F489598

General Info

Members Datasets Scaffolds Average Seq Length
1077 252 1072 221

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100008788|Ga0070661_1000087884
Length 246
Sequence VRVASQPACPRVFRFPQCRAPVRPASMVPFSFAAETFQATPDGALYWPSQQALLVADLHLEKASWFARLGQFLPPYDSQATLAALAEMIERTGATRLYCLGDSFHDRFGCERLPASARVLLTGLTARLDWTWIVGNHDPSFADHCGGRIEEEAEVAGIILRHEAVRDEVRAEISGHFHPKLRVHLRGRQVSRRCFVASTRKIIMPAFGSLTGGLDAHHPEIMGSVGGKAAALVPVSDRLLRFPLAA

Samples

Sample ID Description Type Environment
1 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
2 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
3 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
4 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
5 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
6 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
182 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
183 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
184 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
185 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
186 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
205 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
208 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
214 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
215 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
248 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
249 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
250 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
251 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
252 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.19
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0
Rhizoplane 3.99
Rhizosphere 93.04
Stem 0
Stem Tuber 0
Unclassified 0.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000886 3300001915 Bacteria 9041
2 JGI24740J21852_10000478 3300001979 Bacteria 17228
3 JGI24740J21852_10026663 3300001979 Bacteria 1933
4 JGI24739J22299_10001965 3300001989 Bacteria 7871
5 JGI24737J22298_10014727 3300001990 Bacteria 2537
6 JGI24737J22298_10020683 3300001990 Bacteria 2100
7 JGI24744J21845_10000271 3300002077 Bacteria 8476
8 Ga0055536_1002682 3300003781 Bacteria 9874
9 Ga0055536_1003009 3300003781 Bacteria 9231
10 Ga0055536_1025582 3300003781 Bacteria 1678
11 Ga0055534_1007550 3300003784 Bacteria 2575
12 Ga0055530_10000919 3300003791 Bacteria 24154
13 Ga0055531_10000576 3300003794 Bacteria 32018
14 Ga0055531_10012248 3300003794 Bacteria 4052
15 Ga0065715_10108433 3300005293 Bacteria 2719
16 Ga0070658_10000107 3300005327 Bacteria 73895
17 Ga0070658_10051602 3300005327 Bacteria 3333
18 Ga0070658_10075411 3300005327 Bacteria 2766
19 Ga0070658_10081675 3300005327 Bacteria 2655
20 Ga0070658_10128380 3300005327 Bacteria 2111
21 Ga0070658_10178157 3300005327 Bacteria 1788
22 Ga0070658_10236799 3300005327 Bacteria 1547
23 Ga0070658_10237486 3300005327 Bacteria 1544
24 Ga0070658_10431225 3300005327 Bacteria 1134
25 Ga0070658_10477764 3300005327 Bacteria 1075
26 Ga0070658_10504849 3300005327 Bacteria 1045
27 Ga0070658_10763207 3300005327 Bacteria 840
28 Ga0070676_10229613 3300005328 Bacteria 1229
29 Ga0070676_10280920 3300005328 Bacteria 1122
30 Ga0070683_100001635 3300005329 Bacteria 17347
31 Ga0070683_100002963 3300005329 Bacteria 13612
32 Ga0070683_100029355 3300005329 Bacteria 4978
33 Ga0070683_100038176 3300005329 Bacteria 4400
34 Ga0070683_100054017 3300005329 Bacteria 3724
35 Ga0070683_100327903 3300005329 Bacteria 1457
36 Ga0070683_100587016 3300005329 Bacteria 1066
37 Ga0070690_100016818 3300005330 Bacteria 4391
38 Ga0070690_100510077 3300005330 Bacteria 901
39 Ga0070670_100000263 3300005331 Bacteria 46664
40 Ga0070670_100037310 3300005331 Bacteria 4181
41 Ga0070670_100040551 3300005331 Bacteria 4002
42 Ga0070670_100291648 3300005331 Bacteria 1426
43 Ga0070677_10020480 3300005333 Bacteria 2410
44 Ga0070677_10023201 3300005333 Bacteria 2295
45 Ga0070677_10031327 3300005333 Bacteria 2032
46 Ga0070677_10129925 3300005333 Bacteria 1149
47 Ga0070677_10137713 3300005333 Bacteria 1122
48 Ga0070666_10001184 3300005335 Bacteria 15784
49 Ga0070666_10011615 3300005335 Bacteria 5533
50 Ga0070666_10012419 3300005335 Bacteria 5372
51 Ga0070666_10018378 3300005335 Bacteria 4493
52 Ga0070666_10030734 3300005335 Bacteria 3541
53 Ga0070666_10069376 3300005335 Bacteria 2397
54 Ga0070680_100002425 3300005336 Bacteria 13815
55 Ga0070680_100103499 3300005336 Bacteria 2365
56 Ga0070680_100110439 3300005336 Bacteria 2289
57 Ga0070680_100146675 3300005336 Bacteria 1980
58 Ga0070680_100287890 3300005336 Bacteria 1392
59 Ga0070680_100408033 3300005336 Bacteria 1158
60 Ga0070680_100545684 3300005336 Bacteria 993
61 Ga0070680_100681053 3300005336 Bacteria 884
62 Ga0068868_100019933 3300005338 Bacteria 5030
63 Ga0068868_100119270 3300005338 Bacteria 2150
64 Ga0068868_100473890 3300005338 Bacteria 1092
65 Ga0070660_100002346 3300005339 Bacteria 13006
66 Ga0070660_100003086 3300005339 Bacteria 11449
67 Ga0070660_100006884 3300005339 Bacteria 7885
68 Ga0070660_100035110 3300005339 Bacteria 3793
69 Ga0070660_100043905 3300005339 Bacteria 3416
70 Ga0070660_100063895 3300005339 Bacteria 2862
71 Ga0070660_100116523 3300005339 Bacteria 2130
72 Ga0070660_100197458 3300005339 Bacteria 1631
73 Ga0070660_100204583 3300005339 Bacteria 1602
74 Ga0070660_100227673 3300005339 Bacteria 1516
75 Ga0070660_100289855 3300005339 Bacteria 1340
76 Ga0070660_100337931 3300005339 Bacteria 1239
77 Ga0070660_100380358 3300005339 Bacteria 1165
78 Ga0070660_100402061 3300005339 Bacteria 1133
79 Ga0070660_100517464 3300005339 Bacteria 993
80 Ga0070689_100629179 3300005340 Bacteria 932
81 Ga0070691_10147990 3300005341 Bacteria 1202
82 Ga0070691_10198216 3300005341 Bacteria 1053
83 Ga0070661_100000101 3300005344 Bacteria 70279
84 Ga0070661_100008788 3300005344 Bacteria 6990
85 Ga0070661_100012760 3300005344 Bacteria 5882
86 Ga0070661_100014445 3300005344 Bacteria 5565
87 Ga0070661_100024208 3300005344 Bacteria 4354
88 Ga0070661_100038675 3300005344 Bacteria 3474
89 Ga0070661_100084858 3300005344 Bacteria 2340
90 Ga0070661_100120523 3300005344 Bacteria 1964
91 Ga0070661_100125971 3300005344 Bacteria 1921
92 Ga0070661_100143993 3300005344 Bacteria 1798
93 Ga0070661_100155945 3300005344 Bacteria 1727
94 Ga0070661_100317355 3300005344 Bacteria 1216
95 Ga0070661_100420409 3300005344 Bacteria 1059
96 Ga0070661_100579264 3300005344 Bacteria 905
97 Ga0070661_100751293 3300005344 Bacteria 797
98 Ga0070692_10001622 3300005345 Bacteria 8277
99 Ga0070692_10007869 3300005345 Bacteria 4725
100 Ga0070692_10034396 3300005345 Bacteria 2560
101 Ga0070668_100000081 3300005347 Bacteria 59959
102 Ga0070668_100731195 3300005347 Bacteria 875
103 Ga0070669_100004051 3300005353 Bacteria 10599
104 Ga0070669_100065545 3300005353 Bacteria 2676
105 Ga0070675_100000118 3300005354 Bacteria 46627
106 Ga0070675_100007151 3300005354 Bacteria 8598
107 Ga0070675_100075279 3300005354 Bacteria 2806
108 Ga0070675_100529772 3300005354 Bacteria 1064
109 Ga0070675_100612004 3300005354 Bacteria 988
110 Ga0070671_100000533 3300005355 Bacteria 26740
111 Ga0070671_100001226 3300005355 Bacteria 19207
112 Ga0070671_100008814 3300005355 Bacteria 8092
113 Ga0070671_100021607 3300005355 Bacteria 5257
114 Ga0070671_100027968 3300005355 Bacteria 4643
115 Ga0070671_100032012 3300005355 Bacteria 4348
116 Ga0070671_100035848 3300005355 Bacteria 4111
117 Ga0070671_100044687 3300005355 Bacteria 3682
118 Ga0070671_100050464 3300005355 Bacteria 3460
119 Ga0070671_100097878 3300005355 Bacteria 2460
120 Ga0070671_100740833 3300005355 Bacteria 854
121 Ga0070674_100008358 3300005356 Bacteria 6161
122 Ga0070674_100192537 3300005356 Bacteria 1570
123 Ga0070674_100269195 3300005356 Bacteria 1346
124 Ga0070674_100290847 3300005356 Bacteria 1299
125 Ga0070673_100003291 3300005364 Bacteria 10030
126 Ga0070673_100003843 3300005364 Bacteria 9429
127 Ga0070673_100030923 3300005364 Bacteria 4013
128 Ga0070673_100056275 3300005364 Bacteria 3102
129 Ga0070673_100145576 3300005364 Bacteria 2002
130 Ga0070688_100099934 3300005365 Bacteria 1911
131 Ga0070659_100000045 3300005366 Bacteria 101520
132 Ga0070659_100005279 3300005366 Bacteria 9272
133 Ga0070659_100012293 3300005366 Bacteria 6347
134 Ga0070659_100064878 3300005366 Bacteria 2891
135 Ga0070659_100096358 3300005366 Bacteria 2376
136 Ga0070659_100100698 3300005366 Bacteria 2325
137 Ga0070659_100161099 3300005366 Bacteria 1834
138 Ga0070659_100162672 3300005366 Bacteria 1826
139 Ga0070659_100173117 3300005366 Bacteria 1769
140 Ga0070659_100174630 3300005366 Bacteria 1762
141 Ga0070659_100216003 3300005366 Bacteria 1582
142 Ga0070659_100266020 3300005366 Bacteria 1423
143 Ga0070659_100296367 3300005366 Bacteria 1348
144 Ga0070659_100346999 3300005366 Bacteria 1245
145 Ga0070659_100582090 3300005366 Bacteria 960
146 Ga0070659_100620684 3300005366 Bacteria 930
147 Ga0070659_100958641 3300005366 Bacteria 749
148 Ga0070667_100000211 3300005367 Bacteria 67927
149 Ga0070667_100001244 3300005367 Bacteria 23122
150 Ga0070667_100026867 3300005367 Bacteria 4790
151 Ga0070667_100031641 3300005367 Bacteria 4411
152 Ga0070667_100044459 3300005367 Bacteria 3730
153 Ga0070667_100135292 3300005367 Bacteria 2155
154 Ga0070667_100204835 3300005367 Bacteria 1751
155 Ga0070667_100439113 3300005367 Bacteria 1192
156 Ga0070709_10389676 3300005434 Bacteria 1038
157 Ga0070714_100077489 3300005435 Bacteria 2888
158 Ga0070714_100088581 3300005435 Bacteria 2708
159 Ga0070714_100162622 3300005435 Bacteria 2021
160 Ga0070714_100186386 3300005435 Bacteria 1891
161 Ga0070714_100315487 3300005435 Bacteria 1461
162 Ga0070714_100733969 3300005435 Bacteria 954
163 Ga0070713_100014377 3300005436 Bacteria 5876
164 Ga0070713_100046439 3300005436 Bacteria 3563
165 Ga0070713_100591425 3300005436 Bacteria 1053
166 Ga0070663_100000549 3300005455 Bacteria 19942
167 Ga0070663_100001760 3300005455 Bacteria 12050
168 Ga0070663_100004497 3300005455 Bacteria 8212
169 Ga0070663_100008655 3300005455 Bacteria 6273
170 Ga0070663_100021071 3300005455 Bacteria 4328
171 Ga0070663_100237504 3300005455 Bacteria 1437
172 Ga0070663_100255793 3300005455 Bacteria 1388
173 Ga0070663_100271604 3300005455 Bacteria 1348
174 Ga0070663_100460944 3300005455 Bacteria 1049
175 Ga0070663_100468936 3300005455 Bacteria 1041
176 Ga0070678_100000740 3300005456 Bacteria 16284
177 Ga0070678_100011936 3300005456 Bacteria 5379
178 Ga0070678_100023764 3300005456 Bacteria 4091
179 Ga0070678_100112066 3300005456 Bacteria 2136
180 Ga0070678_100195077 3300005456 Bacteria 1667
