F489700

General Info

Members Datasets Scaffolds Average Seq Length
1082 366 2164 178

Family's Representative Sequence

Representative Sequence 3300046615|Ga0495656_0021620|Ga0495656_0021620_456_1082
Length 208
Sequence MNAGSWRVPAGARGDAGGRLRRPGGDAGQVRAIGVLVSGEGTNLQALVDAGLPVRAVASNRVGARALARAERAGIAAEVFELDSYGSRDERDEAMAAWLASQGVDLVVCAGYMHLLTPAFLDRYPGRIVNVHPSLLPEFPGARAIDDALEAGVETTGVTVHLIDEGLDTGDVIRQEPLPIEPRDTLPARIQAIEHRLLPEVVRELCVH

Samples

Sample ID Description Type Environment
1 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
194 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
195 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
200 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
201 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
202 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
203 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
204 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
205 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
207 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
208 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
218 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
223 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
224 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
225 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
226 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
227 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
228 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
229 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
230 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
231 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
232 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
233 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
234 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
235 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
236 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
237 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
238 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
239 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
240 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
241 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
242 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
243 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
244 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
247 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
253 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
254 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
255 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
256 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
257 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
258 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
259 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
260 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
261 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
262 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
263 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
264 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
265 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
266 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
267 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
268 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
269 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
270 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
271 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
272 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
273 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
274 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
275 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
276 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
277 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
278 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
279 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
280 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
281 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
282 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
283 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
284 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
285 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
290 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
291 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
294 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
295 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
296 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
297 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
298 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
299 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
306 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
307 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
308 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
311 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
312 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
331 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
332 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
333 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
334 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
335 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
336 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
337 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
338 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
339 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
340 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
341 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
342 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
343 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
344 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
345 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
348 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
349 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
350 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
351 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
352 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
353 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
354 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
355 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
356 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
357 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
358 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
359 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
360 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
361 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
362 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
363 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
364 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
365 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
366 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 10.81
Rhizosphere 88.82
Stem 0
Stem Tuber 0
Unclassified 4.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495656_0021620 3300046615 Unclassified 2507
2 JGI24743J22301_10005572 3300001991 Bacteria 2107
3 JGI24743J22301_10005797 3300001991 Bacteria 2076
4 JGI24738J21930_10009489 3300002075 Bacteria 2188
5 JGI24744J21845_10025107 3300002077 Bacteria 1162
6 JGI25406J46586_10058983 3300003203 Bacteria 1248
7 Ga0070658_10060765 3300005327 Bacteria 3078
8 Ga0070676_10110270 3300005328 Bacteria 1713
9 Ga0070676_10151395 3300005328 Bacteria 1485
10 Ga0070683_100011303 3300005329 Bacteria 7709
11 Ga0070683_100040724 3300005329 Bacteria 4272
12 Ga0070683_100046543 3300005329 Bacteria 4008
13 Ga0070683_100172406 3300005329 Bacteria 2053
14 Ga0070683_100336611 3300005329 Bacteria 1437
15 Ga0070683_100339387 3300005329 Bacteria 1430
16 Ga0070683_100416911 3300005329 Bacteria 1281
17 Ga0070683_100557046 3300005329 Bacteria 1096
18 Ga0070683_100574285 3300005329 Bacteria 1078
19 Ga0070683_100946830 3300005329 Bacteria 826
20 Ga0070683_101239251 3300005329 Bacteria 717
21 Ga0070690_100042356 3300005330 Bacteria 2883
22 Ga0070690_100301834 3300005330 Bacteria 1149
23 Ga0068869_100054245 3300005334 Bacteria 2917
24 Ga0068869_100570088 3300005334 Bacteria 953
25 Ga0070666_10064420 3300005335 Bacteria 2486
26 Ga0070666_10206516 3300005335 Bacteria 1383
27 Ga0070680_100005620 3300005336 Bacteria 9494
28 Ga0070680_100278091 3300005336 Bacteria 1418
29 Ga0070680_100736198 3300005336 Bacteria 849
30 Ga0070680_101046726 3300005336 Bacteria 705
31 Ga0070682_100002331 3300005337 Bacteria 10498
32 Ga0070682_100097901 3300005337 Bacteria 1931
33 Ga0070682_100144941 3300005337 Bacteria 1623
34 Ga0070682_100241964 3300005337 Bacteria 1296
35 Ga0068868_100015257 3300005338 Bacteria 5678
36 Ga0068868_100045658 3300005338 Bacteria 3428
37 Ga0068868_100588169 3300005338 Bacteria 985
38 Ga0068868_100843686 3300005338 Bacteria 829
39 Ga0068868_100963878 3300005338 Unclassified 778
40 Ga0070660_100003396 3300005339 Bacteria 10956
41 Ga0070660_100004253 3300005339 Bacteria 9880
42 Ga0070660_100056168 3300005339 Bacteria 3045
43 Ga0070660_100182606 3300005339 Bacteria 1698
44 Ga0070660_100221565 3300005339 Bacteria 1538
45 Ga0070660_100389315 3300005339 Bacteria 1151
46 Ga0070689_100011564 3300005340 Bacteria 6324
47 Ga0070689_100181284 3300005340 Bacteria 1711
48 Ga0070691_10059656 3300005341 Bacteria 1833
49 Ga0070687_100178765 3300005343 Bacteria 1269
50 Ga0070687_100251142 3300005343 Bacteria 1099
51 Ga0070687_100434785 3300005343 Bacteria 869
52 Ga0070687_100859644 3300005343 Unclassified 647
53 Ga0070661_100057489 3300005344 Bacteria 2850
54 Ga0070661_100094629 3300005344 Bacteria 2214
55 Ga0070661_100335969 3300005344 Bacteria 1182
56 Ga0070661_100364852 3300005344 Bacteria 1136
57 Ga0070661_100586610 3300005344 Bacteria 900
58 Ga0070692_10003563 3300005345 Bacteria 6339
59 Ga0070692_10037837 3300005345 Bacteria 2455
60 Ga0070692_10069093 3300005345 Bacteria 1878
61 Ga0070668_100013432 3300005347 Bacteria 6113
62 Ga0070668_100674835 3300005347 Bacteria 910
63 Ga0070668_100949297 3300005347 Bacteria 771
64 Ga0070668_101203109 3300005347 Bacteria 687
65 Ga0070675_100008011 3300005354 Bacteria 8190
66 Ga0070675_100036827 3300005354 Bacteria 3983
67 Ga0070675_100151229 3300005354 Bacteria 1990
68 Ga0070675_100321560 3300005354 Bacteria 1367
69 Ga0070675_100709369 3300005354 Bacteria 916
70 Ga0070675_100919193 3300005354 Bacteria 802
71 Ga0070671_100021637 3300005355 Bacteria 5253
72 Ga0070671_100048075 3300005355 Bacteria 3547
73 Ga0070671_100318560 3300005355 Archaea 1325
74 Ga0070671_100453384 3300005355 Bacteria 1100
75 Ga0070674_100050635 3300005356 Bacteria 2859
