729 | Ga0373931_0378200 | |||
| 1730 | Ga0373935_0070061 | |||
| 1731 | Ga0373935_0519477 | |||
| 1732 | Ga0373947_0002186 | |||
| 1733 | Ga0373947_0002329 | |||
| 1734 | Ga0373937_0000107 | |||
| 1735 | Ga0373925_0008600 | |||
| 1736 | Ga0373925_0022467 | |||
| 1737 | Ga0395899_0027247 | |||
| 1738 | Ga0395899_0056713 | |||
| 1739 | Ga0395899_0134020 | |||
| 1740 | Ga0395899_0332480 | |||
| 1741 | Ga0395900_0005659 | |||
| 1742 | Ga0395900_0039282 | |||
| 1743 | Ga0395900_0360969 | |||
| 1744 | Ga0395900_0401138 | |||
| 1745 | Ga0395900_0465795 | |||
| 1746 | Ga0395898_0118417 | |||
| 1747 | Ga0395898_0118828 | |||
| 1748 | Ga0395898_0443953 | |||
| 1749 | Ga0395898_0456511 | |||
| 1750 | Ga0395898_0730065 | |||
| 1751 | Ga0395898_0997116 | |||
| 1752 | Ga0395905_0063928 | |||
| 1753 | Ga0395905_0070232 | |||
| 1754 | Ga0395905_0164971 | |||
| 1755 | Ga0395905_0370196 | |||
| 1756 | Ga0395905_0413104 | |||
| 1757 | Ga0395905_0535275 | |||
| 1758 | Ga0395901_0000904 | |||
| 1759 | Ga0395901_0037785 | |||
| 1760 | Ga0395901_0112527 | |||
| 1761 | Ga0395901_0136416 | |||
| 1762 | Ga0395901_0316153 | |||
| 1763 | Ga0395901_0743655 | |||
| 1764 | Ga0395901_1601125 | |||
| 1765 | Ga0439436_0032405 | |||
| 1766 | Ga0439439_0012614 | |||
| 1767 | Ga0451793_0221238 | |||
| 1768 | Ga0451853_0598836 | |||
| 1769 | Ga0451853_2862716 | |||
| 1770 | Ga0439433_0001393 | |||
| 1771 | Ga0439437_017806 | |||
| 1772 | Ga0439442_033676 | |||
| 1773 | Ga0439448_0084263 | |||
| 1774 | Ga0439449_0028363 | |||
| 1775 | Ga0439450_021016 | |||
| 1776 | Ga0439451_001707 | |||
| 1777 | Ga0439454_067487 | |||
| 1778 | Ga0439462_0006260 | |||
| 1779 | Ga0439446_0001540 | |||
| 1780 | Ga0439446_0004290 | |||
| 1781 | Ga0439434_0010858 | |||
| 1782 | Ga0439434_0042199 | |||
| 1783 | Ga0466969_0004681 | |||
| 1784 | Ga0466969_0328705 | |||
| 1785 | Ga0466965_0030583 | |||
| 1786 | Ga0466966_0011395 | |||
| 1787 | Ga0466966_0090554 | |||
| 1788 | Ga0466961_0005030 | |||
| 1789 | Ga0466961_0014159 | |||
| 1790 | Ga0466963_0004897 | |||
| 1791 | Ga0466963_0041040 | |||
| 1792 | Ga0466963_0049382 | |||
| 1793 | Ga0466963_0126306 | |||
| 1794 | Ga0466963_0221403 | |||
| 1795 | Ga0466963_0339622 | |||
| 1796 | Ga0466963_0640005 | |||
| 1797 | Ga0466964_0001421 | |||
| 1798 | Ga0466971_0000768 | |||
| 1799 | Ga0466971_0006213 | |||
| 1800 | Ga0466970_0144565 | |||
| 1801 | Ga0466957_0005752 | |||
| 1802 | Ga0466957_0044589 | |||
| 1803 | Ga0466957_0451197 | |||
| 1804 | Ga0466957_0602604 | |||
| 1805 | Ga0466959_0004630 | |||
| 1806 | Ga0466959_0257965 | |||
| 1807 | Ga0466958_0006279 | |||
| 1808 | Ga0466958_0019366 | |||
| 1809 | Ga0466958_0161079 | |||
| 1810 | Ga0466967_0005862 | |||
| 1811 | Ga0466967_0012698 | |||
| 1812 | Ga0466967_0017608 | |||