181 Ga0070678_100352305 3300005456 Bacteria 1266
182 Ga0070662_100000036 3300005457 Bacteria 77190
183 Ga0070662_100000505 3300005457 Bacteria 23361
184 Ga0070662_100004779 3300005457 Bacteria 8582
185 Ga0070662_100007052 3300005457 Bacteria 7270
186 Ga0070662_100017455 3300005457 Bacteria 4840
187 Ga0070662_100023485 3300005457 Bacteria 4236
188 Ga0070662_100026171 3300005457 Bacteria 4038
189 Ga0070662_100083707 3300005457 Bacteria 2382
190 Ga0070662_100144481 3300005457 Bacteria 1847
191 Ga0070662_100165004 3300005457 Bacteria 1735
192 Ga0070662_100340765 3300005457 Bacteria 1226
193 Ga0070681_10066804 3300005458 Bacteria 3565
194 Ga0070681_10075603 3300005458 Bacteria 3328
195 Ga0070681_10195731 3300005458 Bacteria 1940
196 Ga0070681_10197496 3300005458 Bacteria 1930
197 Ga0070681_10201649 3300005458 Bacteria 1908
198 Ga0070681_10213886 3300005458 Bacteria 1844
199 Ga0070681_10499446 3300005458 Bacteria 1129
200 Ga0070681_10571768 3300005458 Bacteria 1044
201 Ga0068867_100192429 3300005459 Bacteria 1628
202 Ga0068867_100709092 3300005459 Bacteria 889
203 Ga0070679_100018187 3300005530 Bacteria 6815
204 Ga0070679_100020530 3300005530 Bacteria 6442
205 Ga0070679_100053950 3300005530 Bacteria 4002
206 Ga0070679_100096518 3300005530 Bacteria 2943
207 Ga0070679_100117872 3300005530 Bacteria 2640
208 Ga0070679_100219953 3300005530 Bacteria 1860
209 Ga0070679_100228966 3300005530 Bacteria 1818
210 Ga0070679_100349894 3300005530 Bacteria 1425
211 Ga0070679_100381706 3300005530 Bacteria 1356
212 Ga0070679_100511688 3300005530 Bacteria 1144
213 Ga0070679_100686721 3300005530 Bacteria 966
214 Ga0070684_100018254 3300005535 Bacteria 5776
215 Ga0070684_100048153 3300005535 Bacteria 3697
216 Ga0070684_100066515 3300005535 Bacteria 3164
217 Ga0070684_100184835 3300005535 Bacteria 1895
218 Ga0068853_100000059 3300005539 Bacteria 78301
219 Ga0068853_100013847 3300005539 Bacteria 6592
220 Ga0068853_100082354 3300005539 Bacteria 2818
221 Ga0068853_100237702 3300005539 Bacteria 1669
222 Ga0068853_100252244 3300005539 Bacteria 1619
223 Ga0068853_100310455 3300005539 Bacteria 1460
224 Ga0068853_100489298 3300005539 Bacteria 1160
225 Ga0068853_100669332 3300005539 Bacteria 989
226 Ga0070672_100003021 3300005543 Bacteria 10838
227 Ga0070672_100052580 3300005543 Bacteria 3181
228 Ga0070672_100078840 3300005543 Bacteria 2636
229 Ga0070672_100314673 3300005543 Bacteria 1329
230 Ga0070672_100541946 3300005543 Bacteria 1010
231 Ga0070672_100680463 3300005543 Bacteria 900
232 Ga0070696_100217879 3300005546 Bacteria 1431
233 Ga0070693_100009384 3300005547 Bacteria 4863
234 Ga0070693_100148787 3300005547 Bacteria 1481
235 Ga0070665_100015366 3300005548 Bacteria 7688
236 Ga0070665_100067723 3300005548 Bacteria 3580
237 Ga0070665_100336763 3300005548 Bacteria 1513
238 Ga0070665_100435321 3300005548 Bacteria 1321
239 Ga0068855_100012363 3300005563 Bacteria 10311
240 Ga0068855_100060416 3300005563 Bacteria 4432
241 Ga0068855_100118355 3300005563 Bacteria 3034
242 Ga0068855_100121018 3300005563 Bacteria 2996
243 Ga0068855_100140238 3300005563 Bacteria 2756
244 Ga0068855_100303010 3300005563 Bacteria 1769
245 Ga0068855_100314583 3300005563 Bacteria 1732
246 Ga0068855_100336690 3300005563 Bacteria 1665
247 Ga0068855_100796753 3300005563 Bacteria 1004
248 Ga0070664_100000027 3300005564 Bacteria 90881
249 Ga0070664_100002553 3300005564 Bacteria 14687
250 Ga0070664_100005661 3300005564 Bacteria 10059
251 Ga0070664_100008562 3300005564 Bacteria 8275
252 Ga0070664_100017909 3300005564 Bacteria 5816
253 Ga0070664_100055518 3300005564 Bacteria 3363
254 Ga0070664_100066168 3300005564 Bacteria 3085
255 Ga0070664_100075344 3300005564 Bacteria 2898
256 Ga0070664_100314029 3300005564 Bacteria 1419
257 Ga0070664_100676667 3300005564 Bacteria 960
258 Ga0070664_100859671 3300005564 Bacteria 849
259 Ga0068857_100011102 3300005577 Bacteria 7835
260 Ga0068857_100043896 3300005577 Bacteria 3965
261 Ga0068857_100048452 3300005577 Bacteria 3772
262 Ga0068857_100116829 3300005577 Bacteria 2400
263 Ga0068857_100288863 3300005577 Bacteria 1510
264 Ga0068857_100289840 3300005577 Bacteria 1507
265 Ga0068857_100657538 3300005577 Bacteria 993
266 Ga0068854_100011147 3300005578 Bacteria 5838
267 Ga0068854_100035602 3300005578 Bacteria 3485
268 Ga0068854_100071398 3300005578 Bacteria 2540
269 Ga0068854_100129557 3300005578 Bacteria 1925
270 Ga0068854_100130156 3300005578 Bacteria 1921
271 Ga0068854_100143186 3300005578 Bacteria 1836
272 Ga0068854_100171077 3300005578 Bacteria 1690
273 Ga0068856_100000705 3300005614 Bacteria 36291
274 Ga0068856_100012564 3300005614 Bacteria 8197
275 Ga0068856_100075058 3300005614 Bacteria 3349
276 Ga0068856_100152115 3300005614 Bacteria 2323
277 Ga0068856_100182771 3300005614 Bacteria 2110
278 Ga0068856_100193323 3300005614 Bacteria 2048
279 Ga0068856_100195161 3300005614 Bacteria 2038
280 Ga0068856_100340563 3300005614 Bacteria 1518
281 Ga0068856_100602185 3300005614 Bacteria 1120
282 Ga0068856_100756797 3300005614 Bacteria 991
283 Ga0068852_100002112 3300005616 Bacteria 13601
284 Ga0068852_100006970 3300005616 Bacteria 8223
285 Ga0068852_100008823 3300005616 Bacteria 7461
286 Ga0068852_100021913 3300005616 Bacteria 5112
287 Ga0068852_100024199 3300005616 Bacteria 4904
288 Ga0068852_100081313 3300005616 Bacteria 2875
289 Ga0068852_100104801 3300005616 Bacteria 2560
290 Ga0068852_100121377 3300005616 Bacteria 2393
291 Ga0068852_100251211 3300005616 Bacteria 1694
292 Ga0068852_100259385 3300005616 Bacteria 1668
293 Ga0068852_100281527 3300005616 Bacteria 1603
294 Ga0068852_100402452 3300005616 Bacteria 1347
295 Ga0068852_100476238 3300005616 Bacteria 1240
296 Ga0068852_100787465 3300005616 Bacteria 964
297 Ga0068852_100833321 3300005616 Bacteria 937
298 Ga0068859_100043942 3300005617 Bacteria 4490
299 Ga0068859_100251243 3300005617 Bacteria 1859
300 Ga0068864_100004115 3300005618 Bacteria 11935
301 Ga0068864_100032196 3300005618 Bacteria 4454
302 Ga0068864_100069096 3300005618 Bacteria 3071
303 Ga0068864_100098063 3300005618 Bacteria 2595
304 Ga0068864_100257100 3300005618 Bacteria 1623
305 Ga0068864_100286783 3300005618 Bacteria 1538
306 Ga0068864_100322090 3300005618 Bacteria 1452
307 Ga0068851_10017671 3300005834 Bacteria 3429
308 Ga0068851_10023959 3300005834 Bacteria 2986
309 Ga0068863_100000178 3300005841 Bacteria 67693
310 Ga0068863_100005577 3300005841 Bacteria 12367
311 Ga0068858_100049224 3300005842 Bacteria 3903
312 Ga0068858_100092446 3300005842 Bacteria 2816
313 Ga0068858_100180613 3300005842 Bacteria 1992
314 Ga0068858_100240528 3300005842 Bacteria 1718
315 Ga0068860_100005258 3300005843 Bacteria 13136
316 Ga0068860_100144550 3300005843 Bacteria 2288
317 Ga0068860_100173608 3300005843 Bacteria 2083
318 Ga0070717_10003959 3300006028 Bacteria 10658
319 Ga0070717_10260009 3300006028 Bacteria 1536
320 Ga0097621_100129132 3300006237 Bacteria 2149
321 Ga0097621_100135500 3300006237 Bacteria 2100
322 Ga0068871_100310210 3300006358 Bacteria 1387
323 Ga0068871_100437081 3300006358 Bacteria 1171
324 Ga0068871_100887925 3300006358 Bacteria 826
325 Ga0068871_101085655 3300006358 Bacteria 748
326 Ga0068865_100033860 3300006881 Bacteria 3423
327 Ga0068865_100375803 3300006881 Bacteria 1158
328 Ga0097620_100043943 3300006931 Bacteria 4490
329 Ga0097620_100251220 3300006931 Bacteria 1859
330 Ga0105240_10044834 3300009093 Bacteria 5615
331 Ga0105240_10050974 3300009093 Bacteria 5212
332 Ga0105240_11028662 3300009093 Bacteria 880
333 Ga0105245_10020695 3300009098 Bacteria 5768
334 Ga0105245_10152223 3300009098 Bacteria 2188
335 Ga0105243_10641258 3300009148 Bacteria 1028
336 Ga0105241_10271116 3300009174 Bacteria 1446
337 Ga0105241_10312447 3300009174 Bacteria 1352
338 Ga0105242_10299941 3300009176 Bacteria 1466
339 Ga0105242_10852802 3300009176 Bacteria 907
340 Ga0105248_10001371 3300009177 Bacteria 27204
341 Ga0105248_10001451 3300009177 Bacteria 26388
342 Ga0105248_10007514 3300009177 Bacteria 11959
343 Ga0105248_10012052 3300009177 Bacteria 9536
344 Ga0105248_10015837 3300009177 Bacteria 8311
345 Ga0105248_10034355 3300009177 Bacteria 5669
346 Ga0105248_10072761 3300009177 Bacteria 3863
347 Ga0105248_10495267 3300009177 Bacteria 1378
348 Ga0105237_10010769 3300009545 Bacteria 9706
349 Ga0105238_10019485 3300009551 Bacteria 6910
350 Ga0105238_10052464 3300009551 Bacteria 4099
351 Ga0105238_10549658 3300009551 Bacteria 1159
352 Ga0105238_10552376 3300009551 Bacteria 1156
353 Ga0105238_10670726 3300009551 Bacteria 1048
354 Ga0105239_10013539 3300010375 Bacteria 9055
355 Ga0105239_10107468 3300010375 Bacteria 3091
356 Ga0157373_10009059 3300013100 Bacteria 7365
357 Ga0157373_10029657 3300013100 Bacteria 3939
358 Ga0157373_10048202 3300013100 Bacteria 3038
359 Ga0157373_10060492 3300013100 Bacteria 2683
360 Ga0157373_10357386 3300013100 Bacteria 1042
361 Ga0157373_10387826 3300013100 Bacteria 1000
362 Ga0157373_10427380 3300013100 Bacteria 951
363 Ga0157373_10530460 3300013100 Bacteria 852
364 Ga0157371_10002958 3300013102 Bacteria 15800
365 Ga0157371_10008730 3300013102 Bacteria 8043
366 Ga0157371_10064531 3300013102 Bacteria 2595
367 Ga0157371_10088172 3300013102 Bacteria 2197
368 Ga0157371_10089900 3300013102 Bacteria 2175
369 Ga0157371_10167194 3300013102 Bacteria 1571
370 Ga0157371_10314405 3300013102 Bacteria 1136
371 Ga0157371_10473449 3300013102 Bacteria 923
372 Ga0157371_10782061 3300013102 Bacteria 718
373 Ga0157370_10000686 3300013104 Bacteria 42199
374 Ga0157370_10018083 3300013104 Bacteria 7095
375 Ga0157370_10064635 3300013104 Bacteria 3463
376 Ga0157370_10140762 3300013104 Bacteria 2248
377 Ga0157370_10146616 3300013104 Bacteria 2197
378 Ga0157370_10237842 3300013104 Bacteria 1685
379 Ga0157370_10526478 3300013104 Bacteria 1085
380 Ga0157369_10000407 3300013105 Bacteria 57129
381 Ga0157369_10000823 3300013105 Bacteria 39591
382 Ga0157369_10001783 3300013105 Bacteria 26058
383 Ga0157369_10079125 3300013105 Bacteria 3521
384 Ga0157369_10117615 3300013105 Bacteria 2821
385 Ga0157369_10128879 3300013105 Bacteria 2682
386 Ga0157369_10311711 3300013105 Bacteria 1636
387 Ga0157369_10355767 3300013105 Bacteria 1521
388 Ga0157369_10383694 3300013105 Bacteria 1458
389 Ga0157369_10637536 3300013105 Bacteria 1099
390 Ga0157369_10862383 3300013105 Bacteria 929
391 Ga0157369_11087937 3300013105 Bacteria 817
392 Ga0157374_10005930 3300013296 Bacteria 10325
393 Ga0157374_10053710 3300013296 Bacteria 3757
394 Ga0157374_10262628 3300013296 Bacteria 1701
395 Ga0157374_10956367 3300013296 Bacteria 875
396 Ga0163162_10119641 3300013306 Bacteria 2737