76 Ga0070674_100062552 3300005356 Bacteria 2601
77 Ga0070674_100142539 3300005356 Bacteria 1800
78 Ga0070674_100567374 3300005356 Unclassified 954
79 Ga0070674_100745649 3300005356 Bacteria 841
80 Ga0070673_100036337 3300005364 Bacteria 3743
81 Ga0070673_101264652 3300005364 Unclassified 692
82 Ga0070688_100001743 3300005365 Bacteria 10860
83 Ga0070688_100155261 3300005365 Bacteria 1567
84 Ga0070688_100794852 3300005365 Bacteria 739
85 Ga0070659_100014966 3300005366 Bacteria 5803
86 Ga0070659_100023401 3300005366 Bacteria 4727
87 Ga0070659_100050901 3300005366 Bacteria 3256
88 Ga0070659_100133099 3300005366 Bacteria 2020
89 Ga0070667_100044216 3300005367 Bacteria 3739
90 Ga0070667_100340500 3300005367 Bacteria 1356
91 Ga0070667_101017664 3300005367 Bacteria 773
92 Ga0070703_10005248 3300005406 Bacteria 3621
93 Ga0070709_10009858 3300005434 Bacteria 5278
94 Ga0070709_10312376 3300005434 Bacteria 1151
95 Ga0070714_100393538 3300005435 Bacteria 1308
96 Ga0070714_100520108 3300005435 Bacteria 1136
97 Ga0070713_100055508 3300005436 Bacteria 3292
98 Ga0070710_10005240 3300005437 Bacteria 6144
99 Ga0070710_10117159 3300005437 Bacteria 1607
100 Ga0070701_10005453 3300005438 Bacteria 5259
101 Ga0070701_10006793 3300005438 Bacteria 4838
102 Ga0070711_100135244 3300005439 Bacteria 1841
103 Ga0070711_100200624 3300005439 Bacteria 1539
104 Ga0070711_100288713 3300005439 Bacteria 1300
105 Ga0070705_100009369 3300005440 Bacteria 4867
106 Ga0070705_100017042 3300005440 Bacteria 3784
107 Ga0070705_100026272 3300005440 Bacteria 3167
108 Ga0070705_100304779 3300005440 Bacteria 1143
109 Ga0070700_100036094 3300005441 Bacteria 2996
110 Ga0070700_100225102 3300005441 Bacteria 1331
111 Ga0070700_100236296 3300005441 Bacteria 1303
112 Ga0070700_100427417 3300005441 Bacteria 1002
113 Ga0070700_100552378 3300005441 Bacteria 895
114 Ga0070700_100571323 3300005441 Bacteria 881
115 Ga0070700_100586827 3300005441 Unclassified 871
116 Ga0070700_100595831 3300005441 Bacteria 865
117 Ga0070700_100985164 3300005441 Bacteria 692
118 Ga0070694_100013842 3300005444 Bacteria 5045
119 Ga0070694_100090801 3300005444 Bacteria 2142
120 Ga0070694_100751029 3300005444 Bacteria 797
121 Ga0070663_100437513 3300005455 Unclassified 1075
122 Ga0070663_100517069 3300005455 Bacteria 993
123 Ga0070678_100012221 3300005456 Bacteria 5327
124 Ga0070678_100237344 3300005456 Bacteria 1523
125 Ga0070678_100313838 3300005456 Bacteria 1337
126 Ga0070678_100317990 3300005456 Bacteria 1328
127 Ga0070678_100338260 3300005456 Bacteria 1290
128 Ga0070678_100347777 3300005456 Unclassified 1274
129 Ga0070678_101013739 3300005456 Bacteria 763
130 Ga0070662_100016137 3300005457 Bacteria 5011
131 Ga0070662_100017748 3300005457 Bacteria 4801
132 Ga0070662_100048961 3300005457 Bacteria 3047
133 Ga0070662_100901306 3300005457 Unclassified 754
134 Ga0070681_10009307 3300005458 Bacteria 9663
135 Ga0070681_10022112 3300005458 Bacteria 6383
136 Ga0070681_10062368 3300005458 Bacteria 3701
137 Ga0070681_10177554 3300005458 Bacteria 2051
138 Ga0070681_10264879 3300005458 Bacteria 1630
139 Ga0068867_100011424 3300005459 Bacteria 6266
140 Ga0068867_100047753 3300005459 Bacteria 3148
141 Ga0068867_100236631 3300005459 Bacteria 1479
142 Ga0068867_100985105 3300005459 Bacteria 763
143 Ga0070685_10000906 3300005466 Bacteria 15926
144 Ga0070685_10007842 3300005466 Bacteria 5467
145 Ga0070685_10126548 3300005466 Bacteria 1592
146 Ga0070706_100031877 3300005467 Bacteria 4859
147 Ga0070707_100000570 3300005468 Bacteria 37054
148 Ga0070707_100096210 3300005468 Bacteria 2868
149 Ga0070699_100030146 3300005518 Bacteria 4681
150 Ga0070699_100388923 3300005518 Bacteria 1260
151 Ga0070679_100010388 3300005530 Bacteria 8830
152 Ga0070679_100020579 3300005530 Bacteria 6434
153 Ga0070679_100023275 3300005530 Bacteria 6061
154 Ga0070679_100243505 3300005530 Bacteria 1755
155 Ga0070679_100288463 3300005530 Bacteria 1593
156 Ga0070679_101066196 3300005530 Bacteria 752
157 Ga0070679_101176687 3300005530 Bacteria 712
158 Ga0070684_100000634 3300005535 Bacteria 24130
159 Ga0070684_100011665 3300005535 Bacteria 7007
160 Ga0070684_100024133 3300005535 Bacteria 5098
161 Ga0070684_100029406 3300005535 Bacteria 4656
162 Ga0070684_100198038 3300005535 Bacteria 1829
163 Ga0070684_100342306 3300005535 Bacteria 1375
164 Ga0070684_101267447 3300005535 Bacteria 693
165 Ga0070697_100150866 3300005536 Bacteria 1959
166 Ga0068853_100031095 3300005539 Bacteria 4514
167 Ga0068853_100070321 3300005539 Bacteria 3046
168 Ga0068853_100104917 3300005539 Bacteria 2503
169 Ga0068853_100545371 3300005539 Bacteria 1098
170 Ga0070672_100012733 3300005543 Bacteria 5921
171 Ga0070672_100047840 3300005543 Bacteria 3320
172 Ga0070672_100061149 3300005543 Bacteria 2968
173 Ga0070686_100006796 3300005544 Bacteria 6368
174 Ga0070686_100241485 3300005544 Bacteria 1315
175 Ga0070695_100029877 3300005545 Bacteria 3389
176 Ga0070695_100031918 3300005545 Bacteria 3290
177 Ga0070696_100028797 3300005546 Bacteria 3790
178 Ga0070696_100218863 3300005546 Bacteria 1428
179 Ga0070696_100738378 3300005546 Bacteria 805
180 Ga0070693_100103112 3300005547 Bacteria 1741
181 Ga0070693_100113908 3300005547 Bacteria 1668
182 Ga0070693_100135874 3300005547 Bacteria 1542
183 Ga0070693_100466625 3300005547 Bacteria 889
184 Ga0070665_100143887 3300005548 Bacteria 2387
185 Ga0070665_100239330 3300005548 Bacteria 1816
186 Ga0070665_100545571 3300005548 Bacteria 1171
187 Ga0070704_100015880 3300005549 Bacteria 4742
188 Ga0070704_100036602 3300005549 Bacteria 3346
189 Ga0070704_100399269 3300005549 Unclassified 1173
190 Ga0070704_100412297 3300005549 Unclassified 1155
191 Ga0070704_100659290 3300005549 Bacteria 924
192 Ga0068855_100107593 3300005563 Bacteria 3203
193 Ga0068855_100651087 3300005563 Bacteria 1131
194 Ga0070664_100049663 3300005564 Bacteria 3548
195 Ga0070664_100072406 3300005564 Bacteria 2955
196 Ga0070664_100226947 3300005564 Bacteria 1673
197 Ga0070664_100399411 3300005564 Bacteria 1257
198 Ga0070664_100412135 3300005564 Bacteria 1237
199 Ga0070664_100604104 3300005564 Bacteria 1017
200 Ga0070664_101410841 3300005564 Bacteria 658
201 Ga0068857_100050538 3300005577 Bacteria 3687
202 Ga0068857_100622894 3300005577 Unclassified 1021
203 Ga0068854_100038806 3300005578 Bacteria 3351
204 Ga0068856_100005850 3300005614 Bacteria 12119
205 Ga0068856_100025213 3300005614 Bacteria 5793
206 Ga0068856_100189955 3300005614 Bacteria 2068
207 Ga0068856_100269155 3300005614 Bacteria 1719
208 Ga0070702_100012908 3300005615 Bacteria 4206
209 Ga0070702_100199097 3300005615 Bacteria 1324
210 Ga0068852_100001457 3300005616 Bacteria 15978
211 Ga0068852_100059585 3300005616 Bacteria 3311
212 Ga0068852_100074511 3300005616 Bacteria 2990
213 Ga0068852_100150197 3300005616 Bacteria 2166
214 Ga0068852_100207699 3300005616 Bacteria 1856
215 Ga0068859_100081137 3300005617 Bacteria 3285
216 Ga0068859_100096319 3300005617 Bacteria 3012
217 Ga0068859_100378757 3300005617 Bacteria 1511
218 Ga0068864_100355285 3300005618 Bacteria 1384
219 Ga0068866_10003460 3300005718 Bacteria 6464
220 Ga0068866_10057442 3300005718 Bacteria 2005
221 Ga0068866_10091732 3300005718 Bacteria 1656
222 Ga0068866_10185367 3300005718 Bacteria 1232
223 Ga0068866_10777641 3300005718 Bacteria 663
224 Ga0068861_100076801 3300005719 Bacteria 2604
225 Ga0068861_100249784 3300005719 Bacteria 1513
226 Ga0068861_100441244 3300005719 Bacteria 1164
227 Ga0068861_100676235 3300005719 Bacteria 956
228 Ga0068870_10022271 3300005840 Bacteria 3111
229 Ga0068870_10203691 3300005840 Bacteria 1201
230 Ga0068863_100059180 3300005841 Bacteria 3625
231 Ga0068863_101613326 3300005841 Bacteria 658
232 Ga0068858_100080417 3300005842 Bacteria 3028
233 Ga0068860_100057257 3300005843 Bacteria 3705
234 Ga0068860_100723162 3300005843 Bacteria 1006
235 Ga0068862_100092345 3300005844 Bacteria 2638
236 Ga0068862_100176542 3300005844 Bacteria 1915
237 Ga0068862_100188608 3300005844 Bacteria 1854
238 Ga0081455_10048423 3300005937 Bacteria 3673
239 Ga0081455_10062523 3300005937 Bacteria 3129
240 Ga0081455_10172657 3300005937 Bacteria 1645
241 Ga0081539_10000171 3300005985 Bacteria 152572
242 Ga0081539_10002475 3300005985 Bacteria 25990
243 Ga0081539_10019265 3300005985 Bacteria 4680
244 Ga0075365_10220650 3300006038 Bacteria 1330
245 Ga0075432_10001317 3300006058 Bacteria 8020
246 Ga0075432_10197256 3300006058 Bacteria 795
247 Ga0070715_10166198 3300006163 Bacteria 1095
248 Ga0070716_100177238 3300006173 Bacteria 1396
249 Ga0070712_100011978 3300006175 Bacteria 5513
250 Ga0070712_100050752 3300006175 Bacteria 2887
251 Ga0070712_100666910 3300006175 Bacteria 885
252 Ga0097621_100023192 3300006237 Bacteria 4828
253 Ga0097621_100226364 3300006237 Bacteria 1631
254 Ga0097621_100352929 3300006237 Bacteria 1308
255 Ga0068871_100118754 3300006358 Bacteria 2231
256 Ga0068871_100536120 3300006358 Bacteria 1059
257 Ga0068871_100573292 3300006358 Bacteria 1024
258 Ga0068871_100971887 3300006358 Bacteria 790
259 Ga0075428_100003867 3300006844 Bacteria 16450
260 Ga0075428_100031645 3300006844 Bacteria 5846
261 Ga0075428_101045104 3300006844 Unclassified 864
262 Ga0075430_100003220 3300006846 Bacteria 13674
263 Ga0075430_100052536 3300006846 Bacteria 3433
264 Ga0075431_100001247 3300006847 Bacteria 23120
265 Ga0075431_100065932 3300006847 Bacteria 3738
266 Ga0075433_10017222 3300006852 Bacteria 5980
267 Ga0075433_10227278 3300006852 Bacteria 1657
268 Ga0075434_100048775 3300006871 Bacteria 4202
269 Ga0075434_100142588 3300006871 Bacteria 2416
270 Ga0075434_100774292 3300006871 Bacteria 976
271 Ga0075434_100780808 3300006871 Unclassified 972
272 Ga0075429_100034988 3300006880 Bacteria 4366
273 Ga0075429_100075005 3300006880 Bacteria 2946
274 Ga0068865_100002544 3300006881 Bacteria 10808
275 Ga0068865_100016384 3300006881 Bacteria 4742
276 Ga0068865_100049535 3300006881 Bacteria 2896
277 Ga0068865_101262863 3300006881 Unclassified 655
278 Ga0075436_100038314 3300006914 Bacteria 3309
279 Ga0075436_100351145 3300006914 Unclassified 1063
280 Ga0097620_100081141 3300006931 Bacteria 3285
281 Ga0097620_100096324 3300006931 Bacteria 3012
282 Ga0097620_100378741 3300006931 Bacteria 1511
283 Ga0075435_100052082 3300007076 Bacteria 3299
284 Ga0075435_100089179 3300007076 Bacteria 2542
285 Ga0075435_100404014 3300007076 Bacteria 1175
286 Ga0075435_101134814 3300007076 Bacteria 683
287 Ga0105244_10217989 3300009036 Bacteria 896
288 Ga0105240_10020003 3300009093 Bacteria 8937
289 Ga0105240_10128114 3300009093 Bacteria 3047
290 Ga0105240_10237940 3300009093 Bacteria 2112
291 Ga0111539_10004209 3300009094 Bacteria 18879
292 Ga0111539_10004392 3300009094 Bacteria 18444
293 Ga0111539_10022303 3300009094 Bacteria 7782
294 Ga0111539_10054760 3300009094 Bacteria 4745
295 Ga0111539_10117881 3300009094 Bacteria 3111
296 Ga0111539_10196070 3300009094 Bacteria 2355
297 Ga0111539_10512172 3300009094 Bacteria 1398
298 Ga0111539_11000798 3300009094 Bacteria 972