| 1813 | Ga0466967_0027407 | |||
| 1814 | Ga0466967_0054062 | |||
| 1815 | Ga0466967_0109005 | |||
| 1816 | Ga0495592_0000089 | |||
| 1817 | Ga0495603_0002404 | |||
| 1818 | Ga0495603_0016845 | |||
| 1819 | Ga0495603_0038673 | |||
| 1820 | Ga0495603_0564792 | |||
| 1821 | Ga0495603_0657930 | |||
| 1822 | Ga0495629_0119635 | |||
| 1823 | Ga0495629_0332740 | |||
| 1824 | Ga0495641_0002430 | |||
| 1825 | Ga0495641_0138364 | |||
| 1826 | Ga0495651_0000057 | |||
| 1827 | Ga0495651_0314617 | |||
| 1828 | Ga0495653_0028354 | |||
| 1829 | Ga0495653_0072567 | |||
| 1830 | Ga0495582_0024097 | |||
| 1831 | Ga0495582_0079585 | |||
| 1832 | Ga0495582_0215921 | |||
| 1833 | Ga0495582_0222962 | |||
| 1834 | Ga0495605_0217372 | |||
| 1835 | Ga0495639_0004511 | |||
| 1836 | Ga0495662_0255175 | |||
| 1837 | Ga0495584_0315172 | |||
| 1838 | Ga0495584_0432491 | |||
| 1839 | Ga0495594_0001407 | |||
| 1840 | Ga0495594_0054381 | |||
| 1841 | Ga0495594_0060162 | |||
| 1842 | Ga0495596_0110667 | |||
| 1843 | Ga0495608_0002880 | |||
| 1844 | Ga0495608_0327686 | |||
| 1845 | Ga0495616_0104136 | |||
| 1846 | Ga0495618_0137110 | |||
| 1847 | Ga0495618_0367806 | |||
| 1848 | Ga0495628_0000066 | |||
| 1849 | Ga0495630_0341511 | |||
| 1850 | Ga0495630_0453667 | |||
| 1851 | Ga0495644_0078581 | |||
| 1852 | Ga0495663_0250864 | |||
| 1853 | Ga0495642_0116086 | |||
| 1854 | Ga0495652_0000118 | |||
| 1855 | Ga0495652_0907627 | |||
| 1856 | Ga0495665_0026926 | |||
| 1857 | Ga0495587_0000096 | |||
| 1858 | Ga0495598_0054577 | |||
| 1859 | Ga0495609_0228987 | |||
| 1860 | Ga0495645_0000052 | |||
| 1861 | Ga0495633_0388066 | |||
| 1862 | Ga0495667_0394618 | |||
| 1863 | Ga0495656_0137837 | |||
| 1864 | Ga0495656_0197163 | |||
| 1865 | Ga0495656_0211048 | |||
| 1866 | Ga0495668_0266921 | |||
| 1867 | Ga0495668_0494276 | |||
| 1868 | Ga0495634_0106206 | |||
| 1869 | Ga0495634_0119858 | |||
| 1870 | Ga0495659_0042279 | |||
| 1871 | Ga0495588_0000537 | |||
| 1872 | Ga0495588_0078247 | |||
| 1873 | Ga0495657_0084489 | |||
| 1874 | Ga0495599_0000046 | |||
| 1875 | Ga0495623_0000061 | |||
| 1876 | Ga0495647_0022214 | |||
| 1877 | Ga0495647_0028454 | |||
| 1878 | Ga0495647_0043763 | |||
| 1879 | Ga0495647_0118600 | |||
| 1880 | Ga0495658_0008228 | |||
| 1881 | Ga0495658_0062724 | |||
| 1882 | Ga0495658_0103844 | |||
| 1883 | Ga0495658_0466230 | |||
| 1884 | Ga0495613_0062181 | |||
| 1885 | Ga0495613_0127887 | |||
| 1886 | Ga0495624_0056812 | |||
| 1887 | Ga0495624_0524635 | |||
| 1888 | Ga0495670_0260281 | |||
| 1889 | Ga0495589_0060698 | |||
| 1890 | Ga0495581_0022119 | |||
| 1891 | Ga0495581_0028818 | |||
| 1892 | Ga0495604_0000075 | |||
| 1893 | Ga0495676_0003263 | |||
| 1894 | Ga0495676_0039225 | |||
| 1895 | Ga0495676_0364282 | |||