397 Ga0157372_10020101 3300013307 Bacteria 7200
398 Ga0157372_10178326 3300013307 Bacteria 2459
399 Ga0157372_10200910 3300013307 Bacteria 2309
400 Ga0157372_10261869 3300013307 Bacteria 2008
401 Ga0157372_10721069 3300013307 Bacteria 1160
402 Ga0157372_11825779 3300013307 Bacteria 699
403 Ga0157375_10017968 3300013308 Bacteria 6402
404 Ga0157375_10061424 3300013308 Bacteria 3731
405 Ga0157375_10624224 3300013308 Bacteria 1236
406 Ga0157375_10660373 3300013308 Bacteria 1201
407 Ga0157375_11075995 3300013308 Bacteria 941
408 Ga0163163_10000187 3300014325 Bacteria 63661
409 Ga0163163_10008745 3300014325 Bacteria 9010
410 Ga0163163_10155023 3300014325 Bacteria 2334
411 Ga0163163_10889426 3300014325 Bacteria 954
412 Ga0157379_10294607 3300014968 Bacteria 1478
413 Ga0163161_10075515 3300017792 Bacteria 2473
414 Ga0163161_10148413 3300017792 Bacteria 1780
415 Ga0206353_10074044 3300020082 Bacteria 1375
416 Ga0206353_11715536 3300020082 Bacteria 1471
417 Ga0213876_10027248 3300021384 Bacteria 3016
418 Ga0213875_10011727 3300021388 Bacteria 4350
419 Ga0209675_1000563 3300025291 Bacteria 26707
420 Ga0209676_1000435 3300025292 Bacteria 72233
421 Ga0209676_1000651 3300025292 Bacteria 49756
422 Ga0209676_1001179 3300025292 Bacteria 28285
423 Ga0209025_1007288 3300025294 Bacteria 8297
424 Ga0209050_1000310 3300025298 Bacteria 99292
425 Ga0209050_1002457 3300025298 Bacteria 15819
426 Ga0209257_1000245 3300025304 Bacteria 125987
427 Ga0209257_1000379 3300025304 Bacteria 88845
428 Ga0209257_1002319 3300025304 Bacteria 19233
429 Ga0209257_1017164 3300025304 Bacteria 2871
430 Ga0207656_10207577 3300025321 Bacteria 948
431 Ga0207682_10004480 3300025893 Bacteria 5829
432 Ga0207682_10033990 3300025893 Bacteria 2054
433 Ga0207682_10123218 3300025893 Bacteria 1151
434 Ga0207682_10149855 3300025893 Bacteria 1051
435 Ga0207688_10182252 3300025901 Bacteria 1253
436 Ga0207688_10185481 3300025901 Bacteria 1242
437 Ga0207680_10005938 3300025903 Bacteria 5867
438 Ga0207680_10007117 3300025903 Bacteria 5439
439 Ga0207680_10008819 3300025903 Bacteria 4969
440 Ga0207680_10014628 3300025903 Bacteria 4069
441 Ga0207680_10022289 3300025903 Bacteria 3442
442 Ga0207680_10605715 3300025903 Bacteria 784
443 Ga0207647_10001381 3300025904 Bacteria 18648
444 Ga0207647_10001456 3300025904 Bacteria 18185
445 Ga0207647_10010206 3300025904 Bacteria 6636
446 Ga0207647_10040280 3300025904 Bacteria 2944
447 Ga0207647_10041257 3300025904 Bacteria 2903
448 Ga0207647_10206541 3300025904 Bacteria 1135
449 Ga0207645_10033797 3300025907 Bacteria 3286
450 Ga0207645_10122622 3300025907 Bacteria 1688
451 Ga0207705_10000086 3300025909 Bacteria 116132
452 Ga0207705_10006209 3300025909 Bacteria 8881
453 Ga0207705_10008363 3300025909 Bacteria 7554
454 Ga0207705_10011590 3300025909 Bacteria 6374
455 Ga0207705_10012670 3300025909 Bacteria 6086
456 Ga0207705_10015255 3300025909 Bacteria 5517
457 Ga0207705_10023053 3300025909 Bacteria 4440
458 Ga0207705_10040477 3300025909 Bacteria 3343
459 Ga0207705_10048653 3300025909 Bacteria 3050
460 Ga0207705_10052814 3300025909 Bacteria 2927
461 Ga0207705_10072016 3300025909 Bacteria 2506
462 Ga0207705_10193872 3300025909 Bacteria 1537
463 Ga0207705_10298576 3300025909 Bacteria 1235
464 Ga0207705_10352190 3300025909 Bacteria 1134
465 Ga0207705_10439649 3300025909 Bacteria 1011
466 Ga0207705_10501189 3300025909 Bacteria 943
467 Ga0207707_10005588 3300025912 Bacteria 11001
468 Ga0207707_10035847 3300025912 Bacteria 4338
469 Ga0207707_10090820 3300025912 Bacteria 2669
470 Ga0207707_10171156 3300025912 Bacteria 1898
471 Ga0207707_10307236 3300025912 Bacteria 1371
472 Ga0207707_10599257 3300025912 Bacteria 933
473 Ga0207695_10006970 3300025913 Bacteria 14506
474 Ga0207695_10035556 3300025913 Bacteria 5400
475 Ga0207695_10127895 3300025913 Bacteria 2501
476 Ga0207695_10603603 3300025913 Bacteria 979
477 Ga0207671_10040914 3300025914 Bacteria 3430
478 Ga0207660_10000711 3300025917 Bacteria 22172
479 Ga0207660_10016540 3300025917 Bacteria 4884
480 Ga0207660_10087640 3300025917 Bacteria 2300
481 Ga0207660_10184895 3300025917 Bacteria 1620
482 Ga0207660_10376496 3300025917 Bacteria 1141
483 Ga0207660_10409318 3300025917 Bacteria 1093
484 Ga0207662_10035033 3300025918 Bacteria 2930
485 Ga0207657_10000133 3300025919 Bacteria 75282
486 Ga0207657_10001177 3300025919 Bacteria 27752
487 Ga0207657_10002861 3300025919 Bacteria 18555
488 Ga0207657_10007733 3300025919 Bacteria 10976
489 Ga0207657_10024605 3300025919 Bacteria 5570
490 Ga0207657_10031556 3300025919 Bacteria 4798
491 Ga0207657_10035921 3300025919 Bacteria 4439
492 Ga0207657_10036355 3300025919 Bacteria 4408
493 Ga0207657_10054053 3300025919 Bacteria 3475
494 Ga0207657_10056827 3300025919 Bacteria 3374
495 Ga0207657_10057120 3300025919 Bacteria 3365
496 Ga0207657_10059403 3300025919 Bacteria 3285
497 Ga0207657_10072397 3300025919 Bacteria 2916
498 Ga0207657_10076561 3300025919 Bacteria 2822
499 Ga0207657_10109217 3300025919 Bacteria 2286
500 Ga0207657_10138363 3300025919 Bacteria 1991
501 Ga0207657_10344149 3300025919 Bacteria 1177
502 Ga0207657_10470248 3300025919 Bacteria 986
503 Ga0207657_10605787 3300025919 Bacteria 854
504 Ga0207657_10707003 3300025919 Bacteria 782
505 Ga0207649_10000378 3300025920 Bacteria 33311
506 Ga0207649_10004499 3300025920 Bacteria 7562
507 Ga0207649_10006156 3300025920 Bacteria 6513
508 Ga0207649_10022730 3300025920 Bacteria 3623
509 Ga0207649_10023114 3300025920 Bacteria 3598
510 Ga0207649_10040298 3300025920 Bacteria 2838
511 Ga0207649_10044741 3300025920 Bacteria 2711
512 Ga0207649_10057966 3300025920 Bacteria 2423
513 Ga0207649_10096667 3300025920 Bacteria 1946
514 Ga0207649_10164991 3300025920 Bacteria 1538
515 Ga0207649_10337593 3300025920 Bacteria 1112
516 Ga0207652_10115194 3300025921 Bacteria 2387
517 Ga0207652_10128090 3300025921 Bacteria 2262
518 Ga0207652_10227468 3300025921 Bacteria 1681
519 Ga0207652_10316497 3300025921 Bacteria 1409
520 Ga0207652_10406594 3300025921 Bacteria 1228
521 Ga0207652_10466938 3300025921 Bacteria 1137
522 Ga0207652_10537508 3300025921 Bacteria 1051
523 Ga0207652_10838757 3300025921 Bacteria 814
524 Ga0207681_10001740 3300025923 Bacteria 13976
525 Ga0207681_10055073 3300025923 Bacteria 2707
526 Ga0207694_10001964 3300025924 Bacteria 17016
527 Ga0207694_10057322 3300025924 Bacteria 3028
528 Ga0207650_10002035 3300025925 Bacteria 14156
529 Ga0207650_10028542 3300025925 Bacteria 4002
530 Ga0207650_10296609 3300025925 Bacteria 1319
531 Ga0207650_10915959 3300025925 Bacteria 745
532 Ga0207659_10021624 3300025926 Bacteria 4274
533 Ga0207659_10157434 3300025926 Bacteria 1780
534 Ga0207659_10410769 3300025926 Bacteria 1134
535 Ga0207700_10171740 3300025928 Bacteria 1809
536 Ga0207700_10527050 3300025928 Bacteria 1047
537 Ga0207664_10072803 3300025929 Bacteria 2772
538 Ga0207664_10075297 3300025929 Bacteria 2728
539 Ga0207664_10101062 3300025929 Bacteria 2382
540 Ga0207664_10131175 3300025929 Bacteria 2110
541 Ga0207664_10536803 3300025929 Bacteria 1049
542 Ga0207644_10000656 3300025931 Bacteria 21901
543 Ga0207644_10000810 3300025931 Bacteria 19859
544 Ga0207644_10000892 3300025931 Bacteria 18859
545 Ga0207644_10015229 3300025931 Bacteria 5159
546 Ga0207644_10025888 3300025931 Bacteria 4037
547 Ga0207644_10057697 3300025931 Bacteria 2804
548 Ga0207644_10228630 3300025931 Bacteria 1477
549 Ga0207644_10358558 3300025931 Bacteria 1185
550 Ga0207690_10000080 3300025932 Bacteria 82082
551 Ga0207690_10004717 3300025932 Bacteria 8049
552 Ga0207690_10005265 3300025932 Bacteria 7623
553 Ga0207690_10011578 3300025932 Bacteria 5269
554 Ga0207690_10094282 3300025932 Bacteria 2123
555 Ga0207690_10117985 3300025932 Bacteria 1922
556 Ga0207690_10137401 3300025932 Bacteria 1796
557 Ga0207690_10144746 3300025932 Bacteria 1756
558 Ga0207690_10177674 3300025932 Bacteria 1600
559 Ga0207690_10205872 3300025932 Bacteria 1497
560 Ga0207690_10312281 3300025932 Bacteria 1233
561 Ga0207690_10332471 3300025932 Bacteria 1197
562 Ga0207690_10332540 3300025932 Bacteria 1197
563 Ga0207690_10388887 3300025932 Bacteria 1110
564 Ga0207690_10681185 3300025932 Bacteria 844
565 Ga0207690_10697975 3300025932 Bacteria 834
566 Ga0207706_10000159 3300025933 Bacteria 75284
567 Ga0207706_10000255 3300025933 Bacteria 58025
568 Ga0207706_10002178 3300025933 Bacteria 19113
569 Ga0207706_10002993 3300025933 Bacteria 16287
570 Ga0207706_10003045 3300025933 Bacteria 16158
571 Ga0207706_10015017 3300025933 Bacteria 7012
572 Ga0207706_10021322 3300025933 Bacteria 5821
573 Ga0207706_10030118 3300025933 Bacteria 4842
574 Ga0207706_10066839 3300025933 Bacteria 3164
575 Ga0207706_10068352 3300025933 Bacteria 3126
576 Ga0207706_10079929 3300025933 Bacteria 2875
577 Ga0207706_10084251 3300025933 Bacteria 2795
578 Ga0207706_10138953 3300025933 Bacteria 2137
579 Ga0207706_10167340 3300025933 Bacteria 1932
580 Ga0207706_10222335 3300025933 Bacteria 1653
581 Ga0207706_10709300 3300025933 Bacteria 859
582 Ga0207669_10007854 3300025937 Bacteria 4968
583 Ga0207669_10024724 3300025937 Bacteria 3233
584 Ga0207669_10275716 3300025937 Bacteria 1266
585 Ga0207669_10307044 3300025937 Bacteria 1208
586 Ga0207669_10349834 3300025937 Bacteria 1141
587 Ga0207704_10061087 3300025938 Bacteria 2335
588 Ga0207665_10098665 3300025939 Bacteria 2036
589 Ga0207691_10000926 3300025940 Bacteria 29127
590 Ga0207691_10000965 3300025940 Bacteria 28542
591 Ga0207691_10026492 3300025940 Bacteria 5439
592 Ga0207691_10062910 3300025940 Bacteria 3366
593 Ga0207691_10175086 3300025940 Bacteria 1877
594 Ga0207691_10185603 3300025940 Bacteria 1816
595 Ga0207691_10222498 3300025940 Bacteria 1636
596 Ga0207691_10778747 3300025940 Bacteria 805
597 Ga0207711_10000744 3300025941 Bacteria 31965
598 Ga0207711_10002185 3300025941 Bacteria 17575
599 Ga0207711_10003526 3300025941 Bacteria 13544
600 Ga0207711_10008994 3300025941 Bacteria 8350
601 Ga0207711_10012570 3300025941 Bacteria 7034
602 Ga0207711_10076604 3300025941 Bacteria 2913
603 Ga0207711_10321478 3300025941 Bacteria 1430
604 Ga0207711_10625216 3300025941 Bacteria 1005
605 Ga0207689_10089895 3300025942 Bacteria 2523
606 Ga0207661_10001549 3300025944 Bacteria 15638
607 Ga0207661_10027951 3300025944 Bacteria 4314
608 Ga0207661_10117244 3300025944 Bacteria 2261
609 Ga0207661_10546325 3300025944 Bacteria 1061
610 Ga0207679_10000155 3300025945 Bacteria 56504
611 Ga0207679_10003647 3300025945 Bacteria 9542
612 Ga0207679_10004206 3300025945 Bacteria 8945
613 Ga0207679_10006641 3300025945 Bacteria 7321
614 Ga0207679_10023013 3300025945 Bacteria 4253