299 Ga0111539_11324215 3300009094 Bacteria 836
300 Ga0105245_10001410 3300009098 Bacteria 21797
301 Ga0105245_10009307 3300009098 Bacteria 8566
302 Ga0105245_10094598 3300009098 Bacteria 2755
303 Ga0105245_10133513 3300009098 Bacteria 2330
304 Ga0105245_10232857 3300009098 Bacteria 1782
305 Ga0105245_10509603 3300009098 Bacteria 1220
306 Ga0105245_10798509 3300009098 Bacteria 982
307 Ga0105245_11061616 3300009098 Bacteria 856
308 Ga0105245_11636117 3300009098 Bacteria 696
309 Ga0105245_12002927 3300009098 Bacteria 632
310 Ga0105247_10018183 3300009101 Bacteria 4216
311 Ga0114129_10033703 3300009147 Bacteria 7236
312 Ga0114129_10088860 3300009147 Bacteria 4284
313 Ga0114129_10200380 3300009147 Bacteria 2704
314 Ga0114129_10284330 3300009147 Bacteria 2209
315 Ga0114129_10657613 3300009147 Bacteria 1352
316 Ga0114129_11060973 3300009147 Bacteria 1017
317 Ga0105243_10004978 3300009148 Bacteria 10414
318 Ga0105243_10063858 3300009148 Bacteria 2952
319 Ga0105243_10095348 3300009148 Bacteria 2459
320 Ga0105243_10171191 3300009148 Bacteria 1881
321 Ga0105243_10368726 3300009148 Bacteria 1324
322 Ga0105243_10422594 3300009148 Bacteria 1244
323 Ga0105243_10605758 3300009148 Bacteria 1055
324 Ga0105243_11320497 3300009148 Bacteria 739
325 Ga0105243_11576266 3300009148 Unclassified 683
326 Ga0105241_10052789 3300009174 Bacteria 3105
327 Ga0105241_10064497 3300009174 Bacteria 2828
328 Ga0105241_10830990 3300009174 Bacteria 853
329 Ga0105242_10024948 3300009176 Bacteria 4726
330 Ga0105242_10056670 3300009176 Bacteria 3207
331 Ga0105242_10075756 3300009176 Bacteria 2802
332 Ga0105242_10109621 3300009176 Bacteria 2351
333 Ga0105242_10115588 3300009176 Bacteria 2294
334 Ga0105242_10316738 3300009176 Bacteria 1429
335 Ga0105242_10390436 3300009176 Bacteria 1296
336 Ga0105242_10741417 3300009176 Bacteria 966
337 Ga0105242_11752794 3300009176 Bacteria 658
338 Ga0105248_10011713 3300009177 Bacteria 9669
339 Ga0105248_10103763 3300009177 Bacteria 3205
340 Ga0105248_10262543 3300009177 Bacteria 1944
341 Ga0105248_10336692 3300009177 Bacteria 1699
342 Ga0105248_10651293 3300009177 Bacteria 1189
343 Ga0105237_10383679 3300009545 Bacteria 1410
344 Ga0105238_10084078 3300009551 Bacteria 3172
345 Ga0105238_10142405 3300009551 Bacteria 2374
346 Ga0105238_10859604 3300009551 Bacteria 924
347 Ga0105249_10006912 3300009553 Bacteria 9893
348 Ga0105249_10107016 3300009553 Bacteria 2639
349 Ga0105249_10269695 3300009553 Bacteria 1695
350 Ga0105249_10443777 3300009553 Unclassified 1335
351 Ga0105249_12097845 3300009553 Bacteria 638
352 Ga0105239_10021863 3300010375 Bacteria 7051
353 Ga0105239_10047682 3300010375 Bacteria 4695
354 Ga0105239_10048190 3300010375 Bacteria 4672
355 Ga0105239_10167984 3300010375 Bacteria 2453
356 Ga0105239_10306318 3300010375 Bacteria 1790
357 Ga0105239_10871679 3300010375 Bacteria 1033
358 Ga0105246_10102111 3300011119 Bacteria 2090
359 Ga0105246_10271431 3300011119 Bacteria 1356
360 Ga0105246_10681203 3300011119 Unclassified 899
361 Ga0157373_10262194 3300013100 Bacteria 1223
362 Ga0157371_10137265 3300013102 Bacteria 1741
363 Ga0157370_10008006 3300013104 Bacteria 11450
364 Ga0157370_10140694 3300013104 Bacteria 2249
365 Ga0157370_10285596 3300013104 Bacteria 1524
366 Ga0157369_10041209 3300013105 Bacteria 5040
367 Ga0157369_10088101 3300013105 Bacteria 3313
368 Ga0157369_10296965 3300013105 Bacteria 1681
369 Ga0157369_10545256 3300013105 Bacteria 1199
370 Ga0157374_10003624 3300013296 Bacteria 12994
371 Ga0157374_10113014 3300013296 Bacteria 2614
372 Ga0157374_10534663 3300013296 Bacteria 1179
373 Ga0157378_10047180 3300013297 Bacteria 3829
374 Ga0157378_10100448 3300013297 Bacteria 2641
375 Ga0157378_12105278 3300013297 Bacteria 615
376 Ga0163162_10009652 3300013306 Bacteria 9384
377 Ga0163162_10119361 3300013306 Bacteria 2740
378 Ga0157372_10026673 3300013307 Bacteria 6287
379 Ga0157372_10035981 3300013307 Bacteria 5453
380 Ga0157372_10508224 3300013307 Bacteria 1405
381 Ga0157372_10660762 3300013307 Bacteria 1217
382 Ga0157372_10699759 3300013307 Bacteria 1179
383 Ga0157372_10980931 3300013307 Unclassified 979
384 Ga0157375_10004528 3300013308 Bacteria 12077
385 Ga0157375_10325016 3300013308 Bacteria 1703
386 Ga0157375_10540364 3300013308 Bacteria 1328
387 Ga0157375_10942063 3300013308 Unclassified 1006
388 Ga0157375_11258140 3300013308 Bacteria 869
389 Ga0157375_11406067 3300013308 Bacteria 822
390 Ga0163163_11029622 3300014325 Bacteria 887
391 Ga0163163_11147477 3300014325 Bacteria 840
392 Ga0163163_11763544 3300014325 Bacteria 679
393 Ga0157380_10010543 3300014326 Bacteria 6649
394 Ga0157380_10010900 3300014326 Bacteria 6554
395 Ga0157380_10188720 3300014326 Bacteria 1818
396 Ga0157380_10932301 3300014326 Bacteria 897
397 Ga0182008_10196722 3300014497 Bacteria 1024
398 Ga0157377_10013489 3300014745 Bacteria 4136
399 Ga0157377_10107788 3300014745 Bacteria 1670
400 Ga0157377_10288389 3300014745 Bacteria 1079
401 Ga0157379_10051692 3300014968 Bacteria 3670
402 Ga0157379_10249268 3300014968 Bacteria 1612
403 Ga0157376_10416727 3300014969 Bacteria 1302
404 Ga0163161_10026238 3300017792 Bacteria 4127
405 Ga0163161_10098814 3300017792 Bacteria 2170
406 Ga0197907_10539662 3300020069 Bacteria 3237
407 Ga0206356_11217405 3300020070 Bacteria 3061
408 Ga0206354_10913791 3300020081 Bacteria 5007
409 Ga0206353_11304487 3300020082 Bacteria 5337
410 Ga0206353_11639839 3300020082 Bacteria 1643
411 Ga0207653_10003328 3300025885 Bacteria 5076
412 Ga0207653_10014014 3300025885 Bacteria 2513
413 Ga0207653_10066133 3300025885 Bacteria 1228
414 Ga0207682_10086863 3300025893 Bacteria 1350
415 Ga0207642_10001672 3300025899 Bacteria 6846
416 Ga0207642_10067726 3300025899 Bacteria 1686
417 Ga0207642_10148826 3300025899 Bacteria 1243
418 Ga0207688_10007450 3300025901 Bacteria 5950
419 Ga0207688_10033979 3300025901 Bacteria 2822
420 Ga0207680_10026351 3300025903 Bacteria 3222
421 Ga0207647_10431373 3300025904 Unclassified 740
422 Ga0207685_10122696 3300025905 Bacteria 1143
423 Ga0207699_10018463 3300025906 Bacteria 3696
424 Ga0207699_10178810 3300025906 Bacteria 1424
425 Ga0207699_10349497 3300025906 Bacteria 1043
426 Ga0207645_10101095 3300025907 Bacteria 1860
427 Ga0207643_10131296 3300025908 Bacteria 1491
428 Ga0207705_10031496 3300025909 Bacteria 3787
429 Ga0207705_10105055 3300025909 Bacteria 2081
430 Ga0207705_10481549 3300025909 Unclassified 963
431 Ga0207654_10403349 3300025911 Bacteria 951
432 Ga0207654_10550638 3300025911 Bacteria 819
433 Ga0207707_10006681 3300025912 Bacteria 10063
434 Ga0207707_10016082 3300025912 Bacteria 6526
435 Ga0207707_10081719 3300025912 Bacteria 2821
436 Ga0207707_10456452 3300025912 Bacteria 1093
437 Ga0207695_10105754 3300025913 Bacteria 2801
438 Ga0207695_10176920 3300025913 Bacteria 2056
439 Ga0207671_10106991 3300025914 Bacteria 2124
440 Ga0207671_10193710 3300025914 Bacteria 1585
441 Ga0207693_10000406 3300025915 Bacteria 39259
442 Ga0207693_10006070 3300025915 Bacteria 10005
443 Ga0207693_10322848 3300025915 Unclassified 1208
444 Ga0207663_10015925 3300025916 Bacteria 4160
445 Ga0207660_10076124 3300025917 Bacteria 2453
446 Ga0207660_10137997 3300025917 Bacteria 1862
447 Ga0207660_10139274 3300025917 Bacteria 1854
448 Ga0207660_10635389 3300025917 Bacteria 870
449 Ga0207660_11164017 3300025917 Bacteria 628
450 Ga0207662_10061124 3300025918 Bacteria 2261
451 Ga0207662_10200495 3300025918 Bacteria 1291
452 Ga0207662_10234148 3300025918 Bacteria 1200
453 Ga0207662_10621003 3300025918 Unclassified 753
454 Ga0207657_10000073 3300025919 Bacteria 93299
455 Ga0207657_10005637 3300025919 Bacteria 13064
456 Ga0207657_10011355 3300025919 Bacteria 8847
457 Ga0207657_10021284 3300025919 Bacteria 6108
458 Ga0207657_10106882 3300025919 Bacteria 2315
459 Ga0207657_10196081 3300025919 Bacteria 1627
460 Ga0207657_10293084 3300025919 Bacteria 1290
461 Ga0207649_10046264 3300025920 Bacteria 2672
462 Ga0207649_10094244 3300025920 Bacteria 1967
463 Ga0207649_10337826 3300025920 Bacteria 1111
464 Ga0207649_10893965 3300025920 Bacteria 696
465 Ga0207652_10149358 3300025921 Bacteria 2092
466 Ga0207652_10192008 3300025921 Bacteria 1837
467 Ga0207652_10601995 3300025921 Unclassified 985
468 Ga0207646_10000371 3300025922 Bacteria 59994
469 Ga0207681_10263677 3300025923 Bacteria 1350
470 Ga0207681_10342077 3300025923 Bacteria 1195
471 Ga0207694_10394833 3300025924 Bacteria 1150
472 Ga0207694_10444961 3300025924 Bacteria 1081
473 Ga0207694_10608050 3300025924 Bacteria 919
474 Ga0207650_10523668 3300025925 Bacteria 992
475 Ga0207659_10021037 3300025926 Bacteria 4324
476 Ga0207659_10133716 3300025926 Bacteria 1918
477 Ga0207659_10143509 3300025926 Bacteria 1856
478 Ga0207659_10397553 3300025926 Bacteria 1152
479 Ga0207659_10490243 3300025926 Bacteria 1039
480 Ga0207687_10012420 3300025927 Bacteria 5564
481 Ga0207687_10085812 3300025927 Bacteria 2285
482 Ga0207687_10108012 3300025927 Bacteria 2060
483 Ga0207687_10133288 3300025927 Bacteria 1876
484 Ga0207687_10138016 3300025927 Bacteria 1846
485 Ga0207687_10184651 3300025927 Bacteria 1618
486 Ga0207687_10322555 3300025927 Bacteria 1251
487 Ga0207687_10682587 3300025927 Bacteria 871
488 Ga0207687_10686773 3300025927 Bacteria 868
489 Ga0207687_11011545 3300025927 Archaea 713
490 Ga0207700_10208321 3300025928 Bacteria 1651
491 Ga0207664_10360711 3300025929 Bacteria 1287
492 Ga0207644_10083311 3300025931 Bacteria 2368
493 Ga0207644_11108226 3300025931 Bacteria 665
494 Ga0207690_10077295 3300025932 Bacteria 2313
495 Ga0207690_10085152 3300025932 Bacteria 2218
496 Ga0207690_10106185 3300025932 Bacteria 2015
497 Ga0207690_10363845 3300025932 Bacteria 1146
498 Ga0207690_10731447 3300025932 Bacteria 815
499 Ga0207706_10006048 3300025933 Bacteria 11256
500 Ga0207706_10027149 3300025933 Bacteria 5121
501 Ga0207706_10117640 3300025933 Bacteria 2337
502 Ga0207706_10341074 3300025933 Bacteria 1303
503 Ga0207686_10048544 3300025934 Bacteria 2630
504 Ga0207686_10199040 3300025934 Bacteria 1433
505 Ga0207686_10222230 3300025934 Bacteria 1364
506 Ga0207686_10291750 3300025934 Bacteria 1208
507 Ga0207686_10327884 3300025934 Bacteria 1146
508 Ga0207686_10693909 3300025934 Bacteria 809
509 Ga0207686_10747661 3300025934 Bacteria 780
510 Ga0207686_11167262 3300025934 Bacteria 629
511 Ga0207709_10005915 3300025935 Bacteria 6901
512 Ga0207709_10023341 3300025935 Bacteria 3520
513 Ga0207709_10089416 3300025935 Bacteria 2008
514 Ga0207709_10140656 3300025935 Bacteria 1658
515 Ga0207709_10296268 3300025935 Bacteria 1201
516 Ga0207709_10930163 3300025935 Unclassified 708
517 Ga0207669_10018239 3300025937 Bacteria 3622
518 Ga0207669_10035642 3300025937 Bacteria 2834
519 Ga0207669_10082370 3300025937 Bacteria 2065
520 Ga0207669_10107322 3300025937 Bacteria 1862
521 Ga0207669_10581661 3300025937 Bacteria 908
522 Ga0207704_10010042 3300025938 Bacteria 4597
523 Ga0207704_10022947 3300025938 Bacteria 3354
524 Ga0207704_10075273 3300025938 Bacteria 2158