| 1896 | Ga0495680_0013423 | |||
| 1897 | Ga0495675_0000089 | |||
| 1898 | Ga0495677_0068840 | |||
| 1899 | Ga0495679_083981 | |||
| 1900 | Ga0495602_0000140 | |||
| 1901 | Ga0495614_0046979 | |||
| 1902 | Ga0496100_0026516 | |||
| 1903 | Ga0496100_0054076 | |||
| 1904 | Ga0496100_0086727 | |||
| 1905 | Ga0496100_0120442 | |||
| 1906 | Ga0496100_0130199 | |||
| 1907 | Ga0496100_0215854 | |||
| 1908 | Ga0496100_0286468 | |||
| 1909 | Ga0496100_0486834 | |||
| 1910 | Ga0496100_1036887 | |||
| 1911 | Ga0496100_1159414 | |||
| 1912 | Ga0496101_0036240 | |||
| 1913 | Ga0496101_0080064 | |||
| 1914 | Ga0496101_0095325 | |||
| 1915 | Ga0496101_0194165 | |||
| 1916 | Ga0496101_0197157 | |||
| 1917 | Ga0496101_0262766 | |||
| 1918 | Ga0496101_0264364 | |||
| 1919 | Ga0496101_0279652 | |||
| 1920 | Ga0496101_0444790 | |||
| 1921 | Ga0496101_0606522 | |||
| 1922 | Ga0496102_0001619 | |||
| 1923 | Ga0496102_0013494 | |||
| 1924 | Ga0496102_0043574 | |||
| 1925 | Ga0496102_0145421 | |||
| 1926 | Ga0496102_0165137 | |||
| 1927 | Ga0496102_0295843 | |||
| 1928 | Ga0496102_0330262 | |||
| 1929 | Ga0496102_0341745 | |||
| 1930 | Ga0496102_1166362 | |||
| 1931 | Ga0496103_0001460 | |||
| 1932 | Ga0496103_0065986 | |||
| 1933 | Ga0496103_0080681 | |||
| 1934 | Ga0496103_0120652 | |||
| 1935 | Ga0496103_0328935 | |||
| 1936 | Ga0496103_0439962 | |||
| 1937 | Ga0496103_0508007 | |||
| 1938 | Ga0496103_0577906 | |||
| 1939 | Ga0496104_0009894 | |||
| 1940 | Ga0496104_0052779 | |||
| 1941 | Ga0496104_0062319 | |||
| 1942 | Ga0496104_0114998 | |||
| 1943 | Ga0496104_0201091 | |||
| 1944 | Ga0496104_0225117 | |||
| 1945 | Ga0496104_0316886 | |||
| 1946 | Ga0496104_0783256 | |||
| 1947 | Ga0496105_0008640 | |||
| 1948 | Ga0496105_0034180 | |||
| 1949 | Ga0496105_0073616 | |||
| 1950 | Ga0496105_0113873 | |||
| 1951 | Ga0496105_0138118 | |||
| 1952 | Ga0496105_0210771 | |||
| 1953 | Ga0496105_0464371 | |||
| 1954 | Ga0496106_0029799 | |||
| 1955 | Ga0496106_0109176 | |||
| 1956 | Ga0496106_0205076 | |||
| 1957 | Ga0496107_0011180 | |||
| 1958 | Ga0496107_0013676 | |||
| 1959 | Ga0496107_0150306 | |||
| 1960 | Ga0496107_0152424 | |||
| 1961 | Ga0496107_0187471 | |||
| 1962 | Ga0496107_0274623 | |||
| 1963 | Ga0496108_0002875 | |||
| 1964 | Ga0496108_0030921 | |||
| 1965 | Ga0496108_0040203 | |||
| 1966 | Ga0496108_0075844 | |||
| 1967 | Ga0496108_0235070 | |||
| 1968 | Ga0496108_0368577 | |||
| 1969 | Ga0496108_0678203 | |||
| 1970 | Ga0496109_0000954 | |||
| 1971 | Ga0496109_0008233 | |||
| 1972 | Ga0496109_0017433 | |||
| 1973 | Ga0496109_0151250 | |||
| 1974 | Ga0496109_0159293 | |||
| 1975 | Ga0496109_0236077 | |||
| 1976 | Ga0496109_0268766 | |||
| 1977 | Ga0496109_0438853 | |||
| 1978 | Ga0496110_0001816 | |||
| 1979 | Ga0496110_0013023 | |||