615 Ga0207679_10028940 3300025945 Bacteria 3852
616 Ga0207679_10035538 3300025945 Bacteria 3527
617 Ga0207679_10088787 3300025945 Bacteria 2384
618 Ga0207679_10339379 3300025945 Bacteria 1306
619 Ga0207679_10442109 3300025945 Bacteria 1152
620 Ga0207667_10004439 3300025949 Bacteria 17176
621 Ga0207667_10011412 3300025949 Bacteria 10327
622 Ga0207667_10040922 3300025949 Bacteria 4932
623 Ga0207667_10059703 3300025949 Bacteria 3993
624 Ga0207667_10066806 3300025949 Bacteria 3748
625 Ga0207667_10140685 3300025949 Bacteria 2485
626 Ga0207667_10203377 3300025949 Bacteria 2031
627 Ga0207667_10256379 3300025949 Bacteria 1789
628 Ga0207667_10289616 3300025949 Bacteria 1673
629 Ga0207667_10365274 3300025949 Bacteria 1472
630 Ga0207667_10481785 3300025949 Bacteria 1259
631 Ga0207667_10517245 3300025949 Bacteria 1209
632 Ga0207667_10538856 3300025949 Bacteria 1181
633 Ga0207667_10576857 3300025949 Bacteria 1136
634 Ga0207667_10626209 3300025949 Bacteria 1083
635 Ga0207667_10665961 3300025949 Bacteria 1045
636 Ga0207667_10683821 3300025949 Bacteria 1029
637 Ga0207651_10004095 3300025960 Bacteria 7274
638 Ga0207651_10004660 3300025960 Bacteria 6950
639 Ga0207651_10013504 3300025960 Bacteria 4676
640 Ga0207651_10191607 3300025960 Bacteria 1631
641 Ga0207651_10257631 3300025960 Bacteria 1430
642 Ga0207668_10000079 3300025972 Bacteria 72795
643 Ga0207640_10005286 3300025981 Bacteria 7034
644 Ga0207640_10043194 3300025981 Bacteria 2880
645 Ga0207640_10127241 3300025981 Bacteria 1836
646 Ga0207640_10129347 3300025981 Bacteria 1823
647 Ga0207640_10136720 3300025981 Bacteria 1780
648 Ga0207640_10173625 3300025981 Bacteria 1609
649 Ga0207658_10000180 3300025986 Bacteria 67969
650 Ga0207658_10015617 3300025986 Bacteria 5211
651 Ga0207658_10015618 3300025986 Bacteria 5211
652 Ga0207658_10023378 3300025986 Bacteria 4314
653 Ga0207658_10433006 3300025986 Bacteria 1162
654 Ga0207677_10023936 3300026023 Bacteria 3782
655 Ga0207677_10088686 3300026023 Bacteria 2243
656 Ga0207677_10581500 3300026023 Bacteria 980
657 Ga0207703_10010603 3300026035 Bacteria 7201
658 Ga0207703_10275919 3300026035 Bacteria 1525
659 Ga0207639_10000137 3300026041 Bacteria 54378
660 Ga0207639_10001284 3300026041 Bacteria 16946
661 Ga0207639_10102760 3300026041 Bacteria 2314
662 Ga0207639_10151577 3300026041 Bacteria 1942
663 Ga0207639_10160989 3300026041 Bacteria 1891
664 Ga0207639_10177388 3300026041 Bacteria 1809
665 Ga0207639_10542520 3300026041 Bacteria 1067
666 Ga0207639_10568704 3300026041 Bacteria 1042
667 Ga0207639_10679060 3300026041 Bacteria 954
668 Ga0207639_11001763 3300026041 Bacteria 782
669 Ga0207678_10000973 3300026067 Bacteria 26103
670 Ga0207678_10003440 3300026067 Bacteria 14260
671 Ga0207678_10004199 3300026067 Bacteria 12929
672 Ga0207678_10011875 3300026067 Bacteria 7648
673 Ga0207678_10012002 3300026067 Bacteria 7610
674 Ga0207678_10013248 3300026067 Bacteria 7236
675 Ga0207678_10113165 3300026067 Bacteria 2315
676 Ga0207678_10150477 3300026067 Bacteria 1987
677 Ga0207678_10167683 3300026067 Bacteria 1875
678 Ga0207678_10218191 3300026067 Bacteria 1632
679 Ga0207678_10487854 3300026067 Bacteria 1073
680 Ga0207678_10502305 3300026067 Bacteria 1057
681 Ga0207702_10000246 3300026078 Bacteria 63201
682 Ga0207702_10019937 3300026078 Bacteria 5556
683 Ga0207702_10050920 3300026078 Bacteria 3498
684 Ga0207702_10070804 3300026078 Bacteria 3000
685 Ga0207702_10073124 3300026078 Bacteria 2955
686 Ga0207702_10111533 3300026078 Bacteria 2432
687 Ga0207702_10140025 3300026078 Bacteria 2188
688 Ga0207702_10206789 3300026078 Bacteria 1823
689 Ga0207702_10344058 3300026078 Bacteria 1425
690 Ga0207702_10364495 3300026078 Bacteria 1386
691 Ga0207702_10515357 3300026078 Bacteria 1167
692 Ga0207702_10526528 3300026078 Bacteria 1154
693 Ga0207641_10000256 3300026088 Bacteria 67708
694 Ga0207641_10030030 3300026088 Bacteria 4499
695 Ga0207648_10002746 3300026089 Bacteria 18708
696 Ga0207648_10175494 3300026089 Bacteria 1895
697 Ga0207676_10055230 3300026095 Bacteria 3116
698 Ga0207676_10094583 3300026095 Bacteria 2462
699 Ga0207676_10269433 3300026095 Bacteria 1541
700 Ga0207676_10289152 3300026095 Bacteria 1491
701 Ga0207676_11009548 3300026095 Bacteria 820
702 Ga0207674_10004899 3300026116 Bacteria 16018
703 Ga0207674_10012992 3300026116 Bacteria 9280
704 Ga0207674_10018670 3300026116 Bacteria 7532
705 Ga0207674_10034836 3300026116 Bacteria 5258
706 Ga0207674_10064334 3300026116 Bacteria 3700
707 Ga0207674_10177549 3300026116 Bacteria 2082
708 Ga0207683_10002872 3300026121 Bacteria 15018
709 Ga0207683_10004561 3300026121 Bacteria 11929
710 Ga0207683_10007564 3300026121 Bacteria 9307
711 Ga0207683_10039722 3300026121 Bacteria 4106
712 Ga0207683_10046329 3300026121 Bacteria 3805
713 Ga0207683_10217735 3300026121 Bacteria 1739
714 Ga0207683_10541921 3300026121 Bacteria 1076
715 Ga0207698_10001619 3300026142 Bacteria 13098
716 Ga0207698_10001854 3300026142 Bacteria 12343
717 Ga0207698_10002932 3300026142 Bacteria 10202
718 Ga0207698_10003776 3300026142 Bacteria 9157
719 Ga0207698_10006751 3300026142 Bacteria 7169
720 Ga0207698_10077796 3300026142 Bacteria 2661
721 Ga0207698_10175991 3300026142 Bacteria 1889
722 Ga0207698_10191769 3300026142 Bacteria 1821
723 Ga0207698_10219689 3300026142 Bacteria 1716
724 Ga0207698_10320571 3300026142 Bacteria 1451
725 Ga0207698_10449317 3300026142 Bacteria 1244
726 Ga0207698_10460633 3300026142 Bacteria 1230
727 Ga0207698_10573614 3300026142 Bacteria 1109
728 Ga0268266_10006664 3300028379 Bacteria 10537
729 Ga0268266_10307593 3300028379 Bacteria 1480
730 Ga0268266_10484597 3300028379 Bacteria 1179
731 Ga0268264_10009751 3300028381 Bacteria 7951
732 Ga0268264_10095412 3300028381 Bacteria 2574
733 Ga0268264_10266100 3300028381 Bacteria 1600
734 Ga0268264_10504436 3300028381 Bacteria 1181
735 Ga0316183_1070022 3300030742 Bacteria 1195
736 Ga0307513_10110056 3300031456 Bacteria 2751
737 Ga0307513_10585415 3300031456 Bacteria 826
738 Ga0307408_100121145 3300031548 Bacteria 2026
739 Ga0316576_10020204 3300031727 Bacteria 4577
740 Ga0307413_10125564 3300031824 Bacteria 1746
741 Ga0307413_10272032 3300031824 Bacteria 1269
742 Ga0307413_10380718 3300031824 Bacteria 1099
743 Ga0307406_10081730 3300031901 Bacteria 2149
744 Ga0307406_10193313 3300031901 Bacteria 1491
745 Ga0307406_10245341 3300031901 Bacteria 1346
746 Ga0307406_10536361 3300031901 Bacteria 955
747 Ga0307407_10519987 3300031903 Bacteria 875
748 Ga0307412_10008170 3300031911 Bacteria 5966
749 Ga0307412_10069387 3300031911 Bacteria 2399
750 Ga0307409_100019646 3300031995 Bacteria 4581
751 Ga0307409_100061380 3300031995 Bacteria 2937
752 Ga0307409_100103585 3300031995 Bacteria 2367
753 Ga0307409_100243607 3300031995 Bacteria 1638
754 Ga0307409_100411279 3300031995 Bacteria 1295
755 Ga0307416_101018825 3300032002 Bacteria 931
756 Ga0307416_101537883 3300032002 Bacteria 771
757 Ga0307414_10000172 3300032004 Bacteria 43715
758 Ga0307414_10019216 3300032004 Bacteria 4228
759 Ga0307414_10039895 3300032004 Bacteria 3167
760 Ga0307414_10096348 3300032004 Bacteria 2213
761 Ga0307414_10209105 3300032004 Bacteria 1593
762 Ga0307414_10359906 3300032004 Bacteria 1252
763 Ga0307414_10680128 3300032004 Bacteria 930
764 Ga0307411_10020238 3300032005 Bacteria 3865
765 Ga0307411_10032101 3300032005 Bacteria 3241
766 Ga0307411_10175929 3300032005 Bacteria 1619
767 Ga0307411_10180405 3300032005 Bacteria 1602
768 Ga0307411_10358860 3300032005 Bacteria 1191
769 Ga0307415_100000364 3300032126 Bacteria 19313
770 Ga0307415_100157617 3300032126 Bacteria 1755
771 Ga0373940_0021905 3300035088 Bacteria 1638
772 Ga0373923_0039690 3300035111 Bacteria 1934
773 Ga0373953_0130300 3300035117 Bacteria 1072
774 Ga0373954_0015739 3300035118 Bacteria 3383
775 Ga0373943_0007559 3300035170 Bacteria 4881
776 Ga0373955_0002938 3300035172 Bacteria 7470
777 Ga0373935_0068434 3300035692 Bacteria 2285
778 Ga0373927_0101826 3300035695 Bacteria 1868
779 Ga0373933_0017201 3300035724 Bacteria 4054
780 Ga0373947_0056008 3300035725 Bacteria 2382
781 Ga0373937_0008086 3300036401 Bacteria 9130
782 Ga0373925_0324439 3300037068 Bacteria 1246
783 Ga0395899_0004378 3300037312 Bacteria 11010
784 Ga0395899_0009083 3300037312 Bacteria 7637
785 Ga0395899_0026252 3300037312 Bacteria 4395
786 Ga0395899_0030162 3300037312 Bacteria 4079
787 Ga0395899_0034693 3300037312 Bacteria 3789
788 Ga0395899_0036423 3300037312 Bacteria 3691
789 Ga0395899_0053426 3300037312 Bacteria 2991
790 Ga0395899_0073457 3300037312 Bacteria 2500
791 Ga0395899_0083038 3300037312 Bacteria 2330
792 Ga0395899_0103504 3300037312 Bacteria 2053
793 Ga0395899_0114025 3300037312 Bacteria 1941
794 Ga0395899_0170533 3300037312 Bacteria 1533
795 Ga0395899_0457420 3300037312 Bacteria 835
796 Ga0395899_0482101 3300037312 Bacteria 807
797 Ga0395899_0489858 3300037312 Bacteria 799
798 Ga0395900_0000192 3300037418 Bacteria 98186
799 Ga0395900_0000605 3300037418 Bacteria 49062
800 Ga0395900_0007106 3300037418 Bacteria 11598
801 Ga0395900_0036057 3300037418 Bacteria 5096
802 Ga0395900_0051097 3300037418 Bacteria 4258
803 Ga0395900_0055607 3300037418 Bacteria 4075
804 Ga0395900_0058668 3300037418 Bacteria 3962
805 Ga0395900_0061192 3300037418 Bacteria 3872
806 Ga0395900_0061809 3300037418 Bacteria 3850
807 Ga0395900_0072413 3300037418 Bacteria 3543
808 Ga0395900_0080857 3300037418 Bacteria 3339
809 Ga0395900_0090507 3300037418 Bacteria 3145
810 Ga0395900_0155034 3300037418 Bacteria 2339
811 Ga0395900_0179656 3300037418 Bacteria 2151
812 Ga0395900_0183756 3300037418 Bacteria 2123
813 Ga0395900_0214332 3300037418 Bacteria 1943
814 Ga0395900_0215400 3300037418 Bacteria 1938
815 Ga0395900_0219135 3300037418 Bacteria 1919
816 Ga0395900_0241083 3300037418 Bacteria 1813
817 Ga0395900_0289362 3300037418 Bacteria 1627
818 Ga0395900_0326469 3300037418 Bacteria 1513
819 Ga0395900_0350590 3300037418 Bacteria 1449
820 Ga0395900_0359661 3300037418 Bacteria 1427
821 Ga0395900_0411276 3300037418 Bacteria 1315
822 Ga0395900_0550502 3300037418 Bacteria 1098
823 Ga0395900_0570000 3300037418 Bacteria 1075
824 Ga0395900_0574719 3300037418 Bacteria 1069
825 Ga0395900_0586485 3300037418 Bacteria 1056
826 Ga0395900_0610473 3300037418 Bacteria 1030
827 Ga0395900_0681563 3300037418 Bacteria 962
828 Ga0395900_0792504 3300037418 Bacteria 876
829 Ga0395898_0001129 3300037466 Bacteria 40961
830 Ga0395898_0003738 3300037466 Bacteria 16877
831 Ga0395898_0011773 3300037466 Bacteria 9067
832 Ga0395898_0029448 3300037466 Bacteria 5500
833 Ga0395898_0031906 3300037466 Bacteria 5260
834 Ga0395898_0042068 3300037466 Bacteria 4510