525 Ga0207704_10093357 3300025938 Bacteria 1983
526 Ga0207704_10106081 3300025938 Bacteria 1886
527 Ga0207665_10027352 3300025939 Bacteria 3768
528 Ga0207665_10683337 3300025939 Bacteria 806
529 Ga0207691_10012106 3300025940 Bacteria 8269
530 Ga0207691_10020746 3300025940 Bacteria 6212
531 Ga0207711_10071375 3300025941 Bacteria 3013
532 Ga0207711_10073998 3300025941 Bacteria 2962
533 Ga0207711_10342124 3300025941 Bacteria 1384
534 Ga0207711_10370784 3300025941 Bacteria 1327
535 Ga0207689_10510072 3300025942 Bacteria 1008
536 Ga0207689_10661583 3300025942 Bacteria 880
537 Ga0207689_10870371 3300025942 Bacteria 760
538 Ga0207689_11071065 3300025942 Bacteria 680
539 Ga0207661_10000400 3300025944 Bacteria 28071
540 Ga0207661_10001504 3300025944 Bacteria 15791
541 Ga0207661_10045319 3300025944 Bacteria 3480
542 Ga0207661_10057322 3300025944 Bacteria 3132
543 Ga0207661_10153477 3300025944 Bacteria 1992
544 Ga0207661_10230763 3300025944 Bacteria 1639
545 Ga0207661_10307900 3300025944 Unclassified 1421
546 Ga0207661_10308889 3300025944 Bacteria 1419
547 Ga0207661_10331093 3300025944 Bacteria 1371
548 Ga0207661_10394192 3300025944 Bacteria 1255
549 Ga0207661_10769699 3300025944 Bacteria 886
550 Ga0207661_10964535 3300025944 Bacteria 785
551 Ga0207661_11252104 3300025944 Bacteria 682
552 Ga0207679_10023009 3300025945 Bacteria 4253
553 Ga0207679_10183150 3300025945 Bacteria 1734
554 Ga0207679_11176588 3300025945 Bacteria 704
555 Ga0207667_10192884 3300025949 Bacteria 2090
556 Ga0207667_10215571 3300025949 Bacteria 1967
557 Ga0207667_10513440 3300025949 Bacteria 1214
558 Ga0207667_10547421 3300025949 Bacteria 1171
559 Ga0207667_11592184 3300025949 Bacteria 622
560 Ga0207712_10352720 3300025961 Bacteria 1224
561 Ga0207668_10064071 3300025972 Bacteria 2596
562 Ga0207668_10105540 3300025972 Bacteria 2103
563 Ga0207668_11106661 3300025972 Bacteria 710
564 Ga0207640_10043230 3300025981 Bacteria 2879
565 Ga0207640_10076778 3300025981 Bacteria 2269
566 Ga0207640_10092498 3300025981 Bacteria 2098
567 Ga0207658_10505242 3300025986 Bacteria 1077
568 Ga0207677_10071822 3300026023 Bacteria 2444
569 Ga0207677_10315707 3300026023 Bacteria 1297
570 Ga0207703_10183672 3300026035 Bacteria 1847
571 Ga0207703_11066225 3300026035 Bacteria 776
572 Ga0207639_10032742 3300026041 Bacteria 3829
573 Ga0207639_10077237 3300026041 Bacteria 2624
574 Ga0207639_10365310 3300026041 Bacteria 1292
575 Ga0207639_10397327 3300026041 Bacteria 1241
576 Ga0207678_10017335 3300026067 Bacteria 6322
577 Ga0207678_10317258 3300026067 Bacteria 1341
578 Ga0207708_10007363 3300026075 Bacteria 8133
579 Ga0207708_10030929 3300026075 Bacteria 4062
580 Ga0207708_10058257 3300026075 Bacteria 2947
581 Ga0207708_10327575 3300026075 Bacteria 1251
582 Ga0207708_10386165 3300026075 Bacteria 1155
583 Ga0207702_10021463 3300026078 Bacteria 5347
584 Ga0207702_10164360 3300026078 Bacteria 2029
585 Ga0207702_10352284 3300026078 Bacteria 1409
586 Ga0207702_10361894 3300026078 Bacteria 1391
587 Ga0207641_10368419 3300026088 Bacteria 1373
588 Ga0207641_11217483 3300026088 Bacteria 753
589 Ga0207648_10001155 3300026089 Bacteria 29566
590 Ga0207648_10084594 3300026089 Bacteria 2767
591 Ga0207648_10127528 3300026089 Bacteria 2238
592 Ga0207648_10294676 3300026089 Unclassified 1453
593 Ga0207676_10126455 3300026095 Bacteria 2165
594 Ga0207676_10284405 3300026095 Bacteria 1503
595 Ga0207674_10041905 3300026116 Bacteria 4732
596 Ga0207674_10385540 3300026116 Unclassified 1355
597 Ga0207674_11116331 3300026116 Unclassified 758
598 Ga0207675_100039062 3300026118 Bacteria 4429
599 Ga0207675_100108178 3300026118 Bacteria 2622
600 Ga0207675_100673689 3300026118 Bacteria 1042
601 Ga0207683_10001368 3300026121 Bacteria 22057
602 Ga0207683_10028085 3300026121 Bacteria 4865
603 Ga0207683_10071199 3300026121 Bacteria 3073
604 Ga0207683_10082690 3300026121 Bacteria 2853
605 Ga0207683_10144814 3300026121 Bacteria 2142
606 Ga0207683_10383886 3300026121 Bacteria 1291
607 Ga0207683_10725849 3300026121 Bacteria 921
608 Ga0207683_11095619 3300026121 Bacteria 739
609 Ga0207683_11296415 3300026121 Bacteria 674
610 Ga0207698_10025256 3300026142 Bacteria 4182
611 Ga0207698_10039363 3300026142 Bacteria 3502
612 Ga0207698_10225989 3300026142 Bacteria 1695
613 Ga0207428_10000104 3300027907 Bacteria 116036
614 Ga0207428_10014814 3300027907 Bacteria 6754
615 Ga0207428_10036344 3300027907 Bacteria 4018
616 Ga0207428_10058751 3300027907 Bacteria 3051
617 Ga0207428_10081818 3300027907 Bacteria 2521
618 Ga0268266_10097009 3300028379 Bacteria 2592
619 Ga0268266_10682479 3300028379 Bacteria 989
620 Ga0268266_11326520 3300028379 Bacteria 695
621 Ga0268265_11059754 3300028380 Bacteria 803
622 Ga0268265_11125818 3300028380 Unclassified 780
623 Ga0265319_1157582 3300028563 Bacteria 702
624 Ga0265338_10040350 3300028800 Bacteria 4386
625 Ga0265320_10038208 3300031240 Bacteria 2411
626 Ga0307405_10491583 3300031731 Bacteria 982
627 Ga0307416_100318555 3300032002 Bacteria 1556
628 Ga0307415_100384176 3300032126 Bacteria 1193
629 Ga0373938_0051382 3300034957 Bacteria 943
630 Ga0373928_0012834 3300035084 Bacteria 1676
631 Ga0373928_0037916 3300035084 Bacteria 1095
632 Ga0373929_0002704 3300035085 Bacteria 3239
633 Ga0373934_0080054 3300035086 Bacteria 1312
634 Ga0373951_0003373 3300035091 Bacteria 3893
635 Ga0373932_0018558 3300035112 Bacteria 1800
636 Ga0373936_0053726 3300035113 Bacteria 1634
637 Ga0373945_0081818 3300035116 Bacteria 1238
638 Ga0373956_0028383 3300035119 Bacteria 2435
639 Ga0373960_0017029 3300035121 Bacteria 1877
640 Ga0373943_0004585 3300035170 Bacteria 6243
641 Ga0373943_0178015 3300035170 Bacteria 1167
642 Ga0373946_0002729 3300035171 Bacteria 6241
643 Ga0373946_0118303 3300035171 Bacteria 1207
644 Ga0373942_0012882 3300035207 Bacteria 2004
645 Ga0373931_0020831 3300035691 Bacteria 3283
646 Ga0373931_0105519 3300035691 Bacteria 1591
647 Ga0373931_0378200 3300035691 Unclassified 892
648 Ga0373935_0070061 3300035692 Bacteria 2260
649 Ga0373935_0519477 3300035692 Bacteria 866
650 Ga0373947_0002186 3300035725 Bacteria 11857
651 Ga0373947_0002329 3300035725 Bacteria 11488
652 Ga0373937_0000107 3300036401 Bacteria 79333
653 Ga0373925_0008600 3300037068 Bacteria 7438
654 Ga0373925_0022467 3300037068 Bacteria 4600
655 Ga0395899_0027247 3300037312 Bacteria 4309
656 Ga0395899_0056713 3300037312 Bacteria 2894
657 Ga0395899_0134020 3300037312 Bacteria 1767
658 Ga0395899_0332480 3300037312 Bacteria 1021
659 Ga0395900_0005659 3300037418 Bacteria 13066
660 Ga0395900_0039282 3300037418 Bacteria 4875
661 Ga0395900_0360969 3300037418 Bacteria 1424
662 Ga0395900_0401138 3300037418 Bacteria 1335
663 Ga0395900_0465795 3300037418 Bacteria 1218
664 Ga0395898_0118417 3300037466 Bacteria 2537
665 Ga0395898_0118828 3300037466 Bacteria 2532
666 Ga0395898_0443953 3300037466 Bacteria 1236
667 Ga0395898_0456511 3300037466 Bacteria 1216
668 Ga0395898_0730065 3300037466 Bacteria 932
669 Ga0395898_0997116 3300037466 Unclassified 773
670 Ga0395905_0063928 3300037471 Bacteria 3443
671 Ga0395905_0070232 3300037471 Bacteria 3281
672 Ga0395905_0164971 3300037471 Bacteria 2081
673 Ga0395905_0370196 3300037471 Bacteria 1326
674 Ga0395905_0413104 3300037471 Bacteria 1245
675 Ga0395905_0535275 3300037471 Bacteria 1072
676 Ga0395901_0000904 3300038443 Bacteria 32610
677 Ga0395901_0037785 3300038443 Bacteria 4993
678 Ga0395901_0112527 3300038443 Bacteria 2859
679 Ga0395901_0136416 3300038443 Bacteria 2578
680 Ga0395901_0316153 3300038443 Bacteria 1616
681 Ga0395901_0743655 3300038443 Bacteria 974
682 Ga0395901_1601125 3300038443 Bacteria 605
683 Ga0439436_0032405 3300041404 Bacteria 1515
684 Ga0439439_0012614 3300041406 Bacteria 2045
685 Ga0451793_0221238 3300041452 Bacteria 1141
686 Ga0451853_0598836 3300041512 Bacteria 2172
687 Ga0451853_2862716 3300041512 Bacteria 801
688 Ga0439433_0001393 3300041999 Bacteria 4966
689 Ga0439437_017806 3300042000 Bacteria 846
690 Ga0439442_033676 3300042002 Bacteria 1071
691 Ga0439448_0084263 3300042005 Bacteria 1070
692 Ga0439449_0028363 3300042007 Bacteria 2087
693 Ga0439450_021016 3300042008 Bacteria 1398
694 Ga0439451_001707 3300042009 Bacteria 4377
695 Ga0439454_067487 3300042011 Bacteria 630
696 Ga0439462_0006260 3300042015 Bacteria 2954
697 Ga0439446_0001540 3300042156 Bacteria 5289
698 Ga0439446_0004290 3300042156 Bacteria 3605
699 Ga0439434_0010858 3300042435 Bacteria 2689
700 Ga0439434_0042199 3300042435 Bacteria 1402
701 Ga0466969_0004681 3300044656 Bacteria 7289
702 Ga0466969_0328705 3300044656 Bacteria 692
703 Ga0466965_0030583 3300044683 Bacteria 2624
704 Ga0466966_0011395 3300044684 Bacteria 5897
705 Ga0466966_0090554 3300044684 Bacteria 1899
706 Ga0466961_0005030 3300044693 Bacteria 8315
707 Ga0466961_0014159 3300044693 Bacteria 5117
708 Ga0466963_0004897 3300044694 Bacteria 7808
709 Ga0466963_0041040 3300044694 Bacteria 3033
710 Ga0466963_0049382 3300044694 Bacteria 2782
711 Ga0466963_0126306 3300044694 Bacteria 1763
712 Ga0466963_0221403 3300044694 Bacteria 1325
713 Ga0466963_0339622 3300044694 Bacteria 1057
714 Ga0466963_0640005 3300044694 Archaea 751
715 Ga0466964_0001421 3300044706 Bacteria 8171
716 Ga0466971_0000768 3300044719 Bacteria 12889
717 Ga0466971_0006213 3300044719 Bacteria 5192
718 Ga0466970_0144565 3300044765 Bacteria 1311
719 Ga0466957_0005752 3300044842 Bacteria 6964
720 Ga0466957_0044589 3300044842 Bacteria 2687
721 Ga0466957_0451197 3300044842 Bacteria 886
722 Ga0466957_0602604 3300044842 Archaea 769
723 Ga0466959_0004630 3300045049 Bacteria 9248
724 Ga0466959_0257965 3300045049 Bacteria 1200
725 Ga0466958_0006279 3300045836 Bacteria 6456
726 Ga0466958_0019366 3300045836 Bacteria 3961
727 Ga0466958_0161079 3300045836 Bacteria 1417
728 Ga0466967_0005862 3300045976 Bacteria 8597
729 Ga0466967_0012698 3300045976 Bacteria 6463
730 Ga0466967_0017608 3300045976 Bacteria 5680
731 Ga0466967_0027407 3300045976 Bacteria 4739
732 Ga0466967_0054062 3300045976 Bacteria 3532
733 Ga0466967_0109005 3300045976 Bacteria 2541
734 Ga0495592_0000089 3300046454 Bacteria 80990
735 Ga0495603_0002404 3300046455 Bacteria 11005
736 Ga0495603_0016845 3300046455 Bacteria 4422
737 Ga0495603_0038673 3300046455 Bacteria 2861
738 Ga0495603_0564792 3300046455 Bacteria 651
739 Ga0495603_0657930 3300046455 Bacteria 599
740 Ga0495629_0119635 3300046459 Bacteria 1835
741 Ga0495629_0332740 3300046459 Bacteria 1037
742 Ga0495641_0002430 3300046461 Bacteria 14716
743 Ga0495641_0138364 3300046461 Bacteria 1087
744 Ga0495651_0000057 3300046462 Bacteria 82943
745 Ga0495651_0314617 3300046462 Bacteria 1046
746 Ga0495653_0028354 3300046463 Bacteria 4476
747 Ga0495653_0072567 3300046463 Bacteria 2570
748 Ga0495582_0024097 3300046473 Bacteria 3328
749 Ga0495582_0079585 3300046473 Bacteria 1819
750 Ga0495582_0215921 3300046473 Bacteria 1097
751 Ga0495582_0222962 3300046473 Bacteria 1079
752 Ga0495605_0217372 3300046474 Unclassified 827