| 1980 | Ga0496110_0020582 | |||
| 1981 | Ga0496110_0249246 | |||
| 1982 | Ga0496110_0409429 | |||
| 1983 | Ga0496110_0657013 | |||
| 1984 | Ga0496110_0919741 | |||
| 1985 | Ga0496110_1084653 | |||
| 1986 | Ga0496111_0003517 | |||
| 1987 | Ga0496111_0038137 | |||
| 1988 | Ga0496111_0057286 | |||
| 1989 | Ga0496111_0313834 | |||
| 1990 | Ga0496111_0340451 | |||
| 1991 | Ga0496112_0000293 | |||
| 1992 | Ga0496112_0028386 | |||
| 1993 | Ga0496112_0051790 | |||
| 1994 | Ga0496112_0077211 | |||
| 1995 | Ga0496112_0476246 | |||
| 1996 | Ga0496113_0008471 | |||
| 1997 | Ga0496113_0020678 | |||
| 1998 | Ga0496113_0091498 | |||
| 1999 | Ga0496113_0100291 | |||
| 2000 | Ga0496113_0104717 | |||
| 2001 | Ga0496113_0368894 | |||
| 2002 | Ga0496113_0526946 | |||
| 2003 | Ga0496114_0042927 | |||
| 2004 | Ga0496114_0071351 | |||
| 2005 | Ga0496114_0079020 | |||
| 2006 | Ga0496114_0094330 | |||
| 2007 | Ga0496114_0177951 | |||
| 2008 | Ga0496114_0311809 | |||
| 2009 | Ga0496114_0328665 | |||
| 2010 | Ga0496114_0426136 | |||
| 2011 | Ga0496114_0495719 | |||
| 2012 | Ga0496114_0705014 | |||
| 2013 | Ga0496115_0005787 | |||
| 2014 | Ga0496115_0011507 | |||
| 2015 | Ga0496115_0018951 | |||
| 2016 | Ga0496115_0041527 | |||
| 2017 | Ga0496115_0417631 | |||
| 2018 | Ga0501031_0031652 | |||
| 2019 | Ga0501031_0086672 | |||
| 2020 | Ga0501032_0206415 | |||
| 2021 | Ga0501033_0128216 | |||
| 2022 | Ga0501034_0012275 | |||
| 2023 | Ga0501034_0500596 | |||
| 2024 | Ga0501036_0480183 | |||
| 2025 | Ga0501037_0250529 | |||
| 2026 | Ga0501037_0521122 | |||
| 2027 | Ga0501038_0059683 | |||
| 2028 | Ga0501038_0132762 | |||
| 2029 | Ga0501038_0300939 | |||
| 2030 | Ga0501038_0389313 | |||
| 2031 | Ga0501039_0093273 | |||
| 2032 | Ga0501039_0256231 | |||
| 2033 | Ga0501039_0788160 | |||
| 2034 | Ga0501040_0023239 | |||
| 2035 | Ga0501040_0025213 | |||
| 2036 | Ga0501040_0046978 | |||
| 2037 | Ga0501040_0550869 | |||
| 2038 | Ga0501041_0039904 | |||
| 2039 | Ga0501041_0093474 | |||
| 2040 | Ga0501041_0238002 | |||
| 2041 | Ga0501041_0415644 | |||
| 2042 | Ga0501042_0037252 | |||
| 2043 | Ga0501042_0097356 | |||
| 2044 | Ga0501042_0133879 | |||
| 2045 | Ga0501042_0452867 | |||
| 2046 | Ga0501043_0065071 | |||
| 2047 | Ga0501043_0443932 | |||
| 2048 | Ga0501046_0069719 | |||
| 2049 | Ga0501046_0104361 | |||
| 2050 | Ga0501046_0106806 | |||
| 2051 | Ga0501048_0028573 | |||
| 2052 | Ga0501048_0029137 | |||
| 2053 | Ga0501048_0890904 | |||
| 2054 | Ga0501068_0108540 | |||
| 2055 | Ga0501068_0727162 | |||
| 2056 | Ga0501069_0315979 | |||
| 2057 | Ga0501069_0662638 | |||
| 2058 | Ga0501070_0035068 | |||
| 2059 | Ga0501071_0063220 | |||
| 2060 | Ga0501071_0064700 | |||
| 2061 | Ga0501071_0086068 | |||
| 2062 | Ga0501071_0140932 | |||