835 Ga0395898_0047931 3300037466 Bacteria 4191
836 Ga0395898_0070952 3300037466 Bacteria 3367
837 Ga0395898_0122081 3300037466 Bacteria 2496
838 Ga0395898_0136377 3300037466 Bacteria 2350
839 Ga0395898_0168757 3300037466 Bacteria 2092
840 Ga0395898_0177449 3300037466 Bacteria 2036
841 Ga0395898_0226453 3300037466 Bacteria 1783
842 Ga0395898_0250581 3300037466 Bacteria 1689
843 Ga0395898_0264317 3300037466 Bacteria 1641
844 Ga0395898_0313339 3300037466 Bacteria 1497
845 Ga0395898_0667766 3300037466 Bacteria 981
846 Ga0395898_0670119 3300037466 Bacteria 979
847 Ga0395905_0000109 3300037471 Bacteria 137754
848 Ga0395905_0000187 3300037471 Bacteria 98895
849 Ga0395905_0002154 3300037471 Bacteria 22324
850 Ga0395905_0006616 3300037471 Bacteria 11625
851 Ga0395905_0025223 3300037471 Bacteria 5607
852 Ga0395905_0027230 3300037471 Bacteria 5390
853 Ga0395905_0028287 3300037471 Bacteria 5283
854 Ga0395905_0029352 3300037471 Bacteria 5181
855 Ga0395905_0033872 3300037471 Bacteria 4798
856 Ga0395905_0039368 3300037471 Bacteria 4435
857 Ga0395905_0042141 3300037471 Bacteria 4283
858 Ga0395905_0049315 3300037471 Bacteria 3945
859 Ga0395905_0108633 3300037471 Bacteria 2604
860 Ga0395905_0117672 3300037471 Bacteria 2497
861 Ga0395905_0130213 3300037471 Bacteria 2366
862 Ga0395905_0142446 3300037471 Bacteria 2255
863 Ga0395905_0158899 3300037471 Bacteria 2125
864 Ga0395905_0181629 3300037471 Bacteria 1975
865 Ga0395905_0182779 3300037471 Bacteria 1969
866 Ga0395905_0280826 3300037471 Bacteria 1551
867 Ga0395905_0281084 3300037471 Bacteria 1550
868 Ga0395905_0356849 3300037471 Bacteria 1354
869 Ga0395905_0374954 3300037471 Bacteria 1316
870 Ga0395905_0390295 3300037471 Bacteria 1286
871 Ga0395905_0434626 3300037471 Bacteria 1209
872 Ga0395905_0464968 3300037471 Bacteria 1163
873 Ga0395905_0565474 3300037471 Bacteria 1038
874 Ga0436364_1351497 3300037853 Bacteria 37033
875 Ga0395901_0000041 3300038443 Bacteria 202314
876 Ga0395901_0007639 3300038443 Bacteria 10912
877 Ga0395901_0013118 3300038443 Bacteria 8410
878 Ga0395901_0013360 3300038443 Bacteria 8344
879 Ga0395901_0030568 3300038443 Bacteria 5549
880 Ga0395901_0031771 3300038443 Bacteria 5444
881 Ga0395901_0035701 3300038443 Bacteria 5137
882 Ga0395901_0037112 3300038443 Bacteria 5040
883 Ga0395901_0038923 3300038443 Bacteria 4918
884 Ga0395901_0057791 3300038443 Bacteria 4034
885 Ga0395901_0069305 3300038443 Bacteria 3673
886 Ga0395901_0074062 3300038443 Bacteria 3552
887 Ga0395901_0088925 3300038443 Bacteria 3231
888 Ga0395901_0089778 3300038443 Bacteria 3215
889 Ga0395901_0095770 3300038443 Bacteria 3110
890 Ga0395901_0128119 3300038443 Bacteria 2667
891 Ga0395901_0156521 3300038443 Bacteria 2393
892 Ga0395901_0206096 3300038443 Bacteria 2060
893 Ga0395901_0230938 3300038443 Bacteria 1931
894 Ga0395901_0386550 3300038443 Bacteria 1439
895 Ga0395901_0551323 3300038443 Bacteria 1168
896 Ga0395901_0928889 3300038443 Bacteria 850
897 Ga0395901_1123004 3300038443 Bacteria 755
898 Ga0436365_0252769 3300039437 Bacteria 10567
899 Ga0439436_0064799 3300041404 Bacteria 1021
900 Ga0439448_0021361 3300042005 Bacteria 2006
901 Ga0439448_0066848 3300042005 Bacteria 1194
902 Ga0439448_0151430 3300042005 Bacteria 805
903 Ga0439432_060816 3300042006 Bacteria 1165
904 Ga0439432_083516 3300042006 Bacteria 966
905 Ga0450892_006643 3300042130 Bacteria 965
906 Ga0439458_0000134 3300042157 Bacteria 15726
907 Ga0466969_0044867 3300044656 Bacteria 2197
908 Ga0466972_0048226 3300044658 Bacteria 2058
909 Ga0466965_0045810 3300044683 Bacteria 2164
910 Ga0466965_0047661 3300044683 Bacteria 2122
911 Ga0466965_0174651 3300044683 Bacteria 1132
912 Ga0466965_0196599 3300044683 Bacteria 1068
913 Ga0466966_0000315 3300044684 Bacteria 31212
914 Ga0466966_0004143 3300044684 Bacteria 9576
915 Ga0466966_0055259 3300044684 Bacteria 2513
916 Ga0466966_0074540 3300044684 Bacteria 2121
917 Ga0466966_0092760 3300044684 Bacteria 1873
918 Ga0466966_0120045 3300044684 Bacteria 1615
919 Ga0466966_0156182 3300044684 Bacteria 1390
920 Ga0466966_0174323 3300044684 Bacteria 1306
921 Ga0466966_0250981 3300044684 Bacteria 1066
922 Ga0466961_0024915 3300044693 Bacteria 3849
923 Ga0466961_0050574 3300044693 Bacteria 2654
924 Ga0466961_0051000 3300044693 Bacteria 2643
925 Ga0466961_0122377 3300044693 Bacteria 1633
926 Ga0466961_0244039 3300044693 Bacteria 1104
927 Ga0466961_0291035 3300044693 Bacteria 999
928 Ga0466963_0010173 3300044694 Bacteria 5688
929 Ga0466963_0027784 3300044694 Bacteria 3627
930 Ga0466963_0040764 3300044694 Bacteria 3044
931 Ga0466963_0114922 3300044694 Bacteria 1849
932 Ga0466963_0162869 3300044694 Bacteria 1553
933 Ga0466963_0198462 3300044694 Bacteria 1403
934 Ga0466963_0311009 3300044694 Bacteria 1108
935 Ga0466963_0633197 3300044694 Bacteria 755
936 Ga0466964_0225265 3300044706 Bacteria 912
937 Ga0466964_0293274 3300044706 Bacteria 817
938 Ga0466971_0021929 3300044719 Bacteria 2843
939 Ga0466971_0057700 3300044719 Bacteria 1752
940 Ga0466971_0062662 3300044719 Bacteria 1683
941 Ga0466968_0022389 3300044735 Bacteria 2568
942 Ga0466970_0003329 3300044765 Bacteria 7817
943 Ga0466970_0016667 3300044765 Bacteria 3792
944 Ga0466970_0095969 3300044765 Bacteria 1612
945 Ga0466970_0121439 3300044765 Bacteria 1431
946 Ga0466970_0183450 3300044765 Bacteria 1161
947 Ga0466957_0009707 3300044842 Bacteria 5496
948 Ga0466957_0012172 3300044842 Bacteria 4978
949 Ga0466957_0024075 3300044842 Bacteria 3603
950 Ga0466957_0102757 3300044842 Bacteria 1803
951 Ga0466960_0033802 3300044901 Bacteria 2379
952 Ga0466960_0035956 3300044901 Bacteria 2318
953 Ga0466959_0047926 3300045049 Bacteria 3142
954 Ga0466959_0057935 3300045049 Bacteria 2823
955 Ga0466959_0110060 3300045049 Bacteria 1966
956 Ga0466959_0331208 3300045049 Bacteria 1040
957 Ga0466958_0016669 3300045836 Bacteria 4234
958 Ga0466958_0042520 3300045836 Bacteria 2736
959 Ga0466958_0076409 3300045836 Bacteria 2055
960 Ga0466958_0161531 3300045836 Bacteria 1415
961 Ga0466958_0283648 3300045836 Bacteria 1062
962 Ga0466967_0004243 3300045976 Bacteria 9622
963 Ga0466967_0004539 3300045976 Bacteria 9393
964 Ga0466967_0017060 3300045976 Bacteria 5749
965 Ga0466967_0059026 3300045976 Bacteria 3393
966 Ga0466967_0154906 3300045976 Bacteria 2145
967 Ga0466967_0184774 3300045976 Bacteria 1968
968 Ga0466967_0265372 3300045976 Bacteria 1643
969 Ga0466967_0323247 3300045976 Bacteria 1488
970 Ga0466967_0323264 3300045976 Bacteria 1488
971 Ga0466967_0463969 3300045976 Bacteria 1239
972 Ga0466967_0573786 3300045976 Bacteria 1112
973 Ga0466967_0634022 3300045976 Bacteria 1056
974 Ga0466967_0767515 3300045976 Bacteria 956
975 Ga0466967_0820954 3300045976 Bacteria 923
976 Ga0466967_0852389 3300045976 Bacteria 905
977 Ga0466967_0868741 3300045976 Bacteria 896
978 Ga0466967_0983231 3300045976 Bacteria 840
979 Ga0466967_1289667 3300045976 Bacteria 727
980 Ga0495650_0003691 3300046471 Bacteria 10960
981 Ga0495582_0344488 3300046473 Bacteria 858
982 Ga0495606_0145845 3300046507 Bacteria 1394
983 Ga0495610_0219218 3300046512 Bacteria 769
984 Ga0495642_0032662 3300046528 Bacteria 2089
985 Ga0495642_0082667 3300046528 Bacteria 1354
986 Ga0495587_0203892 3300046536 Unclassified 1118
987 Ga0495598_0000354 3300046537 Bacteria 8210
988 Ga0495621_0000064 3300046539 Bacteria 20546
989 Ga0495668_0000004 3300046616 Bacteria 574236
990 Ga0495668_0046220 3300046616 Bacteria 2418
991 Ga0495625_0000955 3300046660 Bacteria 38571
992 Ga0495625_0117641 3300046660 Bacteria 1812
993 Ga0495669_0001578 3300046684 Bacteria 9372
994 Ga0495669_0001675 3300046684 Bacteria 9076
995 Ga0495669_0002837 3300046684 Bacteria 7112
996 Ga0495669_0016653 3300046684 Bacteria 3149
997 Ga0495669_0020251 3300046684 Bacteria 2877
998 Ga0495669_0063397 3300046684 Bacteria 1676
999 Ga0495670_0000346 3300046691 Bacteria 22049
1000 Ga0495670_0187632 3300046691 Bacteria 1093
1001 Ga0495677_0037518 3300047445 Bacteria 1770
1002 Ga0495685_126577 3300047447 Bacteria 837
1003 Ga0495681_0056950 3300047470 Bacteria 1817
1004 Ga0495602_0050257 3300048088 Bacteria 3727
1005 Ga0496100_0008370 3300048903 Bacteria 5765
1006 Ga0496100_0157809 3300048903 Bacteria 1624
1007 Ga0496100_0293475 3300048903 Bacteria 1215
1008 Ga0496100_0299083 3300048903 Bacteria 1204
1009 Ga0496101_0623762 3300048904 Bacteria 852
1010 Ga0496102_0166675 3300048905 Bacteria 2073
1011 Ga0496102_0233237 3300048905 Bacteria 1735
1012 Ga0496102_0242635 3300048905 Bacteria 1699
1013 Ga0496102_0426603 3300048905 Bacteria 1245
1014 Ga0496102_0482565 3300048905 Bacteria 1161
1015 Ga0496103_0269164 3300048906 Bacteria 1096
1016 Ga0496103_0367997 3300048906 Bacteria 924
1017 Ga0496104_0119290 3300048907 Bacteria 2533
1018 Ga0496106_0004149 3300048909 Bacteria 10801
1019 Ga0496106_0274125 3300048909 Bacteria 1351
1020 Ga0496107_0013433 3300048910 Bacteria 5723
1021 Ga0496107_0430084 3300048910 Bacteria 981
1022 Ga0496108_0002723 3300048911 Bacteria 14131
1023 Ga0496108_0004380 3300048911 Bacteria 11366
1024 Ga0496108_0011863 3300048911 Bacteria 7088
1025 Ga0496108_0051136 3300048911 Bacteria 3461
1026 Ga0496108_0283727 3300048911 Bacteria 1441
1027 Ga0496109_0003002 3300048912 Bacteria 14099
1028 Ga0496109_0017473 3300048912 Bacteria 6290
1029 Ga0496109_0045279 3300048912 Bacteria 3991
1030 Ga0496109_0060780 3300048912 Bacteria 3453
1031 Ga0496109_0280719 3300048912 Bacteria 1570
1032 Ga0496110_0000298 3300048913 Bacteria 32511
1033 Ga0496110_0053866 3300048913 Bacteria 3538
1034 Ga0496110_0244316 3300048913 Bacteria 1634
1035 Ga0496111_0020065 3300048914 Bacteria 4648
1036 Ga0496111_0084054 3300048914 Bacteria 2326
1037 Ga0496111_0485986 3300048914 Bacteria 909
1038 Ga0496112_0007247 3300048915 Bacteria 9829
1039 Ga0496112_0014536 3300048915 Bacteria 7311
1040 Ga0496112_0074884 3300048915 Bacteria 3348
1041 Ga0496112_0135960 3300048915 Bacteria 2428
1042 Ga0496112_0142481 3300048915 Bacteria 2366
1043 Ga0496112_0937187 3300048915 Bacteria 787
1044 Ga0496113_0013322 3300048916 Bacteria 5565
1045 Ga0496113_0074138 3300048916 Bacteria 2594
1046 Ga0496114_0011356 3300048917 Bacteria 7114
1047 Ga0496115_0063673 3300048918 Bacteria 2975
1048 Ga0501031_0171533 3300049568 Bacteria 1417
1049 Ga0501032_0065516 3300049569 Bacteria 2429
1050 Ga0501032_0394327 3300049569 Bacteria 889
1051 Ga0501034_0102693 3300049571 Bacteria 2852
1052 Ga0501036_0042032 3300049572 Bacteria 3869
1053 Ga0501037_0124742 3300049573 Bacteria 1849
1054 Ga0501038_0111307 3300049574 Bacteria 2268
1055 Ga0501039_0008855 3300049575 Bacteria 7669
1056 Ga0501039_0153282 3300049575 Bacteria 1810