753 Ga0495639_0004511 3300046475 Bacteria 5973
754 Ga0495662_0255175 3300046476 Unclassified 863
755 Ga0495584_0315172 3300046491 Bacteria 794
756 Ga0495584_0432491 3300046491 Bacteria 669
757 Ga0495594_0001407 3300046499 Bacteria 12492
758 Ga0495594_0054381 3300046499 Bacteria 2206
759 Ga0495594_0060162 3300046499 Bacteria 2101
760 Ga0495596_0110667 3300046500 Bacteria 1067
761 Ga0495608_0002880 3300046511 Bacteria 12324
762 Ga0495608_0327686 3300046511 Bacteria 945
763 Ga0495616_0104136 3300046513 Bacteria 1327
764 Ga0495618_0137110 3300046514 Bacteria 1565
765 Ga0495618_0367806 3300046514 Bacteria 884
766 Ga0495628_0000066 3300046516 Bacteria 85699
767 Ga0495630_0341511 3300046517 Bacteria 1146
768 Ga0495630_0453667 3300046517 Bacteria 983
769 Ga0495644_0078581 3300046523 Bacteria 1243
770 Ga0495663_0250864 3300046525 Archaea 628
771 Ga0495642_0116086 3300046528 Bacteria 1147
772 Ga0495652_0000118 3300046529 Bacteria 85706
773 Ga0495652_0907627 3300046529 Unclassified 581
774 Ga0495665_0026926 3300046531 Bacteria 3087
775 Ga0495587_0000096 3300046536 Bacteria 68520
776 Ga0495598_0054577 3300046537 Bacteria 1214
777 Ga0495609_0228987 3300046538 Bacteria 770
778 Ga0495645_0000052 3300046543 Bacteria 86470
779 Ga0495633_0388066 3300046558 Archaea 632
780 Ga0495667_0394618 3300046559 Bacteria 872
781 Ga0495656_0137837 3300046615 Bacteria 1167
782 Ga0495656_0197163 3300046615 Bacteria 997
783 Ga0495656_0211048 3300046615 Bacteria 967
784 Ga0495668_0266921 3300046616 Unclassified 937
785 Ga0495668_0494276 3300046616 Bacteria 674
786 Ga0495634_0106206 3300046642 Bacteria 1810
787 Ga0495634_0119858 3300046642 Bacteria 1685
788 Ga0495659_0042279 3300046664 Bacteria 1631
789 Ga0495588_0000537 3300046674 Bacteria 18303
790 Ga0495588_0078247 3300046674 Bacteria 1725
791 Ga0495657_0084489 3300046675 Bacteria 2047
792 Ga0495599_0000046 3300046678 Bacteria 85727
793 Ga0495623_0000061 3300046679 Bacteria 67279
794 Ga0495647_0022214 3300046681 Unclassified 2291
795 Ga0495647_0028454 3300046681 Bacteria 2061
796 Ga0495647_0043763 3300046681 Bacteria 1715
797 Ga0495647_0118600 3300046681 Bacteria 1111
798 Ga0495658_0008228 3300046683 Bacteria 5167
799 Ga0495658_0062724 3300046683 Bacteria 2137
800 Ga0495658_0103844 3300046683 Bacteria 1700
801 Ga0495658_0466230 3300046683 Unclassified 807
802 Ga0495613_0062181 3300046689 Bacteria 2733
803 Ga0495613_0127887 3300046689 Bacteria 1821
804 Ga0495624_0056812 3300046690 Bacteria 2462
805 Ga0495624_0524635 3300046690 Bacteria 708
806 Ga0495670_0260281 3300046691 Bacteria 926
807 Ga0495589_0060698 3300046794 Bacteria 1857
808 Ga0495581_0022119 3300047315 Bacteria 3684
809 Ga0495581_0028818 3300047315 Bacteria 3219
810 Ga0495604_0000075 3300047317 Bacteria 85370
811 Ga0495676_0003263 3300047321 Bacteria 14659
812 Ga0495676_0039225 3300047321 Bacteria 3925
813 Ga0495676_0364282 3300047321 Bacteria 964
814 Ga0495680_0013423 3300047322 Bacteria 7148
815 Ga0495675_0000089 3300047444 Bacteria 64853
816 Ga0495677_0068840 3300047445 Bacteria 1318
817 Ga0495679_083981 3300047446 Bacteria 901
818 Ga0495602_0000140 3300048088 Bacteria 68037
819 Ga0495614_0046979 3300048089 Bacteria 1851
820 Ga0496100_0026516 3300048903 Bacteria 3554
821 Ga0496100_0054076 3300048903 Bacteria 2617
822 Ga0496100_0086727 3300048903 Bacteria 2127
823 Ga0496100_0120442 3300048903 Bacteria 1835
824 Ga0496100_0130199 3300048903 Bacteria 1771
825 Ga0496100_0215854 3300048903 Bacteria 1406
826 Ga0496100_0286468 3300048903 Bacteria 1229
827 Ga0496100_0486834 3300048903 Bacteria 949
828 Ga0496100_1036887 3300048903 Bacteria 646
829 Ga0496100_1159414 3300048903 Bacteria 609
830 Ga0496101_0036240 3300048904 Bacteria 3493
831 Ga0496101_0080064 3300048904 Bacteria 2412
832 Ga0496101_0095325 3300048904 Bacteria 2219
833 Ga0496101_0194165 3300048904 Bacteria 1567
834 Ga0496101_0197157 3300048904 Bacteria 1556
835 Ga0496101_0262766 3300048904 Bacteria 1346
836 Ga0496101_0264364 3300048904 Bacteria 1342
837 Ga0496101_0279652 3300048904 Bacteria 1304
838 Ga0496101_0444790 3300048904 Unclassified 1022
839 Ga0496101_0606522 3300048904 Bacteria 865
840 Ga0496102_0001619 3300048905 Bacteria 19836
841 Ga0496102_0013494 3300048905 Bacteria 7077
842 Ga0496102_0043574 3300048905 Bacteria 4070
843 Ga0496102_0145421 3300048905 Bacteria 2225
844 Ga0496102_0165137 3300048905 Bacteria 2083
845 Ga0496102_0295843 3300048905 Bacteria 1526
846 Ga0496102_0330262 3300048905 Bacteria 1436
847 Ga0496102_0341745 3300048905 Bacteria 1409
848 Ga0496102_1166362 3300048905 Bacteria 690
849 Ga0496103_0001460 3300048906 Bacteria 15825
850 Ga0496103_0065986 3300048906 Bacteria 2259
851 Ga0496103_0080681 3300048906 Bacteria 2046
852 Ga0496103_0120652 3300048906 Bacteria 1670
853 Ga0496103_0328935 3300048906 Bacteria 983
854 Ga0496103_0439962 3300048906 Bacteria 836
855 Ga0496103_0508007 3300048906 Unclassified 771
856 Ga0496103_0577906 3300048906 Bacteria 716
857 Ga0496104_0009894 3300048907 Bacteria 8513
858 Ga0496104_0052779 3300048907 Bacteria 3840
859 Ga0496104_0062319 3300048907 Bacteria 3536
860 Ga0496104_0114998 3300048907 Bacteria 2581
861 Ga0496104_0201091 3300048907 Bacteria 1904
862 Ga0496104_0225117 3300048907 Bacteria 1788
863 Ga0496104_0316886 3300048907 Bacteria 1473
864 Ga0496104_0783256 3300048907 Bacteria 860
865 Ga0496105_0008640 3300048908 Bacteria 7920
866 Ga0496105_0034180 3300048908 Bacteria 4180
867 Ga0496105_0073616 3300048908 Bacteria 2822
868 Ga0496105_0113873 3300048908 Bacteria 2231
869 Ga0496105_0138118 3300048908 Bacteria 2007
870 Ga0496105_0210771 3300048908 Bacteria 1584
871 Ga0496105_0464371 3300048908 Bacteria 998
872 Ga0496106_0029799 3300048909 Bacteria 4068
873 Ga0496106_0109176 3300048909 Bacteria 2153
874 Ga0496106_0205076 3300048909 Bacteria 1570
875 Ga0496107_0011180 3300048910 Bacteria 6249
876 Ga0496107_0013676 3300048910 Bacteria 5675
877 Ga0496107_0150306 3300048910 Bacteria 1722
878 Ga0496107_0152424 3300048910 Bacteria 1710
879 Ga0496107_0187471 3300048910 Bacteria 1536
880 Ga0496107_0274623 3300048910 Bacteria 1254
881 Ga0496108_0002875 3300048911 Bacteria 13812
882 Ga0496108_0030921 3300048911 Bacteria 4438
883 Ga0496108_0040203 3300048911 Bacteria 3897
884 Ga0496108_0075844 3300048911 Bacteria 2841
885 Ga0496108_0235070 3300048911 Bacteria 1594
886 Ga0496108_0368577 3300048911 Bacteria 1254
887 Ga0496108_0678203 3300048911 Bacteria 895
888 Ga0496109_0000954 3300048912 Bacteria 23913
889 Ga0496109_0008233 3300048912 Bacteria 8851
890 Ga0496109_0017433 3300048912 Bacteria 6296
891 Ga0496109_0151250 3300048912 Bacteria 2173
892 Ga0496109_0159293 3300048912 Bacteria 2115
893 Ga0496109_0236077 3300048912 Bacteria 1720
894 Ga0496109_0268766 3300048912 Bacteria 1606
895 Ga0496109_0438853 3300048912 Bacteria 1233
896 Ga0496110_0001816 3300048913 Bacteria 15730
897 Ga0496110_0013023 3300048913 Bacteria 6861
898 Ga0496110_0020582 3300048913 Bacteria 5572
899 Ga0496110_0249246 3300048913 Bacteria 1616
900 Ga0496110_0409429 3300048913 Bacteria 1236
901 Ga0496110_0657013 3300048913 Bacteria 948
902 Ga0496110_0919741 3300048913 Bacteria 781
903 Ga0496110_1084653 3300048913 Bacteria 709
904 Ga0496111_0003517 3300048914 Bacteria 9693
905 Ga0496111_0038137 3300048914 Bacteria 3442
906 Ga0496111_0057286 3300048914 Bacteria 2821
907 Ga0496111_0313834 3300048914 Bacteria 1161
908 Ga0496111_0340451 3300048914 Bacteria 1110
909 Ga0496112_0000293 3300048915 Bacteria 32490
910 Ga0496112_0028386 3300048915 Bacteria 5400
911 Ga0496112_0051790 3300048915 Bacteria 4027
912 Ga0496112_0077211 3300048915 Bacteria 3294
913 Ga0496112_0476246 3300048915 Bacteria 1185
914 Ga0496113_0008471 3300048916 Bacteria 6701
915 Ga0496113_0020678 3300048916 Bacteria 4633
916 Ga0496113_0091498 3300048916 Bacteria 2345
917 Ga0496113_0100291 3300048916 Bacteria 2243
918 Ga0496113_0104717 3300048916 Bacteria 2196
919 Ga0496113_0368894 3300048916 Bacteria 1152
920 Ga0496113_0526946 3300048916 Bacteria 948
921 Ga0496114_0042927 3300048917 Bacteria 3749
922 Ga0496114_0071351 3300048917 Bacteria 2919
923 Ga0496114_0079020 3300048917 Bacteria 2776
924 Ga0496114_0094330 3300048917 Bacteria 2545
925 Ga0496114_0177951 3300048917 Bacteria 1856
926 Ga0496114_0311809 3300048917 Bacteria 1390
927 Ga0496114_0328665 3300048917 Bacteria 1351
928 Ga0496114_0426136 3300048917 Bacteria 1175
929 Ga0496114_0495719 3300048917 Bacteria 1080
930 Ga0496114_0705014 3300048917 Bacteria 885
931 Ga0496115_0005787 3300048918 Bacteria 9000
932 Ga0496115_0011507 3300048918 Bacteria 6634
933 Ga0496115_0018951 3300048918 Bacteria 5293
934 Ga0496115_0041527 3300048918 Bacteria 3661
935 Ga0496115_0417631 3300048918 Bacteria 1087
936 Ga0501031_0031652 3300049568 Bacteria 3451
937 Ga0501031_0086672 3300049568 Bacteria 2042
938 Ga0501032_0206415 3300049569 Bacteria 1282
939 Ga0501033_0128216 3300049570 Bacteria 1839
940 Ga0501034_0012275 3300049571 Bacteria 8854
941 Ga0501034_0500596 3300049571 Bacteria 1129
942 Ga0501036_0480183 3300049572 Bacteria 1035
943 Ga0501037_0250529 3300049573 Bacteria 1239
944 Ga0501037_0521122 3300049573 Bacteria 805
945 Ga0501038_0059683 3300049574 Bacteria 3266
946 Ga0501038_0132762 3300049574 Bacteria 2042
947 Ga0501038_0300939 3300049574 Bacteria 1259
948 Ga0501038_0389313 3300049574 Bacteria 1080
949 Ga0501039_0093273 3300049575 Unclassified 2346
950 Ga0501039_0256231 3300049575 Bacteria 1375
951 Ga0501039_0788160 3300049575 Bacteria 742
952 Ga0501040_0023239 3300049576 Bacteria 4156
953 Ga0501040_0025213 3300049576 Bacteria 3998
954 Ga0501040_0046978 3300049576 Bacteria 2947
955 Ga0501040_0550869 3300049576 Bacteria 832
956 Ga0501041_0039904 3300049577 Bacteria 2848
957 Ga0501041_0093474 3300049577 Bacteria 1857
958 Ga0501041_0238002 3300049577 Bacteria 1144
959 Ga0501041_0415644 3300049577 Bacteria 853
960 Ga0501042_0037252 3300049578 Bacteria 3452
961 Ga0501042_0097356 3300049578 Bacteria 2114
962 Ga0501042_0133879 3300049578 Bacteria 1787
963 Ga0501042_0452867 3300049578 Bacteria 931
964 Ga0501043_0065071 3300049579 Bacteria 2863
965 Ga0501043_0443932 3300049579 Bacteria 976
966 Ga0501046_0069719 3300049580 Bacteria 2735
967 Ga0501046_0104361 3300049580 Bacteria 2172
968 Ga0501046_0106806 3300049580 Bacteria 2142
969 Ga0501048_0028573 3300049582 Bacteria 4048
970 Ga0501048_0029137 3300049582 Bacteria 4005
971 Ga0501048_0890904 3300049582 Bacteria 640
972 Ga0501068_0108540 3300049584 Bacteria 1724
973 Ga0501068_0727162 3300049584 Bacteria 649
974 Ga0501069_0315979 3300049585 Unclassified 917
975 Ga0501069_0662638 3300049585 Bacteria 628
976 Ga0501070_0035068 3300049586 Bacteria 4193
977 Ga0501071_0063220 3300049587 Bacteria 2683
978 Ga0501071_0064700 3300049587 Bacteria 2653
979 Ga0501071_0086068 3300049587 Bacteria 2305
980 Ga0501071_0140932 3300049587 Bacteria 1795
981 Ga0501071_0370092 3300049587 Bacteria 1092
982 Ga0501072_0001406 3300049588 Bacteria 18115
983 Ga0501072_0027847 3300049588 Bacteria 4409