| 2063 | Ga0501071_0370092 | |||
| 2064 | Ga0501072_0001406 | |||
| 2065 | Ga0501072_0027847 | |||
| 2066 | Ga0501072_0139224 | |||
| 2067 | Ga0501072_0161624 | |||
| 2068 | Ga0501072_0503857 | |||
| 2069 | Ga0501072_0605598 | |||
| 2070 | Ga0501073_0094635 | |||
| 2071 | Ga0501074_0042398 | |||
| 2072 | Ga0501074_0050253 | |||
| 2073 | Ga0501074_0079091 | |||
| 2074 | Ga0501074_0265539 | |||
| 2075 | Ga0501074_0747837 | |||
| 2076 | Ga0501075_0016117 | |||
| 2077 | Ga0501075_0050018 | |||
| 2078 | Ga0501075_0063124 | |||
| 2079 | Ga0501075_0075716 | |||
| 2080 | Ga0501075_0522474 | |||
| 2081 | Ga0501076_0008719 | |||
| 2082 | Ga0501076_0015983 | |||
| 2083 | Ga0501076_0068957 | |||
| 2084 | Ga0501076_0076520 | |||
| 2085 | Ga0501076_0250841 | |||
| 2086 | Ga0501076_0282987 | |||
| 2087 | Ga0501077_0003452 | |||
| 2088 | Ga0501077_0024418 | |||
| 2089 | Ga0501077_0046480 | |||
| 2090 | Ga0501077_0515432 | |||
| 2091 | Ga0501216_097487 | |||
| 2092 | Ga0501079_0049513 | |||
| 2093 | Ga0501079_0050704 | |||
| 2094 | Ga0501079_0143395 | |||
| 2095 | Ga0501079_0482033 | |||
| 2096 | Ga0501079_0583577 | |||
| 2097 | Ga0501079_0757753 | |||
| 2098 | Ga0501080_0003102 | |||
| 2099 | Ga0501080_0014392 | |||
| 2100 | Ga0501080_0019569 | |||
| 2101 | Ga0501080_0601551 | |||
| 2102 | Ga0501080_1030443 | |||
| 2103 | Ga0501081_0058946 | |||
| 2104 | Ga0501081_0076627 | |||
| 2105 | Ga0501081_0115374 | |||
| 2106 | Ga0501081_0260651 | |||
| 2107 | Ga0501081_0755045 | |||
| 2108 | Ga0501083_0072558 | |||
| 2109 | Ga0501083_0075522 | |||
| 2110 | Ga0501035_0020176 | |||
| 2111 | Ga0501035_0110887 | |||
| 2112 | Ga0501044_0400982 | |||
| 2113 | Ga0501045_0085690 | |||
| 2114 | Ga0501045_0097721 | |||
| 2115 | nmdc:mga0yw44_502155_c1 | |||
| 2116 | nmdc:mga05p37_160234_c1 | |||
| 2117 | nmdc:mga05p37_247498_c1 | |||
| 2118 | nmdc:mga05p37_713479_c1 | |||
| 2119 | nmdc:mga09592_57341_c1 | |||
| 2120 | nmdc:mga09592_80779_c1 | |||
| 2121 | nmdc:mga0qj67_204564_c1 | |||
| 2122 | nmdc:mga06r32_540672_c1 | |||
| 2123 | nmdc:mga08y16_100400_c1 | |||
| 2124 | nmdc:mga08y16_65697_c1 | |||
| 2125 | nmdc:mga08y16_68549_c1 | |||
| 2126 | nmdc:mga08y16_86703_c1 | |||
| 2127 | nmdc:mga0n895_1183861_c1 | |||
| 2128 | nmdc:mga0n895_15149_c1 | |||
| 2129 | nmdc:mga0n895_639846_c1 | |||
| 2130 | nmdc:mga0n895_96856_c1 | |||
| 2131 | nmdc:mga0rr50_55781_c1 | |||
| 2132 | nmdc:mga0rr50_592323_c1 | |||
| 2133 | nmdc:mga08x19_12257_c1 | |||
| 2134 | nmdc:mga08x19_99535_c1 | |||
| 2135 | nmdc:mga0a205_113983_c1 | |||
| 2136 | nmdc:mga0a205_246783_c1 | |||
| 2137 | Ga0495601_0000273 | |||
| 2138 | Ga0495601_0351130 | |||
| 2139 | Ga0495612_0091343 | |||
| 2140 | Ga0495655_0133444 | |||
| 2141 | Ga0495595_0016131 | |||
| 2142 | Ga0495595_0119272 | |||