1057 Ga0501039_0303316 3300049575 Bacteria 1256
1058 Ga0501041_0133782 3300049577 Bacteria 1545
1059 Ga0501043_0043797 3300049579 Bacteria 3518
1060 Ga0501048_0058450 3300049582 Bacteria 2733
1061 Ga0501067_0112865 3300049583 Bacteria 1511
1062 Ga0501080_0114902 3300049742 Bacteria 2496
1063 Ga0501035_0032855 3300049822 Bacteria 4718
1064 Ga0501044_0462113 3300049823 Bacteria 1174
1065 Ga0501045_0413909 3300049824 Bacteria 1003
1066 Ga0500592_009492 3300053116 Bacteria 1547
1067 Ga0500568_0001991 3300053139 Bacteria 12456
1068 Ga0500604_0133675 3300053151 Bacteria 835
1069 Ga0500624_000011 3300053157 Bacteria 168125
1070 Ga0500627_0000009 3300053158 Bacteria 153203
1071 Ga0466962_0005370 3300061719 Bacteria 6164
1072 Ga0466962_0050158 3300061719 Bacteria 1995

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031824 Ga0307413_10380718 Ga0307413_103807181 195
2 3300005366 Ga0070659_100296367 Ga0070659_1002963671 197
3 3300045976 Ga0466967_0059026 Ga0466967_0059026_2760_3356 198
4 3300025304 Ga0209257_1017164 Ga0209257_10171642 199
5 3300053151 Ga0500604_0133675 Ga0500604_0133675_82_804 199
6 3300053158 Ga0500627_0000009 Ga0500627_0000009_64427_65149 199
7 3300049569 Ga0501032_0065516 Ga0501032_0065516_676_1398 200
8 3300049571 Ga0501034_0102693 Ga0501034_0102693_1911_2633 200
9 3300049579 Ga0501043_0043797 Ga0501043_0043797_2152_2874 200
10 3300005616 Ga0068852_100081313 Ga0068852_1000813132 202
11 3300013105 Ga0157369_10637536 Ga0157369_106375363 202
12 3300013307 Ga0157372_11825779 Ga0157372_118257791 202
13 3300026142 Ga0207698_10320571 Ga0207698_103205713 202
14 3300049575 Ga0501039_0303316 Ga0501039_0303316_171_818 203
15 3300009093 Ga0105240_11028662 Ga0105240_110286622 204
16 3300025913 Ga0207695_10603603 Ga0207695_106036032 204
17 3300025937 Ga0207669_10275716 Ga0207669_102757162 205
18 3300030742 Ga0316183_1070022 Ga0316183_10700222 205
19 3300032004 Ga0307414_10000172 Ga0307414_1000017227 205
20 3300049569 Ga0501032_0394327 Ga0501032_0394327_54_776 205
21 3300031727 Ga0316576_10020204 Ga0316576_100202042 206
22 3300031911 Ga0307412_10069387 Ga0307412_100693872 206
23 3300049575 Ga0501039_0153282 Ga0501039_0153282_1055_1726 206
24 3300049577 Ga0501041_0133782 Ga0501041_0133782_694_1365 206
25 3300003794 Ga0055531_10012248 Ga0055531_100122482 207
26 3300025304 Ga0209257_1000245 Ga0209257_100024566 207
27 3300046512 Ga0495610_0219218 Ga0495610_0219218_81_758 207
28 3300005434 Ga0070709_10389676 Ga0070709_103896762 210
29 3300005577 Ga0068857_100657538 Ga0068857_1006575382 211
30 3300009551 Ga0105238_10052464 Ga0105238_100524645 211
31 3300013100 Ga0157373_10357386 Ga0157373_103573862 211
32 3300013104 Ga0157370_10146616 Ga0157370_101466163 211
33 3300013307 Ga0157372_10200910 Ga0157372_102009103 211
34 3300025921 Ga0207652_10227468 Ga0207652_102274683 211
35 3300025949 Ga0207667_10665961 Ga0207667_106659611 211
36 3300037312 Ga0395899_0030162 Ga0395899_0030162_2582_3217 211
37 3300037418 Ga0395900_0061809 Ga0395900_0061809_1641_2276 211
38 3300037466 Ga0395898_0667766 Ga0395898_0667766_300_935 211
39 3300037471 Ga0395905_0028287 Ga0395905_0028287_3196_3831 211
40 3300038443 Ga0395901_0128119 Ga0395901_0128119_1169_1804 211
41 3300025304 Ga0209257_1002319 Ga0209257_10023198 216
42 iso_pu_bacteria 2643221563 2643834958 217
43 iso_pu_bacteria 2643221608 2644055885 217
44 iso_pu_bacteria 2852653556 2852655789 217
45 iso_pu_bacteria 2852680915 2852682892 217
46 3300003781 Ga0055536_1002682 Ga0055536_10026825 218
47 3300003781 Ga0055536_1003009 Ga0055536_10030094 218
48 3300003781 Ga0055536_1025582 Ga0055536_10255822 218
49 3300003784 Ga0055534_1007550 Ga0055534_10075502 218
50 3300003791 Ga0055530_10000919 Ga0055530_1000091916 218
51 3300003794 Ga0055531_10000576 Ga0055531_100005765 218
52 3300025291 Ga0209675_1000563 Ga0209675_100056320 218
53 3300025292 Ga0209676_1000435 Ga0209676_100043543 218
54 3300025292 Ga0209676_1000651 Ga0209676_100065127 218
55 3300025292 Ga0209676_1001179 Ga0209676_100117927 218
56 3300025294 Ga0209025_1007288 Ga0209025_10072882 218
57 3300025298 Ga0209050_1000310 Ga0209050_100031069 218
58 3300025298 Ga0209050_1002457 Ga0209050_100245716 218
59 3300025304 Ga0209257_1000379 Ga0209257_100037958 218
60 3300031824 Ga0307413_10272032 Ga0307413_102720322 218
61 3300032004 Ga0307414_10039895 Ga0307414_100398953 218
62 3300032005 Ga0307411_10032101 Ga0307411_100321012 218
63 3300046616 Ga0495668_0000004 Ga0495668_0000004_86008_86730 218
64 3300046660 Ga0495625_0000955 Ga0495625_0000955_27184_27900 218
65 3300047470 Ga0495681_0056950 Ga0495681_0056950_770_1486 218
66 3300049568 Ga0501031_0171533 Ga0501031_0171533_50_772 218
67 3300049572 Ga0501036_0042032 Ga0501036_0042032_244_966 218
68 3300049573 Ga0501037_0124742 Ga0501037_0124742_1027_1749 218
69 3300049574 Ga0501038_0111307 Ga0501038_0111307_674_1396 218
70 3300049575 Ga0501039_0008855 Ga0501039_0008855_3761_4483 218
71 3300049582 Ga0501048_0058450 Ga0501048_0058450_1632_2354 218
72 3300049822 Ga0501035_0032855 Ga0501035_0032855_831_1553 218
73 3300049823 Ga0501044_0462113 Ga0501044_0462113_184_906 218
74 3300049824 Ga0501045_0413909 Ga0501045_0413909_255_977 218
75 3300053116 Ga0500592_009492 Ga0500592_009492_77_799 218
76 3300053139 Ga0500568_0001991 Ga0500568_0001991_5522_6238 218
77 iso_pu_bacteria 2643221560 2643819090 218
78 3300005336 Ga0070680_100408033 Ga0070680_1004080332 219
79 3300005339 Ga0070660_100035110 Ga0070660_1000351102 219
80 3300005366 Ga0070659_100161099 Ga0070659_1001610994 219
81 3300005458 Ga0070681_10197496 Ga0070681_101974964 219
82 3300005458 Ga0070681_10213886 Ga0070681_102138864 219
83 3300005530 Ga0070679_100117872 Ga0070679_1001178723 219
84 3300005530 Ga0070679_100511688 Ga0070679_1005116882 219
85 3300005539 Ga0068853_100237702 Ga0068853_1002377023 219
86 3300025919 Ga0207657_10109217 Ga0207657_101092171 219
87 3300025921 Ga0207652_10838757 Ga0207652_108387571 219
88 3300025932 Ga0207690_10137401 Ga0207690_101374012 219
89 3300045976 Ga0466967_1289667 Ga0466967_1289667_50_712 219
90 3300048915 Ga0496112_0135960 Ga0496112_0135960_976_1635 219
91 3300053157 Ga0500624_000011 Ga0500624_000011_115850_116509 219
92 3300001915 JGI24741J21665_1000886 JGI24741J21665_10008869 220
93 3300001979 JGI24740J21852_10000478 JGI24740J21852_1000047813 220
94 3300001979 JGI24740J21852_10026663 JGI24740J21852_100266633 220
95 3300001989 JGI24739J22299_10001965 JGI24739J22299_100019658 220
96 3300001990 JGI24737J22298_10014727 JGI24737J22298_100147271 220
97 3300001990 JGI24737J22298_10020683 JGI24737J22298_100206834 220
98 3300002077 JGI24744J21845_10000271 JGI24744J21845_100002714 220
99 3300005293 Ga0065715_10108433 Ga0065715_101084332 220
100 3300005327 Ga0070658_10000107 Ga0070658_1000010716 220
101 3300005327 Ga0070658_10051602 Ga0070658_100516023 220
102 3300005327 Ga0070658_10075411 Ga0070658_100754112 220
103 3300005327 Ga0070658_10081675 Ga0070658_100816752 220
104 3300005327 Ga0070658_10128380 Ga0070658_101283803 220
105 3300005327 Ga0070658_10178157 Ga0070658_101781571 220
106 3300005327 Ga0070658_10236799 Ga0070658_102367991 220
107 3300005327 Ga0070658_10237486 Ga0070658_102374862 220
108 3300005327 Ga0070658_10431225 Ga0070658_104312252 220
109 3300005327 Ga0070658_10477764 Ga0070658_104777641 220
110 3300005327 Ga0070658_10504849 Ga0070658_105048492 220
111 3300005327 Ga0070658_10763207 Ga0070658_107632071 220
112 3300005328 Ga0070676_10229613 Ga0070676_102296132 220
113 3300005328 Ga0070676_10280920 Ga0070676_102809202 220
114 3300005329 Ga0070683_100001635 Ga0070683_10000163515 220
115 3300005329 Ga0070683_100002963 Ga0070683_1000029636 220
116 3300005329 Ga0070683_100029355 Ga0070683_1000293552 220
117 3300005329 Ga0070683_100038176 Ga0070683_1000381762 220
118 3300005329 Ga0070683_100054017 Ga0070683_1000540175 220
119 3300005329 Ga0070683_100327903 Ga0070683_1003279032 220
120 3300005329 Ga0070683_100587016 Ga0070683_1005870161 220
121 3300005330 Ga0070690_100016818 Ga0070690_1000168183 220
122 3300005330 Ga0070690_100510077 Ga0070690_1005100771 220
123 3300005331 Ga0070670_100000263 Ga0070670_10000026322 220
124 3300005331 Ga0070670_100037310 Ga0070670_1000373103 220
125 3300005331 Ga0070670_100040551 Ga0070670_1000405513 220
126 3300005331 Ga0070670_100291648 Ga0070670_1002916482 220
127 3300005333 Ga0070677_10020480 Ga0070677_100204802 220
128 3300005333 Ga0070677_10023201 Ga0070677_100232013 220
129 3300005333 Ga0070677_10031327 Ga0070677_100313273 220
130 3300005333 Ga0070677_10129925 Ga0070677_101299252 220
131 3300005333 Ga0070677_10137713 Ga0070677_101377132 220
132 3300005335 Ga0070666_10001184 Ga0070666_1000118415 220
133 3300005335 Ga0070666_10011615 Ga0070666_100116152 220
134 3300005335 Ga0070666_10012419 Ga0070666_100124196 220
135 3300005335 Ga0070666_10018378 Ga0070666_100183784 220
136 3300005335 Ga0070666_10030734 Ga0070666_100307344 220
137 3300005335 Ga0070666_10069376 Ga0070666_100693763 220
138 3300005336 Ga0070680_100002425 Ga0070680_1000024257 220
139 3300005336 Ga0070680_100103499 Ga0070680_1001034993 220
140 3300005336 Ga0070680_100110439 Ga0070680_1001104393 220
141 3300005336 Ga0070680_100146675 Ga0070680_1001466752 220
142 3300005336 Ga0070680_100287890 Ga0070680_1002878902 220
143 3300005336 Ga0070680_100545684 Ga0070680_1005456842 220
144 3300005336 Ga0070680_100681053 Ga0070680_1006810531 220
145 3300005338 Ga0068868_100019933 Ga0068868_1000199336 220
146 3300005338 Ga0068868_100119270 Ga0068868_1001192703 220
147 3300005338 Ga0068868_100473890 Ga0068868_1004738902 220
148 3300005339 Ga0070660_100002346 Ga0070660_1000023467 220
149 3300005339 Ga0070660_100003086 Ga0070660_10000308611 220
150 3300005339 Ga0070660_100006884 Ga0070660_1000068843 220
151 3300005339 Ga0070660_100043905 Ga0070660_1000439053 220
152 3300005339 Ga0070660_100063895 Ga0070660_1000638954 220
153 3300005339 Ga0070660_100116523 Ga0070660_1001165231 220
154 3300005339 Ga0070660_100197458 Ga0070660_1001974582 220
155 3300005339 Ga0070660_100204583 Ga0070660_1002045831 220
156 3300005339 Ga0070660_100227673 Ga0070660_1002276731 220
157 3300005339 Ga0070660_100289855 Ga0070660_1002898553 220
158 3300005339 Ga0070660_100337931 Ga0070660_1003379312 220
159 3300005339 Ga0070660_100380358 Ga0070660_1003803581 220
160 3300005339 Ga0070660_100402061 Ga0070660_1004020612 220
161 3300005339 Ga0070660_100517464 Ga0070660_1005174641 220
162 3300005340 Ga0070689_100629179 Ga0070689_1006291792 220
163 3300005341 Ga0070691_10147990 Ga0070691_101479902 220
164 3300005341 Ga0070691_10198216 Ga0070691_101982162 220