984 Ga0501072_0139224 3300049588 Bacteria 1935
985 Ga0501072_0161624 3300049588 Bacteria 1787
986 Ga0501072_0503857 3300049588 Bacteria 958
987 Ga0501072_0605598 3300049588 Bacteria 863
988 Ga0501073_0094635 3300049589 Bacteria 2075
989 Ga0501074_0042398 3300049590 Bacteria 3293
990 Ga0501074_0050253 3300049590 Bacteria 3010
991 Ga0501074_0079091 3300049590 Bacteria 2359
992 Ga0501074_0265539 3300049590 Bacteria 1220
993 Ga0501074_0747837 3300049590 Bacteria 689
994 Ga0501075_0016117 3300049591 Bacteria 5378
995 Ga0501075_0050018 3300049591 Bacteria 3141
996 Ga0501075_0063124 3300049591 Bacteria 2793
997 Ga0501075_0075716 3300049591 Bacteria 2545
998 Ga0501075_0522474 3300049591 Bacteria 906
999 Ga0501076_0008719 3300049592 Bacteria 7447
1000 Ga0501076_0015983 3300049592 Bacteria 5681
1001 Ga0501076_0068957 3300049592 Bacteria 2825
1002 Ga0501076_0076520 3300049592 Bacteria 2684
1003 Ga0501076_0250841 3300049592 Bacteria 1448
1004 Ga0501076_0282987 3300049592 Bacteria 1358
1005 Ga0501077_0003452 3300049593 Bacteria 9487
1006 Ga0501077_0024418 3300049593 Bacteria 3839
1007 Ga0501077_0046480 3300049593 Bacteria 2757
1008 Ga0501077_0515432 3300049593 Bacteria 767
1009 Ga0501216_097487 3300049660 Bacteria 644
1010 Ga0501079_0049513 3300049741 Bacteria 3243
1011 Ga0501079_0050704 3300049741 Bacteria 3203
1012 Ga0501079_0143395 3300049741 Bacteria 1861
1013 Ga0501079_0482033 3300049741 Bacteria 975
1014 Ga0501079_0583577 3300049741 Bacteria 879
1015 Ga0501079_0757753 3300049741 Bacteria 764
1016 Ga0501080_0003102 3300049742 Bacteria 14670
1017 Ga0501080_0014392 3300049742 Bacteria 7286
1018 Ga0501080_0019569 3300049742 Bacteria 6272
1019 Ga0501080_0601551 3300049742 Bacteria 976
1020 Ga0501080_1030443 3300049742 Bacteria 713
1021 Ga0501081_0058946 3300049743 Bacteria 2657
1022 Ga0501081_0076627 3300049743 Bacteria 2335
1023 Ga0501081_0115374 3300049743 Bacteria 1909
1024 Ga0501081_0260651 3300049743 Bacteria 1267
1025 Ga0501081_0755045 3300049743 Bacteria 731
1026 Ga0501083_0072558 3300049744 Bacteria 2288
1027 Ga0501083_0075522 3300049744 Bacteria 2238
1028 Ga0501035_0020176 3300049822 Bacteria 6121
1029 Ga0501035_0110887 3300049822 Bacteria 2405
1030 Ga0501044_0400982 3300049823 Unclassified 1284
1031 Ga0501045_0085690 3300049824 Bacteria 2325
1032 Ga0501045_0097721 3300049824 Bacteria 2172
1033 nmdc:mga0yw44_502155_c1 3300050492 Bacteria 823
1034 nmdc:mga05p37_160234_c1 3300050507 Bacteria 2749
1035 nmdc:mga05p37_247498_c1 3300050507 Bacteria 2140
1036 nmdc:mga05p37_713479_c1 3300050507 Bacteria 1112
1037 nmdc:mga09592_57341_c1 3300050508 Bacteria 3292
1038 nmdc:mga09592_80779_c1 3300050508 Bacteria 2769
1039 nmdc:mga0qj67_204564_c1 3300050509 Bacteria 1604
1040 nmdc:mga06r32_540672_c1 3300050510 Bacteria 1140
1041 nmdc:mga08y16_100400_c1 3300050511 Bacteria 3013
1042 nmdc:mga08y16_65697_c1 3300050511 Bacteria 3787
1043 nmdc:mga08y16_68549_c1 3300050511 Bacteria 3699
1044 nmdc:mga08y16_86703_c1 3300050511 Bacteria 3263
1045 nmdc:mga0n895_1183861_c1 3300050512 Unclassified 739
1046 nmdc:mga0n895_15149_c1 3300050512 Bacteria 7026
1047 nmdc:mga0n895_639846_c1 3300050512 Bacteria 1063
1048 nmdc:mga0n895_96856_c1 3300050512 Bacteria 2956
1049 nmdc:mga0rr50_55781_c1 3300050513 Bacteria 2949
1050 nmdc:mga0rr50_592323_c1 3300050513 Bacteria 945
1051 nmdc:mga08x19_12257_c1 3300050514 Bacteria 5161
1052 nmdc:mga08x19_99535_c1 3300050514 Bacteria 1928
1053 nmdc:mga0a205_113983_c1 3300050515 Bacteria 2602
1054 nmdc:mga0a205_246783_c1 3300050515 Bacteria 1666
1055 Ga0495601_0000273 3300053077 Bacteria 28075
1056 Ga0495601_0351130 3300053077 Bacteria 959
1057 Ga0495612_0091343 3300053078 Bacteria 1289
1058 Ga0495655_0133444 3300053083 Bacteria 767
1059 Ga0495595_0016131 3300053084 Bacteria 3191
1060 Ga0495595_0119272 3300053084 Bacteria 1284
1061 Ga0495619_0000123 3300053085 Bacteria 57052
1062 Ga0495619_0064465 3300053085 Bacteria 2443
1063 Ga0495619_0334442 3300053085 Bacteria 1048
1064 Ga0501084_0002565 3300054114 Bacteria 14640
1065 Ga0501084_0029462 3300054114 Bacteria 4592
1066 Ga0501084_0032747 3300054114 Bacteria 4349
1067 Ga0501084_0049299 3300054114 Bacteria 3525
1068 Ga0501084_0160722 3300054114 Bacteria 1895
1069 Ga0501084_0217161 3300054114 Bacteria 1613
1070 Ga0501084_0661911 3300054114 Bacteria 881
1071 Ga0501084_0786383 3300054114 Bacteria 802
1072 Ga0501084_0872458 3300054114 Bacteria 757
1073 Ga0501082_0019671 3300060353 Bacteria 5821
1074 Ga0501082_0077187 3300060353 Bacteria 2872
1075 Ga0501082_0377151 3300060353 Bacteria 1237
1076 Ga0501082_0512355 3300060353 Bacteria 1049
1077 Ga0501082_0529948 3300060353 Bacteria 1030
1078 Ga0501082_0765836 3300060353 Bacteria 845
1079 Ga0466962_0002035 3300061719 Bacteria 9553
1080 Ga0530510_0034871 3300061734 Bacteria 3625
1081 Ga0530510_0097496 3300061734 Bacteria 2149
1082 Ga0530510_0437648 3300061734 Bacteria 988
1083 Ga0495656_0021620
1084 JGI24743J22301_10005572
1085 JGI24743J22301_10005797
1086 JGI24738J21930_10009489
1087 JGI24744J21845_10025107
1088 JGI25406J46586_10058983
1089 Ga0070658_10060765
1090 Ga0070676_10110270
1091 Ga0070676_10151395
1092 Ga0070683_100011303
1093 Ga0070683_100040724
1094 Ga0070683_100046543
1095 Ga0070683_100172406
1096 Ga0070683_100336611
1097 Ga0070683_100339387
1098 Ga0070683_100416911
1099 Ga0070683_100557046
1100 Ga0070683_100574285
1101 Ga0070683_100946830
1102 Ga0070683_101239251
1103 Ga0070690_100042356
1104 Ga0070690_100301834
1105 Ga0068869_100054245
1106 Ga0068869_100570088
1107 Ga0070666_10064420
1108 Ga0070666_10206516
1109 Ga0070680_100005620
1110 Ga0070680_100278091
1111 Ga0070680_100736198
1112 Ga0070680_101046726
1113 Ga0070682_100002331
1114 Ga0070682_100097901
1115 Ga0070682_100144941
1116 Ga0070682_100241964
1117 Ga0068868_100015257
1118 Ga0068868_100045658
1119 Ga0068868_100588169
1120 Ga0068868_100843686
1121 Ga0068868_100963878
1122 Ga0070660_100003396
1123 Ga0070660_100004253
1124 Ga0070660_100056168
1125 Ga0070660_100182606
1126 Ga0070660_100221565
1127 Ga0070660_100389315
1128 Ga0070689_100011564
1129 Ga0070689_100181284
1130 Ga0070691_10059656
1131 Ga0070687_100178765
1132 Ga0070687_100251142
1133 Ga0070687_100434785
1134 Ga0070687_100859644
1135 Ga0070661_100057489
1136 Ga0070661_100094629
1137 Ga0070661_100335969
1138 Ga0070661_100364852
1139 Ga0070661_100586610
1140 Ga0070692_10003563
1141 Ga0070692_10037837
1142 Ga0070692_10069093
1143 Ga0070668_100013432
1144 Ga0070668_100674835
1145 Ga0070668_100949297
1146 Ga0070668_101203109
1147 Ga0070675_100008011
1148 Ga0070675_100036827
1149 Ga0070675_100151229
1150 Ga0070675_100321560
1151 Ga0070675_100709369
1152 Ga0070675_100919193
1153 Ga0070671_100021637
1154 Ga0070671_100048075
1155 Ga0070671_100318560
1156 Ga0070671_100453384
1157 Ga0070674_100050635
1158 Ga0070674_100062552
1159 Ga0070674_100142539
1160 Ga0070674_100567374
1161 Ga0070674_100745649
1162 Ga0070673_100036337
1163 Ga0070673_101264652
1164 Ga0070688_100001743
1165 Ga0070688_100155261
1166 Ga0070688_100794852
1167 Ga0070659_100014966
1168 Ga0070659_100023401
1169 Ga0070659_100050901
1170 Ga0070659_100133099
1171 Ga0070667_100044216
1172 Ga0070667_100340500
1173 Ga0070667_101017664
1174 Ga0070703_10005248
1175 Ga0070709_10009858
1176 Ga0070709_10312376
1177 Ga0070714_100393538
1178 Ga0070714_100520108
1179 Ga0070713_100055508
1180 Ga0070710_10005240
1181 Ga0070710_10117159
1182 Ga0070701_10005453
1183 Ga0070701_10006793
1184 Ga0070711_100135244
1185 Ga0070711_100200624
1186 Ga0070711_100288713
1187 Ga0070705_100009369
1188 Ga0070705_100017042
1189 Ga0070705_100026272
1190 Ga0070705_100304779
1191 Ga0070700_100036094
1192 Ga0070700_100225102
1193 Ga0070700_100236296
1194 Ga0070700_100427417
1195 Ga0070700_100552378
1196 Ga0070700_100571323
1197 Ga0070700_100586827
1198 Ga0070700_100595831
1199 Ga0070700_100985164
1200 Ga0070694_100013842
1201 Ga0070694_100090801
1202 Ga0070694_100751029
1203 Ga0070663_100437513
1204 Ga0070663_100517069
1205 Ga0070678_100012221
1206 Ga0070678_100237344
1207 Ga0070678_100313838
1208 Ga0070678_100317990
1209 Ga0070678_100338260
1210 Ga0070678_100347777
1211 Ga0070678_101013739
1212 Ga0070662_100016137
1213 Ga0070662_100017748
1214 Ga0070662_100048961
1215 Ga0070662_100901306
1216 Ga0070681_10009307
1217 Ga0070681_10022112
1218 Ga0070681_10062368
1219 Ga0070681_10177554
1220 Ga0070681_10264879
1221 Ga0068867_100011424
1222 Ga0068867_100047753
1223 Ga0068867_100236631
1224 Ga0068867_100985105
1225 Ga0070685_10000906
1226 Ga0070685_10007842
1227 Ga0070685_10126548
1228 Ga0070706_100031877
1229 Ga0070707_100000570
1230 Ga0070707_100096210
1231 Ga0070699_100030146
1232 Ga0070699_100388923
1233 Ga0070679_100010388
1234 Ga0070679_100020579
1235 Ga0070679_100023275
1236 Ga0070679_100243505
1237 Ga0070679_100288463
1238 Ga0070679_101066196
1239 Ga0070679_101176687
1240 Ga0070684_100000634
1241 Ga0070684_100011665
1242 Ga0070684_100024133
1243 Ga0070684_100029406
1244 Ga0070684_100198038
1245 Ga0070684_100342306
1246 Ga0070684_101267447
1247 Ga0070697_100150866
1248 Ga0068853_100031095
1249 Ga0068853_100070321
1250 Ga0068853_100104917
1251 Ga0068853_100545371
1252 Ga0070672_100012733
1253 Ga0070672_100047840
1254 Ga0070672_100061149
1255 Ga0070686_100006796
1256 Ga0070686_100241485
1257 Ga0070695_100029877
1258 Ga0070695_100031918
1259 Ga0070696_100028797
1260 Ga0070696_100218863
1261 Ga0070696_100738378
1262 Ga0070693_100103112
1263 Ga0070693_100113908
1264 Ga0070693_100135874
1265 Ga0070693_100466625
1266 Ga0070665_100143887
1267 Ga0070665_100239330
1268 Ga0070665_100545571
1269 Ga0070704_100015880
1270 Ga0070704_100036602
1271 Ga0070704_100399269
1272 Ga0070704_100412297
1273 Ga0070704_100659290
1274 Ga0068855_100107593
1275 Ga0068855_100651087
1276 Ga0070664_100049663
1277 Ga0070664_100072406
1278 Ga0070664_100226947
1279 Ga0070664_100399411
1280 Ga0070664_100412135
1281 Ga0070664_100604104
1282 Ga0070664_101410841
1283 Ga0068857_100050538
1284 Ga0068857_100622894
1285 Ga0068854_100038806
1286 Ga0068856_100005850
1287 Ga0068856_100025213
1288 Ga0068856_100189955
1289 Ga0068856_100269155
1290 Ga0070702_100012908
1291 Ga0070702_100199097
1292 Ga0068852_100001457
1293 Ga0068852_100059585
1294 Ga0068852_100074511
1295 Ga0068852_100150197
1296 Ga0068852_100207699
1297 Ga0068859_100081137
1298 Ga0068859_100096319
1299 Ga0068859_100378757
1300 Ga0068864_100355285
1301 Ga0068866_10003460
1302 Ga0068866_10057442
1303 Ga0068866_10091732
1304 Ga0068866_10185367
1305 Ga0068866_10777641
1306 Ga0068861_100076801
1307 Ga0068861_100249784
1308 Ga0068861_100441244
1309 Ga0068861_100676235
1310 Ga0068870_10022271
1311 Ga0068870_10203691
1312 Ga0068863_100059180
1313 Ga0068863_101613326
1314 Ga0068858_100080417
1315 Ga0068860_100057257
1316 Ga0068860_100723162
1317 Ga0068862_100092345
1318 Ga0068862_100176542
1319 Ga0068862_100188608
1320 Ga0081455_10048423
1321 Ga0081455_10062523
1322 Ga0081455_10172657
1323 Ga0081539_10000171
1324 Ga0081539_10002475