| 2143 | Ga0495619_0000123 | |||
| 2144 | Ga0495619_0064465 | |||
| 2145 | Ga0495619_0334442 | |||
| 2146 | Ga0501084_0002565 | |||
| 2147 | Ga0501084_0029462 | |||
| 2148 | Ga0501084_0032747 | |||
| 2149 | Ga0501084_0049299 | |||
| 2150 | Ga0501084_0160722 | |||
| 2151 | Ga0501084_0217161 | |||
| 2152 | Ga0501084_0661911 | |||
| 2153 | Ga0501084_0786383 | |||
| 2154 | Ga0501084_0872458 | |||
| 2155 | Ga0501082_0019671 | |||
| 2156 | Ga0501082_0077187 | |||
| 2157 | Ga0501082_0377151 | |||
| 2158 | Ga0501082_0512355 | |||
| 2159 | Ga0501082_0529948 | |||
| 2160 | Ga0501082_0765836 | |||
| 2161 | Ga0466962_0002035 | |||
| 2162 | Ga0530510_0034871 | |||
| 2163 | Ga0530510_0097496 | |||
| 2164 | Ga0530510_0437648 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3auf-assembly1.cif.gz_A-2 | crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii | 0.9681 | 2 | 172 |
| 4s1n-assembly1.cif.gz_A | the crystal structure of phosphoribosylglycinamide formyltransferase from streptococcus pneumoniae tigr4 | 0.9645 | 2 | 178 |
| 2ywr-assembly1.cif.gz_A | crystal structure of gar transformylase from aquifex aeolicus | 0.9633 | 2 | 174 |
| 4zyv-assembly1.cif.gz_A | human gar transformylase in complex with gar and n-({5-[(2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidin-6-yl)butyl]thiophen-2-yl}carbonyl)-l-glutamic acid (agf71) | 0.9596 | 2 | 174 |
| 3p9x-assembly1.cif.gz_B | crystal structure of phosphoribosylglycinamide formyltransferase from bacillus halodurans | 0.9572 | 2 | 178 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3aufA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9681 | 2 | 172 | 3.40.50.170 |
| 4s1nA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9584 | 2 | 178 | 3.40.50.170 |
| 1njsA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9551 | 2 | 174 | 3.40.50.170 |
| af_Q2FZI7_1_188_3.40.50.170 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9512 | 2 | 178 | 3.40.50.170 |
| 2ywrA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9501 | 2 | 174 | 3.40.50.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9ZWE7-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) | 0.9881 | 1 | 180 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A538E454-F1-model_v4 | phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) | 0.9821 | 98 | 180 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A7W0G8W0-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) | 0.9768 | 1 | 180 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A550JKQ1-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) | 0.9741 | 2 | 172 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A2V6XK53-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) | 0.9728 | 2 | 150 |
GO:0004644
GO:0005829 GO:0006189 |