165 3300005344 Ga0070661_100000101 Ga0070661_10000010121 220
166 3300005344 Ga0070661_100008788 Ga0070661_1000087884 220
167 3300005344 Ga0070661_100012760 Ga0070661_1000127603 220
168 3300005344 Ga0070661_100014445 Ga0070661_1000144455 220
169 3300005344 Ga0070661_100024208 Ga0070661_1000242084 220
170 3300005344 Ga0070661_100038675 Ga0070661_1000386754 220
171 3300005344 Ga0070661_100084858 Ga0070661_1000848583 220
172 3300005344 Ga0070661_100120523 Ga0070661_1001205233 220
173 3300005344 Ga0070661_100125971 Ga0070661_1001259713 220
174 3300005344 Ga0070661_100143993 Ga0070661_1001439932 220
175 3300005344 Ga0070661_100155945 Ga0070661_1001559453 220
176 3300005344 Ga0070661_100317355 Ga0070661_1003173552 220
177 3300005344 Ga0070661_100420409 Ga0070661_1004204092 220
178 3300005344 Ga0070661_100579264 Ga0070661_1005792641 220
179 3300005344 Ga0070661_100751293 Ga0070661_1007512931 220
180 3300005345 Ga0070692_10001622 Ga0070692_1000162211 220
181 3300005345 Ga0070692_10007869 Ga0070692_100078696 220
182 3300005345 Ga0070692_10034396 Ga0070692_100343963 220
183 3300005347 Ga0070668_100000081 Ga0070668_10000008121 220
184 3300005347 Ga0070668_100731195 Ga0070668_1007311951 220
185 3300005353 Ga0070669_100004051 Ga0070669_1000040514 220
186 3300005353 Ga0070669_100065545 Ga0070669_1000655453 220
187 3300005354 Ga0070675_100000118 Ga0070675_10000011822 220
188 3300005354 Ga0070675_100007151 Ga0070675_1000071516 220
189 3300005354 Ga0070675_100075279 Ga0070675_1000752793 220
190 3300005354 Ga0070675_100529772 Ga0070675_1005297721 220
191 3300005354 Ga0070675_100612004 Ga0070675_1006120042 220
192 3300005355 Ga0070671_100000533 Ga0070671_10000053321 220
193 3300005355 Ga0070671_100001226 Ga0070671_1000012263 220
194 3300005355 Ga0070671_100008814 Ga0070671_1000088146 220
195 3300005355 Ga0070671_100021607 Ga0070671_1000216073 220
196 3300005355 Ga0070671_100027968 Ga0070671_1000279687 220
197 3300005355 Ga0070671_100032012 Ga0070671_1000320122 220
198 3300005355 Ga0070671_100035848 Ga0070671_1000358485 220
199 3300005355 Ga0070671_100044687 Ga0070671_1000446874 220
200 3300005355 Ga0070671_100050464 Ga0070671_1000504643 220
201 3300005355 Ga0070671_100097878 Ga0070671_1000978781 220
202 3300005355 Ga0070671_100740833 Ga0070671_1007408331 220
203 3300005356 Ga0070674_100008358 Ga0070674_1000083583 220
204 3300005356 Ga0070674_100192537 Ga0070674_1001925372 220
205 3300005356 Ga0070674_100269195 Ga0070674_1002691953 220
206 3300005356 Ga0070674_100290847 Ga0070674_1002908472 220
207 3300005364 Ga0070673_100003291 Ga0070673_1000032916 220
208 3300005364 Ga0070673_100003843 Ga0070673_1000038435 220
209 3300005364 Ga0070673_100030923 Ga0070673_1000309234 220
210 3300005364 Ga0070673_100056275 Ga0070673_1000562752 220
211 3300005364 Ga0070673_100145576 Ga0070673_1001455761 220
212 3300005365 Ga0070688_100099934 Ga0070688_1000999341 220
213 3300005366 Ga0070659_100000045 Ga0070659_10000004560 220
214 3300005366 Ga0070659_100005279 Ga0070659_1000052799 220
215 3300005366 Ga0070659_100012293 Ga0070659_1000122932 220
216 3300005366 Ga0070659_100064878 Ga0070659_1000648783 220
217 3300005366 Ga0070659_100096358 Ga0070659_1000963583 220
218 3300005366 Ga0070659_100100698 Ga0070659_1001006982 220
219 3300005366 Ga0070659_100162672 Ga0070659_1001626723 220
220 3300005366 Ga0070659_100173117 Ga0070659_1001731172 220
221 3300005366 Ga0070659_100174630 Ga0070659_1001746303 220
222 3300005366 Ga0070659_100216003 Ga0070659_1002160032 220
223 3300005366 Ga0070659_100266020 Ga0070659_1002660203 220
224 3300005366 Ga0070659_100346999 Ga0070659_1003469993 220
225 3300005366 Ga0070659_100582090 Ga0070659_1005820902 220
226 3300005366 Ga0070659_100620684 Ga0070659_1006206841 220
227 3300005366 Ga0070659_100958641 Ga0070659_1009586411 220
228 3300005367 Ga0070667_100000211 Ga0070667_10000021132 220
229 3300005367 Ga0070667_100001244 Ga0070667_1000012446 220
230 3300005367 Ga0070667_100026867 Ga0070667_1000268675 220
231 3300005367 Ga0070667_100031641 Ga0070667_1000316414 220
232 3300005367 Ga0070667_100044459 Ga0070667_1000444594 220
233 3300005367 Ga0070667_100135292 Ga0070667_1001352923 220
234 3300005367 Ga0070667_100204835 Ga0070667_1002048353 220
235 3300005367 Ga0070667_100439113 Ga0070667_1004391132 220
236 3300005435 Ga0070714_100077489 Ga0070714_1000774893 220
237 3300005435 Ga0070714_100088581 Ga0070714_1000885813 220
238 3300005435 Ga0070714_100162622 Ga0070714_1001626223 220
239 3300005435 Ga0070714_100186386 Ga0070714_1001863863 220
240 3300005435 Ga0070714_100315487 Ga0070714_1003154871 220
241 3300005435 Ga0070714_100733969 Ga0070714_1007339692 220
242 3300005436 Ga0070713_100014377 Ga0070713_1000143772 220
243 3300005436 Ga0070713_100046439 Ga0070713_1000464395 220
244 3300005436 Ga0070713_100591425 Ga0070713_1005914251 220
245 3300005455 Ga0070663_100000549 Ga0070663_10000054918 220
246 3300005455 Ga0070663_100001760 Ga0070663_1000017601 220
247 3300005455 Ga0070663_100004497 Ga0070663_1000044975 220
248 3300005455 Ga0070663_100008655 Ga0070663_1000086555 220
249 3300005455 Ga0070663_100021071 Ga0070663_1000210715 220
250 3300005455 Ga0070663_100237504 Ga0070663_1002375043 220
251 3300005455 Ga0070663_100255793 Ga0070663_1002557932 220
252 3300005455 Ga0070663_100271604 Ga0070663_1002716043 220
253 3300005455 Ga0070663_100460944 Ga0070663_1004609442 220
254 3300005455 Ga0070663_100468936 Ga0070663_1004689361 220
255 3300005456 Ga0070678_100000740 Ga0070678_10000074012 220
256 3300005456 Ga0070678_100011936 Ga0070678_1000119366 220
257 3300005456 Ga0070678_100023764 Ga0070678_1000237643 220
258 3300005456 Ga0070678_100112066 Ga0070678_1001120663 220
259 3300005456 Ga0070678_100195077 Ga0070678_1001950773 220
260 3300005456 Ga0070678_100352305 Ga0070678_1003523053 220
261 3300005457 Ga0070662_100000036 Ga0070662_10000003661 220
262 3300005457 Ga0070662_100000505 Ga0070662_10000050510 220
263 3300005457 Ga0070662_100004779 Ga0070662_1000047793 220
264 3300005457 Ga0070662_100007052 Ga0070662_10000705210 220
265 3300005457 Ga0070662_100017455 Ga0070662_1000174557 220
266 3300005457 Ga0070662_100023485 Ga0070662_1000234853 220
267 3300005457 Ga0070662_100026171 Ga0070662_1000261713 220
268 3300005457 Ga0070662_100083707 Ga0070662_1000837073 220
269 3300005457 Ga0070662_100144481 Ga0070662_1001444812 220
270 3300005457 Ga0070662_100165004 Ga0070662_1001650041 220
271 3300005457 Ga0070662_100340765 Ga0070662_1003407652 220
272 3300005458 Ga0070681_10066804 Ga0070681_100668043 220
273 3300005458 Ga0070681_10075603 Ga0070681_100756032 220
274 3300005458 Ga0070681_10195731 Ga0070681_101957312 220
275 3300005458 Ga0070681_10201649 Ga0070681_102016493 220
276 3300005458 Ga0070681_10499446 Ga0070681_104994462 220
277 3300005458 Ga0070681_10571768 Ga0070681_105717682 220
278 3300005459 Ga0068867_100192429 Ga0068867_1001924292 220
279 3300005459 Ga0068867_100709092 Ga0068867_1007090922 220
280 3300005530 Ga0070679_100018187 Ga0070679_1000181878 220
281 3300005530 Ga0070679_100020530 Ga0070679_1000205307 220
282 3300005530 Ga0070679_100053950 Ga0070679_1000539503 220
283 3300005530 Ga0070679_100096518 Ga0070679_1000965183 220
284 3300005530 Ga0070679_100219953 Ga0070679_1002199533 220
285 3300005530 Ga0070679_100228966 Ga0070679_1002289663 220
286 3300005530 Ga0070679_100349894 Ga0070679_1003498942 220
287 3300005530 Ga0070679_100381706 Ga0070679_1003817063 220
288 3300005530 Ga0070679_100686721 Ga0070679_1006867211 220
289 3300005535 Ga0070684_100018254 Ga0070684_1000182545 220
290 3300005535 Ga0070684_100048153 Ga0070684_1000481532 220
291 3300005535 Ga0070684_100066515 Ga0070684_1000665154 220
292 3300005535 Ga0070684_100184835 Ga0070684_1001848353 220
293 3300005539 Ga0068853_100000059 Ga0068853_10000005931 220
294 3300005539 Ga0068853_100013847 Ga0068853_1000138472 220
295 3300005539 Ga0068853_100082354 Ga0068853_1000823544 220
296 3300005539 Ga0068853_100252244 Ga0068853_1002522443 220
297 3300005539 Ga0068853_100310455 Ga0068853_1003104552 220
298 3300005539 Ga0068853_100489298 Ga0068853_1004892981 220
299 3300005539 Ga0068853_100669332 Ga0068853_1006693321 220
300 3300005543 Ga0070672_100003021 Ga0070672_10000302110 220
301 3300005543 Ga0070672_100052580 Ga0070672_1000525804 220
302 3300005543 Ga0070672_100078840 Ga0070672_1000788403 220
303 3300005543 Ga0070672_100314673 Ga0070672_1003146732 220
304 3300005543 Ga0070672_100541946 Ga0070672_1005419462 220
305 3300005543 Ga0070672_100680463 Ga0070672_1006804632 220
306 3300005546 Ga0070696_100217879 Ga0070696_1002178792 220
307 3300005547 Ga0070693_100009384 Ga0070693_1000093845 220
308 3300005547 Ga0070693_100148787 Ga0070693_1001487872 220
309 3300005548 Ga0070665_100015366 Ga0070665_1000153663 220
310 3300005548 Ga0070665_100067723 Ga0070665_1000677235 220
311 3300005548 Ga0070665_100336763 Ga0070665_1003367633 220
312 3300005548 Ga0070665_100435321 Ga0070665_1004353211 220
313 3300005563 Ga0068855_100012363 Ga0068855_10001236311 220
314 3300005563 Ga0068855_100060416 Ga0068855_1000604164 220
315 3300005563 Ga0068855_100118355 Ga0068855_1001183554 220
316 3300005563 Ga0068855_100121018 Ga0068855_1001210184 220
317 3300005563 Ga0068855_100140238 Ga0068855_1001402381 220
318 3300005563 Ga0068855_100303010 Ga0068855_1003030103 220
319 3300005563 Ga0068855_100314583 Ga0068855_1003145833 220
320 3300005563 Ga0068855_100336690 Ga0068855_1003366903 220
321 3300005563 Ga0068855_100796753 Ga0068855_1007967532 220
322 3300005564 Ga0070664_100000027 Ga0070664_10000002761 220
323 3300005564 Ga0070664_100002553 Ga0070664_10000255312 220
324 3300005564 Ga0070664_100005661 Ga0070664_1000056615 220
325 3300005564 Ga0070664_100008562 Ga0070664_1000085623 220
326 3300005564 Ga0070664_100017909 Ga0070664_1000179094 220
327 3300005564 Ga0070664_100055518 Ga0070664_1000555182 220
328 3300005564 Ga0070664_100066168 Ga0070664_1000661683 220
329 3300005564 Ga0070664_100075344 Ga0070664_1000753442 220
330 3300005564 Ga0070664_100314029 Ga0070664_1003140292 220
331 3300005564 Ga0070664_100676667 Ga0070664_1006766672 220
332 3300005564 Ga0070664_100859671 Ga0070664_1008596711 220
333 3300005577 Ga0068857_100011102 Ga0068857_1000111025 220
334 3300005577 Ga0068857_100043896 Ga0068857_1000438963 220
335 3300005577 Ga0068857_100048452 Ga0068857_1000484523 220
336 3300005577 Ga0068857_100116829 Ga0068857_1001168292 220
337 3300005577 Ga0068857_100288863 Ga0068857_1002888632 220
338 3300005577 Ga0068857_100289840 Ga0068857_1002898401 220
339 3300005578 Ga0068854_100011147 Ga0068854_1000111475 220