1325 Ga0081539_10019265
1326 Ga0075365_10220650
1327 Ga0075432_10001317
1328 Ga0075432_10197256
1329 Ga0070715_10166198
1330 Ga0070716_100177238
1331 Ga0070712_100011978
1332 Ga0070712_100050752
1333 Ga0070712_100666910
1334 Ga0097621_100023192
1335 Ga0097621_100226364
1336 Ga0097621_100352929
1337 Ga0068871_100118754
1338 Ga0068871_100536120
1339 Ga0068871_100573292
1340 Ga0068871_100971887
1341 Ga0075428_100003867
1342 Ga0075428_100031645
1343 Ga0075428_101045104
1344 Ga0075430_100003220
1345 Ga0075430_100052536
1346 Ga0075431_100001247
1347 Ga0075431_100065932
1348 Ga0075433_10017222
1349 Ga0075433_10227278
1350 Ga0075434_100048775
1351 Ga0075434_100142588
1352 Ga0075434_100774292
1353 Ga0075434_100780808
1354 Ga0075429_100034988
1355 Ga0075429_100075005
1356 Ga0068865_100002544
1357 Ga0068865_100016384
1358 Ga0068865_100049535
1359 Ga0068865_101262863
1360 Ga0075436_100038314
1361 Ga0075436_100351145
1362 Ga0097620_100081141
1363 Ga0097620_100096324
1364 Ga0097620_100378741
1365 Ga0075435_100052082
1366 Ga0075435_100089179
1367 Ga0075435_100404014
1368 Ga0075435_101134814
1369 Ga0105244_10217989
1370 Ga0105240_10020003
1371 Ga0105240_10128114
1372 Ga0105240_10237940
1373 Ga0111539_10004209
1374 Ga0111539_10004392
1375 Ga0111539_10022303
1376 Ga0111539_10054760
1377 Ga0111539_10117881
1378 Ga0111539_10196070
1379 Ga0111539_10512172
1380 Ga0111539_11000798
1381 Ga0111539_11324215
1382 Ga0105245_10001410
1383 Ga0105245_10009307
1384 Ga0105245_10094598
1385 Ga0105245_10133513
1386 Ga0105245_10232857
1387 Ga0105245_10509603
1388 Ga0105245_10798509
1389 Ga0105245_11061616
1390 Ga0105245_11636117
1391 Ga0105245_12002927
1392 Ga0105247_10018183
1393 Ga0114129_10033703
1394 Ga0114129_10088860
1395 Ga0114129_10200380
1396 Ga0114129_10284330
1397 Ga0114129_10657613
1398 Ga0114129_11060973
1399 Ga0105243_10004978
1400 Ga0105243_10063858
1401 Ga0105243_10095348
1402 Ga0105243_10171191
1403 Ga0105243_10368726
1404 Ga0105243_10422594
1405 Ga0105243_10605758
1406 Ga0105243_11320497
1407 Ga0105243_11576266
1408 Ga0105241_10052789
1409 Ga0105241_10064497
1410 Ga0105241_10830990
1411 Ga0105242_10024948
1412 Ga0105242_10056670
1413 Ga0105242_10075756
1414 Ga0105242_10109621
1415 Ga0105242_10115588
1416 Ga0105242_10316738
1417 Ga0105242_10390436
1418 Ga0105242_10741417
1419 Ga0105242_11752794
1420 Ga0105248_10011713
1421 Ga0105248_10103763
1422 Ga0105248_10262543
1423 Ga0105248_10336692
1424 Ga0105248_10651293
1425 Ga0105237_10383679
1426 Ga0105238_10084078
1427 Ga0105238_10142405
1428 Ga0105238_10859604
1429 Ga0105249_10006912
1430 Ga0105249_10107016
1431 Ga0105249_10269695
1432 Ga0105249_10443777
1433 Ga0105249_12097845
1434 Ga0105239_10021863
1435 Ga0105239_10047682
1436 Ga0105239_10048190
1437 Ga0105239_10167984
1438 Ga0105239_10306318
1439 Ga0105239_10871679
1440 Ga0105246_10102111
1441 Ga0105246_10271431
1442 Ga0105246_10681203
1443 Ga0157373_10262194
1444 Ga0157371_10137265
1445 Ga0157370_10008006
1446 Ga0157370_10140694
1447 Ga0157370_10285596
1448 Ga0157369_10041209
1449 Ga0157369_10088101
1450 Ga0157369_10296965
1451 Ga0157369_10545256
1452 Ga0157374_10003624
1453 Ga0157374_10113014
1454 Ga0157374_10534663
1455 Ga0157378_10047180
1456 Ga0157378_10100448
1457 Ga0157378_12105278
1458 Ga0163162_10009652
1459 Ga0163162_10119361
1460 Ga0157372_10026673
1461 Ga0157372_10035981
1462 Ga0157372_10508224
1463 Ga0157372_10660762
1464 Ga0157372_10699759
1465 Ga0157372_10980931
1466 Ga0157375_10004528
1467 Ga0157375_10325016
1468 Ga0157375_10540364
1469 Ga0157375_10942063
1470 Ga0157375_11258140
1471 Ga0157375_11406067
1472 Ga0163163_11029622
1473 Ga0163163_11147477
1474 Ga0163163_11763544
1475 Ga0157380_10010543
1476 Ga0157380_10010900
1477 Ga0157380_10188720
1478 Ga0157380_10932301
1479 Ga0182008_10196722
1480 Ga0157377_10013489
1481 Ga0157377_10107788
1482 Ga0157377_10288389
1483 Ga0157379_10051692
1484 Ga0157379_10249268
1485 Ga0157376_10416727
1486 Ga0163161_10026238
1487 Ga0163161_10098814
1488 Ga0197907_10539662
1489 Ga0206356_11217405
1490 Ga0206354_10913791
1491 Ga0206353_11304487
1492 Ga0206353_11639839
1493 Ga0207653_10003328
1494 Ga0207653_10014014
1495 Ga0207653_10066133
1496 Ga0207682_10086863
1497 Ga0207642_10001672
1498 Ga0207642_10067726
1499 Ga0207642_10148826
1500 Ga0207688_10007450
1501 Ga0207688_10033979
1502 Ga0207680_10026351
1503 Ga0207647_10431373
1504 Ga0207685_10122696
1505 Ga0207699_10018463
1506 Ga0207699_10178810
1507 Ga0207699_10349497
1508 Ga0207645_10101095
1509 Ga0207643_10131296
1510 Ga0207705_10031496
1511 Ga0207705_10105055
1512 Ga0207705_10481549
1513 Ga0207654_10403349
1514 Ga0207654_10550638
1515 Ga0207707_10006681
1516 Ga0207707_10016082
1517 Ga0207707_10081719
1518 Ga0207707_10456452
1519 Ga0207695_10105754
1520 Ga0207695_10176920
1521 Ga0207671_10106991
1522 Ga0207671_10193710
1523 Ga0207693_10000406
1524 Ga0207693_10006070
1525 Ga0207693_10322848
1526 Ga0207663_10015925
1527 Ga0207660_10076124
1528 Ga0207660_10137997
1529 Ga0207660_10139274
1530 Ga0207660_10635389
1531 Ga0207660_11164017
1532 Ga0207662_10061124
1533 Ga0207662_10200495
1534 Ga0207662_10234148
1535 Ga0207662_10621003
1536 Ga0207657_10000073
1537 Ga0207657_10005637
1538 Ga0207657_10011355
1539 Ga0207657_10021284
1540 Ga0207657_10106882
1541 Ga0207657_10196081
1542 Ga0207657_10293084
1543 Ga0207649_10046264
1544 Ga0207649_10094244
1545 Ga0207649_10337826
1546 Ga0207649_10893965
1547 Ga0207652_10149358
1548 Ga0207652_10192008
1549 Ga0207652_10601995
1550 Ga0207646_10000371
1551 Ga0207681_10263677
1552 Ga0207681_10342077
1553 Ga0207694_10394833
1554 Ga0207694_10444961
1555 Ga0207694_10608050
1556 Ga0207650_10523668
1557 Ga0207659_10021037
1558 Ga0207659_10133716
1559 Ga0207659_10143509
1560 Ga0207659_10397553
1561 Ga0207659_10490243
1562 Ga0207687_10012420
1563 Ga0207687_10085812
1564 Ga0207687_10108012
1565 Ga0207687_10133288
1566 Ga0207687_10138016
1567 Ga0207687_10184651
1568 Ga0207687_10322555
1569 Ga0207687_10682587
1570 Ga0207687_10686773
1571 Ga0207687_11011545
1572 Ga0207700_10208321
1573 Ga0207664_10360711
1574 Ga0207644_10083311
1575 Ga0207644_11108226
1576 Ga0207690_10077295
1577 Ga0207690_10085152
1578 Ga0207690_10106185
1579 Ga0207690_10363845
1580 Ga0207690_10731447
1581 Ga0207706_10006048
1582 Ga0207706_10027149
1583 Ga0207706_10117640
1584 Ga0207706_10341074
1585 Ga0207686_10048544
1586 Ga0207686_10199040
1587 Ga0207686_10222230
1588 Ga0207686_10291750
1589 Ga0207686_10327884
1590 Ga0207686_10693909
1591 Ga0207686_10747661
1592 Ga0207686_11167262
1593 Ga0207709_10005915
1594 Ga0207709_10023341
1595 Ga0207709_10089416
1596 Ga0207709_10140656
1597 Ga0207709_10296268
1598 Ga0207709_10930163
1599 Ga0207669_10018239
1600 Ga0207669_10035642
1601 Ga0207669_10082370
1602 Ga0207669_10107322
1603 Ga0207669_10581661
1604 Ga0207704_10010042
1605 Ga0207704_10022947
1606 Ga0207704_10075273
1607 Ga0207704_10093357
1608 Ga0207704_10106081
1609 Ga0207665_10027352
1610 Ga0207665_10683337
1611 Ga0207691_10012106
1612 Ga0207691_10020746
1613 Ga0207711_10071375
1614 Ga0207711_10073998
1615 Ga0207711_10342124
1616 Ga0207711_10370784
1617 Ga0207689_10510072
1618 Ga0207689_10661583
1619 Ga0207689_10870371
1620 Ga0207689_11071065
1621 Ga0207661_10000400
1622 Ga0207661_10001504
1623 Ga0207661_10045319
1624 Ga0207661_10057322
1625 Ga0207661_10153477
1626 Ga0207661_10230763
1627 Ga0207661_10307900
1628 Ga0207661_10308889
1629 Ga0207661_10331093
1630 Ga0207661_10394192
1631 Ga0207661_10769699
1632 Ga0207661_10964535
1633 Ga0207661_11252104
1634 Ga0207679_10023009
1635 Ga0207679_10183150
1636 Ga0207679_11176588
1637 Ga0207667_10192884
1638 Ga0207667_10215571
1639 Ga0207667_10513440
1640 Ga0207667_10547421
1641 Ga0207667_11592184
1642 Ga0207712_10352720
1643 Ga0207668_10064071
1644 Ga0207668_10105540
1645 Ga0207668_11106661
1646 Ga0207640_10043230
1647 Ga0207640_10076778
1648 Ga0207640_10092498
1649 Ga0207658_10505242
1650 Ga0207677_10071822
1651 Ga0207677_10315707
1652 Ga0207703_10183672
1653 Ga0207703_11066225
1654 Ga0207639_10032742
1655 Ga0207639_10077237
1656 Ga0207639_10365310
1657 Ga0207639_10397327
1658 Ga0207678_10017335
1659 Ga0207678_10317258
1660 Ga0207708_10007363
1661 Ga0207708_10030929
1662 Ga0207708_10058257
1663 Ga0207708_10327575
1664 Ga0207708_10386165
1665 Ga0207702_10021463
1666 Ga0207702_10164360
1667 Ga0207702_10352284
1668 Ga0207702_10361894
1669 Ga0207641_10368419
1670 Ga0207641_11217483
1671 Ga0207648_10001155
1672 Ga0207648_10084594
1673 Ga0207648_10127528
1674 Ga0207648_10294676
1675 Ga0207676_10126455
1676 Ga0207676_10284405
1677 Ga0207674_10041905
1678 Ga0207674_10385540
1679 Ga0207674_11116331
1680 Ga0207675_100039062
1681 Ga0207675_100108178
1682 Ga0207675_100673689
1683 Ga0207683_10001368
1684 Ga0207683_10028085
1685 Ga0207683_10071199
1686 Ga0207683_10082690
1687 Ga0207683_10144814
1688 Ga0207683_10383886
1689 Ga0207683_10725849
1690 Ga0207683_11095619
1691 Ga0207683_11296415
1692 Ga0207698_10025256
1693 Ga0207698_10039363
1694 Ga0207698_10225989
1695 Ga0207428_10000104
1696 Ga0207428_10014814
1697 Ga0207428_10036344
1698 Ga0207428_10058751
1699 Ga0207428_10081818
1700 Ga0268266_10097009
1701 Ga0268266_10682479
1702 Ga0268266_11326520
1703 Ga0268265_11059754
1704 Ga0268265_11125818
1705 Ga0265319_1157582
1706 Ga0265338_10040350
1707 Ga0265320_10038208
1708 Ga0307405_10491583
1709 Ga0307416_100318555
1710 Ga0307415_100384176
1711 Ga0373938_0051382
1712 Ga0373928_0012834
1713 Ga0373928_0037916
1714 Ga0373929_0002704
1715 Ga0373934_0080054
1716 Ga0373951_0003373
1717 Ga0373932_0018558
1718 Ga0373936_0053726
1719 Ga0373945_0081818
1720 Ga0373956_0028383
1721 Ga0373960_0017029
1722 Ga0373943_0004585
1723 Ga0373943_0178015
1724 Ga0373946_0002729
1725 Ga0373946_0118303
1726 Ga0373942_0012882
1727 Ga0373931_0020831
1728 Ga0373931_0105519
1729 Ga0373931_0378200
1730 Ga0373935_0070061
1731 Ga0373935_0519477
1732 Ga0373947_0002186
1733 Ga0373947_0002329
1734 Ga0373937_0000107
1735 Ga0373925_0008600
1736 Ga0373925_0022467
1737 Ga0395899_0027247
1738 Ga0395899_0056713
1739 Ga0395899_0134020
1740 Ga0395899_0332480
1741 Ga0395900_0005659
1742 Ga0395900_0039282
1743 Ga0395900_0360969
1744 Ga0395900_0401138
1745 Ga0395900_0465795
1746 Ga0395898_0118417
1747 Ga0395898_0118828
1748 Ga0395898_0443953
1749 Ga0395898_0456511
1750 Ga0395898_0730065
1751 Ga0395898_0997116
1752 Ga0395905_0063928
1753 Ga0395905_0070232
1754 Ga0395905_0164971
1755 Ga0395905_0370196
1756 Ga0395905_0413104
1757 Ga0395905_0535275
1758 Ga0395901_0000904
1759 Ga0395901_0037785
1760 Ga0395901_0112527
1761 Ga0395901_0136416
1762 Ga0395901_0316153
1763 Ga0395901_0743655
1764 Ga0395901_1601125
1765 Ga0439436_0032405
1766 Ga0439439_0012614
1767 Ga0451793_0221238
1768 Ga0451853_0598836
1769 Ga0451853_2862716
1770 Ga0439433_0001393
1771 Ga0439437_017806
1772 Ga0439442_033676
1773 Ga0439448_0084263
1774 Ga0439449_0028363
1775 Ga0439450_021016
1776 Ga0439451_001707
1777 Ga0439454_067487
1778 Ga0439462_0006260
1779 Ga0439446_0001540
1780 Ga0439446_0004290
1781 Ga0439434_0010858
1782 Ga0439434_0042199
1783 Ga0466969_0004681
1784 Ga0466969_0328705
1785 Ga0466965_0030583
1786 Ga0466966_0011395
1787 Ga0466966_0090554
1788 Ga0466961_0005030
1789 Ga0466961_0014159
1790 Ga0466963_0004897
1791 Ga0466963_0041040
1792 Ga0466963_0049382
1793 Ga0466963_0126306
1794 Ga0466963_0221403
1795 Ga0466963_0339622
1796 Ga0466963_0640005
1797 Ga0466964_0001421
1798 Ga0466971_0000768
1799 Ga0466971_0006213
1800 Ga0466970_0144565
1801 Ga0466957_0005752
1802 Ga0466957_0044589
1803 Ga0466957_0451197
1804 Ga0466957_0602604
1805 Ga0466959_0004630
1806 Ga0466959_0257965
1807 Ga0466958_0006279
1808 Ga0466958_0019366
1809 Ga0466958_0161079
1810 Ga0466967_0005862
1811 Ga0466967_0012698
1812 Ga0466967_0017608
1813 Ga0466967_0027407
1814 Ga0466967_0054062
1815 Ga0466967_0109005
1816 Ga0495592_0000089
1817 Ga0495603_0002404
1818 Ga0495603_0016845
1819 Ga0495603_0038673
1820 Ga0495603_0564792
1821 Ga0495603_0657930
1822 Ga0495629_0119635
1823 Ga0495629_0332740
1824 Ga0495641_0002430
1825 Ga0495641_0138364
1826 Ga0495651_0000057
1827 Ga0495651_0314617
1828 Ga0495653_0028354
1829 Ga0495653_0072567
1830 Ga0495582_0024097
1831 Ga0495582_0079585
1832 Ga0495582_0215921
1833 Ga0495582_0222962
1834 Ga0495605_0217372
1835 Ga0495639_0004511
1836 Ga0495662_0255175
1837 Ga0495584_0315172
1838 Ga0495584_0432491
1839 Ga0495594_0001407
1840 Ga0495594_0054381
1841 Ga0495594_0060162
1842 Ga0495596_0110667
1843 Ga0495608_0002880
1844 Ga0495608_0327686
1845 Ga0495616_0104136
1846 Ga0495618_0137110
1847 Ga0495618_0367806
1848 Ga0495628_0000066
1849 Ga0495630_0341511
1850 Ga0495630_0453667
1851 Ga0495644_0078581
1852 Ga0495663_0250864
1853 Ga0495642_0116086
1854 Ga0495652_0000118
1855 Ga0495652_0907627
1856 Ga0495665_0026926
1857 Ga0495587_0000096
1858 Ga0495598_0054577
1859 Ga0495609_0228987
1860 Ga0495645_0000052
1861 Ga0495633_0388066
1862 Ga0495667_0394618
1863 Ga0495656_0137837
1864 Ga0495656_0197163
1865 Ga0495656_0211048
1866 Ga0495668_0266921
1867 Ga0495668_0494276
1868 Ga0495634_0106206
1869 Ga0495634_0119858
1870 Ga0495659_0042279
1871 Ga0495588_0000537
1872 Ga0495588_0078247
1873 Ga0495657_0084489
1874 Ga0495599_0000046
1875 Ga0495623_0000061
1876 Ga0495647_0022214
1877 Ga0495647_0028454
1878 Ga0495647_0043763
1879 Ga0495647_0118600
1880 Ga0495658_0008228
1881 Ga0495658_0062724
1882 Ga0495658_0103844
1883 Ga0495658_0466230
1884 Ga0495613_0062181
1885 Ga0495613_0127887
1886 Ga0495624_0056812
1887 Ga0495624_0524635
1888 Ga0495670_0260281
1889 Ga0495589_0060698
1890 Ga0495581_0022119
1891 Ga0495581_0028818
1892 Ga0495604_0000075
1893 Ga0495676_0003263
1894 Ga0495676_0039225
1895 Ga0495676_0364282
1896 Ga0495680_0013423
1897 Ga0495675_0000089
1898 Ga0495677_0068840
1899 Ga0495679_083981
1900 Ga0495602_0000140
1901 Ga0495614_0046979
1902 Ga0496100_0026516
1903 Ga0496100_0054076
1904 Ga0496100_0086727
1905 Ga0496100_0120442
1906 Ga0496100_0130199
1907 Ga0496100_0215854
1908 Ga0496100_0286468
1909 Ga0496100_0486834
1910 Ga0496100_1036887
1911 Ga0496100_1159414
1912 Ga0496101_0036240
1913 Ga0496101_0080064
1914 Ga0496101_0095325
1915 Ga0496101_0194165
1916 Ga0496101_0197157
1917 Ga0496101_0262766
1918 Ga0496101_0264364
1919 Ga0496101_0279652
1920 Ga0496101_0444790
1921 Ga0496101_0606522
1922 Ga0496102_0001619
1923 Ga0496102_0013494
1924 Ga0496102_0043574
1925 Ga0496102_0145421
1926 Ga0496102_0165137
1927 Ga0496102_0295843
1928 Ga0496102_0330262
1929 Ga0496102_0341745
1930 Ga0496102_1166362
1931 Ga0496103_0001460
1932 Ga0496103_0065986
1933 Ga0496103_0080681
1934 Ga0496103_0120652
1935 Ga0496103_0328935
1936 Ga0496103_0439962
1937 Ga0496103_0508007
1938 Ga0496103_0577906
1939 Ga0496104_0009894
1940 Ga0496104_0052779
1941 Ga0496104_0062319
1942 Ga0496104_0114998
1943 Ga0496104_0201091
1944 Ga0496104_0225117
1945 Ga0496104_0316886
1946 Ga0496104_0783256
1947 Ga0496105_0008640
1948 Ga0496105_0034180
1949 Ga0496105_0073616
1950 Ga0496105_0113873
1951 Ga0496105_0138118
1952 Ga0496105_0210771
1953 Ga0496105_0464371
1954 Ga0496106_0029799
1955 Ga0496106_0109176
1956 Ga0496106_0205076
1957 Ga0496107_0011180
1958 Ga0496107_0013676
1959 Ga0496107_0150306
1960 Ga0496107_0152424
1961 Ga0496107_0187471
1962 Ga0496107_0274623
1963 Ga0496108_0002875
1964 Ga0496108_0030921
1965 Ga0496108_0040203
1966 Ga0496108_0075844
1967 Ga0496108_0235070
1968 Ga0496108_0368577
1969 Ga0496108_0678203
1970 Ga0496109_0000954
1971 Ga0496109_0008233
1972 Ga0496109_0017433
1973 Ga0496109_0151250
1974 Ga0496109_0159293
1975 Ga0496109_0236077
1976 Ga0496109_0268766
1977 Ga0496109_0438853
1978 Ga0496110_0001816
1979 Ga0496110_0013023
1980 Ga0496110_0020582
1981 Ga0496110_0249246
1982 Ga0496110_0409429
1983 Ga0496110_0657013
1984 Ga0496110_0919741
1985 Ga0496110_1084653
1986 Ga0496111_0003517
1987 Ga0496111_0038137
1988 Ga0496111_0057286
1989 Ga0496111_0313834
1990 Ga0496111_0340451
1991 Ga0496112_0000293
1992 Ga0496112_0028386
1993 Ga0496112_0051790
1994 Ga0496112_0077211
1995 Ga0496112_0476246
1996 Ga0496113_0008471
1997 Ga0496113_0020678
1998 Ga0496113_0091498
1999 Ga0496113_0100291
2000 Ga0496113_0104717
2001 Ga0496113_0368894
2002 Ga0496113_0526946
2003 Ga0496114_0042927
2004 Ga0496114_0071351
2005 Ga0496114_0079020
2006 Ga0496114_0094330
2007 Ga0496114_0177951
2008 Ga0496114_0311809
2009 Ga0496114_0328665
2010 Ga0496114_0426136
2011 Ga0496114_0495719
2012 Ga0496114_0705014
2013 Ga0496115_0005787
2014 Ga0496115_0011507
2015 Ga0496115_0018951
2016 Ga0496115_0041527
2017 Ga0496115_0417631
2018 Ga0501031_0031652
2019 Ga0501031_0086672
2020 Ga0501032_0206415
2021 Ga0501033_0128216
2022 Ga0501034_0012275
2023 Ga0501034_0500596
2024 Ga0501036_0480183
2025 Ga0501037_0250529
2026 Ga0501037_0521122
2027 Ga0501038_0059683
2028 Ga0501038_0132762
2029 Ga0501038_0300939
2030 Ga0501038_0389313
2031 Ga0501039_0093273
2032 Ga0501039_0256231
2033 Ga0501039_0788160
2034 Ga0501040_0023239
2035 Ga0501040_0025213
2036 Ga0501040_0046978
2037 Ga0501040_0550869
2038 Ga0501041_0039904
2039 Ga0501041_0093474
2040 Ga0501041_0238002
2041 Ga0501041_0415644
2042 Ga0501042_0037252
2043 Ga0501042_0097356
2044 Ga0501042_0133879
2045 Ga0501042_0452867
2046 Ga0501043_0065071
2047 Ga0501043_0443932
2048 Ga0501046_0069719
2049 Ga0501046_0104361
2050 Ga0501046_0106806
2051 Ga0501048_0028573
2052 Ga0501048_0029137
2053 Ga0501048_0890904
2054 Ga0501068_0108540
2055 Ga0501068_0727162
2056 Ga0501069_0315979
2057 Ga0501069_0662638
2058 Ga0501070_0035068
2059 Ga0501071_0063220
2060 Ga0501071_0064700
2061 Ga0501071_0086068
2062 Ga0501071_0140932
2063 Ga0501071_0370092
2064 Ga0501072_0001406
2065 Ga0501072_0027847
2066 Ga0501072_0139224
2067 Ga0501072_0161624
2068 Ga0501072_0503857
2069 Ga0501072_0605598
2070 Ga0501073_0094635
2071 Ga0501074_0042398
2072 Ga0501074_0050253
2073 Ga0501074_0079091
2074 Ga0501074_0265539
2075 Ga0501074_0747837
2076 Ga0501075_0016117
2077 Ga0501075_0050018
2078 Ga0501075_0063124
2079 Ga0501075_0075716
2080 Ga0501075_0522474
2081 Ga0501076_0008719
2082 Ga0501076_0015983
2083 Ga0501076_0068957
2084 Ga0501076_0076520
2085 Ga0501076_0250841
2086 Ga0501076_0282987
2087 Ga0501077_0003452
2088 Ga0501077_0024418
2089 Ga0501077_0046480
2090 Ga0501077_0515432
2091 Ga0501216_097487
2092 Ga0501079_0049513
2093 Ga0501079_0050704
2094 Ga0501079_0143395
2095 Ga0501079_0482033
2096 Ga0501079_0583577
2097 Ga0501079_0757753
2098 Ga0501080_0003102
2099 Ga0501080_0014392
2100 Ga0501080_0019569
2101 Ga0501080_0601551
2102 Ga0501080_1030443
2103 Ga0501081_0058946
2104 Ga0501081_0076627
2105 Ga0501081_0115374
2106 Ga0501081_0260651
2107 Ga0501081_0755045
2108 Ga0501083_0072558
2109 Ga0501083_0075522
2110 Ga0501035_0020176
2111 Ga0501035_0110887
2112 Ga0501044_0400982
2113 Ga0501045_0085690
2114 Ga0501045_0097721
2115 nmdc:mga0yw44_502155_c1
2116 nmdc:mga05p37_160234_c1
2117 nmdc:mga05p37_247498_c1
2118 nmdc:mga05p37_713479_c1
2119 nmdc:mga09592_57341_c1
2120 nmdc:mga09592_80779_c1
2121 nmdc:mga0qj67_204564_c1
2122 nmdc:mga06r32_540672_c1
2123 nmdc:mga08y16_100400_c1
2124 nmdc:mga08y16_65697_c1
2125 nmdc:mga08y16_68549_c1
2126 nmdc:mga08y16_86703_c1
2127 nmdc:mga0n895_1183861_c1
2128 nmdc:mga0n895_15149_c1
2129 nmdc:mga0n895_639846_c1
2130 nmdc:mga0n895_96856_c1
2131 nmdc:mga0rr50_55781_c1
2132 nmdc:mga0rr50_592323_c1
2133 nmdc:mga08x19_12257_c1
2134 nmdc:mga08x19_99535_c1
2135 nmdc:mga0a205_113983_c1
2136 nmdc:mga0a205_246783_c1
2137 Ga0495601_0000273
2138 Ga0495601_0351130
2139 Ga0495612_0091343
2140 Ga0495655_0133444
2141 Ga0495595_0016131
2142 Ga0495595_0119272
2143 Ga0495619_0000123
2144 Ga0495619_0064465
2145 Ga0495619_0334442
2146 Ga0501084_0002565
2147 Ga0501084_0029462
2148 Ga0501084_0032747
2149 Ga0501084_0049299
2150 Ga0501084_0160722
2151 Ga0501084_0217161
2152 Ga0501084_0661911
2153 Ga0501084_0786383
2154 Ga0501084_0872458
2155 Ga0501082_0019671
2156 Ga0501082_0077187
2157 Ga0501082_0377151
2158 Ga0501082_0512355
2159 Ga0501082_0529948
2160 Ga0501082_0765836
2161 Ga0466962_0002035
2162 Ga0530510_0034871
2163 Ga0530510_0097496
2164 Ga0530510_0437648

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

31

202

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3auf-assembly1.cif.gz_A-2 crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii 0.9681 2 172
4s1n-assembly1.cif.gz_A the crystal structure of phosphoribosylglycinamide formyltransferase from streptococcus pneumoniae tigr4 0.9645 2 178
2ywr-assembly1.cif.gz_A crystal structure of gar transformylase from aquifex aeolicus 0.9633 2 174
4zyv-assembly1.cif.gz_A human gar transformylase in complex with gar and n-({5-[(2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidin-6-yl)butyl]thiophen-2-yl}carbonyl)-l-glutamic acid (agf71) 0.9596 2 174
3p9x-assembly1.cif.gz_B crystal structure of phosphoribosylglycinamide formyltransferase from bacillus halodurans 0.9572 2 178
ID Description Score Start End Superfamily
3aufA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9681 2 172 3.40.50.170
4s1nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9584 2 178 3.40.50.170
1njsA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9551 2 174 3.40.50.170
af_Q2FZI7_1_188_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9512 2 178 3.40.50.170
2ywrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9501 2 174 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A7V9ZWE7-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9881 1 180 GO:0004644
GO:0005829
GO:0006189
AF-A0A538E454-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) 0.9821 98 180 GO:0004644
GO:0005829
GO:0006189
AF-A0A7W0G8W0-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) 0.9768 1 180 GO:0004644
GO:0005829
GO:0006189
AF-A0A550JKQ1-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9741 2 172 GO:0004644
GO:0005829
GO:0006189
AF-A0A2V6XK53-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) 0.9728 2 150 GO:0004644
GO:0005829
GO:0006189

Map