340 3300005578 Ga0068854_100035602 Ga0068854_1000356023 220
341 3300005578 Ga0068854_100071398 Ga0068854_1000713983 220
342 3300005578 Ga0068854_100129557 Ga0068854_1001295572 220
343 3300005578 Ga0068854_100130156 Ga0068854_1001301563 220
344 3300005578 Ga0068854_100143186 Ga0068854_1001431863 220
345 3300005578 Ga0068854_100171077 Ga0068854_1001710772 220
346 3300005614 Ga0068856_100000705 Ga0068856_10000070514 220
347 3300005614 Ga0068856_100012564 Ga0068856_1000125649 220
348 3300005614 Ga0068856_100075058 Ga0068856_1000750583 220
349 3300005614 Ga0068856_100152115 Ga0068856_1001521153 220
350 3300005614 Ga0068856_100182771 Ga0068856_1001827713 220
351 3300005614 Ga0068856_100193323 Ga0068856_1001933232 220
352 3300005614 Ga0068856_100195161 Ga0068856_1001951611 220
353 3300005614 Ga0068856_100340563 Ga0068856_1003405633 220
354 3300005614 Ga0068856_100602185 Ga0068856_1006021851 220
355 3300005614 Ga0068856_100756797 Ga0068856_1007567971 220
356 3300005616 Ga0068852_100002112 Ga0068852_10000211215 220
357 3300005616 Ga0068852_100006970 Ga0068852_1000069705 220
358 3300005616 Ga0068852_100008823 Ga0068852_1000088237 220
359 3300005616 Ga0068852_100021913 Ga0068852_1000219133 220
360 3300005616 Ga0068852_100024199 Ga0068852_1000241994 220
361 3300005616 Ga0068852_100104801 Ga0068852_1001048013 220
362 3300005616 Ga0068852_100121377 Ga0068852_1001213774 220
363 3300005616 Ga0068852_100251211 Ga0068852_1002512113 220
364 3300005616 Ga0068852_100259385 Ga0068852_1002593852 220
365 3300005616 Ga0068852_100281527 Ga0068852_1002815273 220
366 3300005616 Ga0068852_100402452 Ga0068852_1004024523 220
367 3300005616 Ga0068852_100476238 Ga0068852_1004762382 220
368 3300005616 Ga0068852_100787465 Ga0068852_1007874652 220
369 3300005616 Ga0068852_100833321 Ga0068852_1008333212 220
370 3300005617 Ga0068859_100043942 Ga0068859_1000439425 220
371 3300005617 Ga0068859_100251243 Ga0068859_1002512433 220
372 3300005618 Ga0068864_100004115 Ga0068864_1000041152 220
373 3300005618 Ga0068864_100032196 Ga0068864_1000321964 220
374 3300005618 Ga0068864_100069096 Ga0068864_1000690963 220
375 3300005618 Ga0068864_100098063 Ga0068864_1000980632 220
376 3300005618 Ga0068864_100257100 Ga0068864_1002571003 220
377 3300005618 Ga0068864_100286783 Ga0068864_1002867833 220
378 3300005618 Ga0068864_100322090 Ga0068864_1003220903 220
379 3300005834 Ga0068851_10017671 Ga0068851_100176713 220
380 3300005834 Ga0068851_10023959 Ga0068851_100239592 220
381 3300005841 Ga0068863_100000178 Ga0068863_10000017832 220
382 3300005841 Ga0068863_100005577 Ga0068863_1000055777 220
383 3300005842 Ga0068858_100049224 Ga0068858_1000492243 220
384 3300005842 Ga0068858_100092446 Ga0068858_1000924464 220
385 3300005842 Ga0068858_100180613 Ga0068858_1001806132 220
386 3300005842 Ga0068858_100240528 Ga0068858_1002405283 220
387 3300005843 Ga0068860_100005258 Ga0068860_1000052585 220
388 3300005843 Ga0068860_100144550 Ga0068860_1001445503 220
389 3300005843 Ga0068860_100173608 Ga0068860_1001736083 220
390 3300006028 Ga0070717_10003959 Ga0070717_1000395911 220
391 3300006028 Ga0070717_10260009 Ga0070717_102600093 220
392 3300006237 Ga0097621_100129132 Ga0097621_1001291322 220
393 3300006237 Ga0097621_100135500 Ga0097621_1001355002 220
394 3300006358 Ga0068871_100310210 Ga0068871_1003102102 220
395 3300006358 Ga0068871_100437081 Ga0068871_1004370812 220
396 3300006358 Ga0068871_100887925 Ga0068871_1008879251 220
397 3300006358 Ga0068871_101085655 Ga0068871_1010856551 220
398 3300006881 Ga0068865_100033860 Ga0068865_1000338602 220
399 3300006881 Ga0068865_100375803 Ga0068865_1003758032 220
400 3300006931 Ga0097620_100043943 Ga0097620_1000439435 220
401 3300006931 Ga0097620_100251220 Ga0097620_1002512203 220
402 3300009093 Ga0105240_10044834 Ga0105240_100448343 220
403 3300009093 Ga0105240_10050974 Ga0105240_100509745 220
404 3300009098 Ga0105245_10020695 Ga0105245_100206951 220
405 3300009098 Ga0105245_10152223 Ga0105245_101522233 220
406 3300009148 Ga0105243_10641258 Ga0105243_106412582 220
407 3300009174 Ga0105241_10271116 Ga0105241_102711162 220
408 3300009174 Ga0105241_10312447 Ga0105241_103124473 220
409 3300009176 Ga0105242_10299941 Ga0105242_102999412 220
410 3300009176 Ga0105242_10852802 Ga0105242_108528022 220
411 3300009177 Ga0105248_10001371 Ga0105248_1000137111 220
412 3300009177 Ga0105248_10001451 Ga0105248_1000145130 220
413 3300009177 Ga0105248_10007514 Ga0105248_100075148 220
414 3300009177 Ga0105248_10012052 Ga0105248_100120524 220
415 3300009177 Ga0105248_10015837 Ga0105248_100158376 220
416 3300009177 Ga0105248_10034355 Ga0105248_100343554 220
417 3300009177 Ga0105248_10072761 Ga0105248_100727615 220
418 3300009177 Ga0105248_10495267 Ga0105248_104952671 220
419 3300009545 Ga0105237_10010769 Ga0105237_1001076910 220
420 3300009551 Ga0105238_10019485 Ga0105238_1001948510 220
421 3300009551 Ga0105238_10549658 Ga0105238_105496581 220
422 3300009551 Ga0105238_10552376 Ga0105238_105523762 220
423 3300009551 Ga0105238_10670726 Ga0105238_106707262 220
424 3300010375 Ga0105239_10013539 Ga0105239_100135393 220
425 3300010375 Ga0105239_10107468 Ga0105239_101074681 220
426 3300013100 Ga0157373_10009059 Ga0157373_100090593 220
427 3300013100 Ga0157373_10029657 Ga0157373_100296572 220
428 3300013100 Ga0157373_10048202 Ga0157373_100482023 220
429 3300013100 Ga0157373_10060492 Ga0157373_100604923 220
430 3300013100 Ga0157373_10387826 Ga0157373_103878261 220
431 3300013100 Ga0157373_10427380 Ga0157373_104273802 220
432 3300013100 Ga0157373_10530460 Ga0157373_105304602 220
433 3300013102 Ga0157371_10002958 Ga0157371_100029586 220
434 3300013102 Ga0157371_10008730 Ga0157371_100087304 220
435 3300013102 Ga0157371_10064531 Ga0157371_100645313 220
436 3300013102 Ga0157371_10088172 Ga0157371_100881723 220
437 3300013102 Ga0157371_10089900 Ga0157371_100899003 220
438 3300013102 Ga0157371_10167194 Ga0157371_101671943 220
439 3300013102 Ga0157371_10314405 Ga0157371_103144052 220
440 3300013102 Ga0157371_10473449 Ga0157371_104734491 220
441 3300013102 Ga0157371_10782061 Ga0157371_107820611 220
442 3300013104 Ga0157370_10000686 Ga0157370_1000068623 220
443 3300013104 Ga0157370_10018083 Ga0157370_100180837 220
444 3300013104 Ga0157370_10064635 Ga0157370_100646354 220
445 3300013104 Ga0157370_10140762 Ga0157370_101407622 220
446 3300013104 Ga0157370_10237842 Ga0157370_102378422 220
447 3300013104 Ga0157370_10526478 Ga0157370_105264781 220
448 3300013105 Ga0157369_10000407 Ga0157369_1000040714 220
449 3300013105 Ga0157369_10000823 Ga0157369_1000082335 220
450 3300013105 Ga0157369_10001783 Ga0157369_100017832 220
451 3300013105 Ga0157369_10079125 Ga0157369_100791253 220
452 3300013105 Ga0157369_10117615 Ga0157369_101176152 220
453 3300013105 Ga0157369_10128879 Ga0157369_101288794 220
454 3300013105 Ga0157369_10311711 Ga0157369_103117113 220
455 3300013105 Ga0157369_10355767 Ga0157369_103557673 220
456 3300013105 Ga0157369_10383694 Ga0157369_103836942 220
457 3300013105 Ga0157369_10862383 Ga0157369_108623832 220
458 3300013105 Ga0157369_11087937 Ga0157369_110879371 220
459 3300013296 Ga0157374_10005930 Ga0157374_100059303 220
460 3300013296 Ga0157374_10053710 Ga0157374_100537106 220
461 3300013296 Ga0157374_10262628 Ga0157374_102626283 220
462 3300013296 Ga0157374_10956367 Ga0157374_109563671 220
463 3300013306 Ga0163162_10119641 Ga0163162_101196414 220
464 3300013307 Ga0157372_10020101 Ga0157372_100201015 220
465 3300013307 Ga0157372_10178326 Ga0157372_101783263 220
466 3300013307 Ga0157372_10261869 Ga0157372_102618692 220
467 3300013307 Ga0157372_10721069 Ga0157372_107210691 220
468 3300013308 Ga0157375_10017968 Ga0157375_100179685 220
469 3300013308 Ga0157375_10061424 Ga0157375_100614245 220
470 3300013308 Ga0157375_10624224 Ga0157375_106242242 220
471 3300013308 Ga0157375_10660373 Ga0157375_106603731 220
472 3300013308 Ga0157375_11075995 Ga0157375_110759952 220
473 3300014325 Ga0163163_10000187 Ga0163163_1000018717 220
474 3300014325 Ga0163163_10008745 Ga0163163_100087459 220
475 3300014325 Ga0163163_10155023 Ga0163163_101550233 220
476 3300014325 Ga0163163_10889426 Ga0163163_108894261 220
477 3300014968 Ga0157379_10294607 Ga0157379_102946072 220
478 3300017792 Ga0163161_10075515 Ga0163161_100755152 220
479 3300017792 Ga0163161_10148413 Ga0163161_101484132 220
480 3300020082 Ga0206353_10074044 Ga0206353_100740442 220
481 3300020082 Ga0206353_11715536 Ga0206353_117155362 220
482 3300021384 Ga0213876_10027248 Ga0213876_100272482 220
483 3300021388 Ga0213875_10011727 Ga0213875_100117277 220
484 3300025321 Ga0207656_10207577 Ga0207656_102075772 220
485 3300025893 Ga0207682_10004480 Ga0207682_100044805 220
486 3300025893 Ga0207682_10033990 Ga0207682_100339903 220
487 3300025893 Ga0207682_10123218 Ga0207682_101232181 220
488 3300025893 Ga0207682_10149855 Ga0207682_101498552 220
489 3300025901 Ga0207688_10182252 Ga0207688_101822522 220
490 3300025901 Ga0207688_10185481 Ga0207688_101854813 220
491 3300025903 Ga0207680_10005938 Ga0207680_100059384 220
492 3300025903 Ga0207680_10007117 Ga0207680_100071173 220
493 3300025903 Ga0207680_10008819 Ga0207680_100088194 220
494 3300025903 Ga0207680_10014628 Ga0207680_100146281 220
495 3300025903 Ga0207680_10022289 Ga0207680_100222895 220
496 3300025903 Ga0207680_10605715 Ga0207680_106057151 220
497 3300025904 Ga0207647_10001381 Ga0207647_1000138114 220
498 3300025904 Ga0207647_10001456 Ga0207647_1000145617 220
499 3300025904 Ga0207647_10010206 Ga0207647_100102066 220
500 3300025904 Ga0207647_10040280 Ga0207647_100402804 220
501 3300025904 Ga0207647_10041257 Ga0207647_100412574 220
502 3300025904 Ga0207647_10206541 Ga0207647_102065412 220
503 3300025907 Ga0207645_10033797 Ga0207645_100337973 220
504 3300025907 Ga0207645_10122622 Ga0207645_101226223 220
505 3300025909 Ga0207705_10000086 Ga0207705_10000086110 220
506 3300025909 Ga0207705_10006209 Ga0207705_100062099 220
507 3300025909 Ga0207705_10008363 Ga0207705_100083634 220
508 3300025909 Ga0207705_10011590 Ga0207705_100115903 220
509 3300025909 Ga0207705_10012670 Ga0207705_100126703 220
510 3300025909 Ga0207705_10015255 Ga0207705_100152555 220
511 3300025909 Ga0207705_10023053 Ga0207705_100230534 220
512 3300025909 Ga0207705_10040477 Ga0207705_100404773 220
513 3300025909 Ga0207705_10048653 Ga0207705_100486534 220
514 3300025909 Ga0207705_10052814 Ga0207705_100528143 220
515 3300025909 Ga0207705_10072016 Ga0207705_100720162 220
516 3300025909 Ga0207705_10193872 Ga0207705_101938722 220
517 3300025909 Ga0207705_10298576 Ga0207705_102985762 220
518 3300025909 Ga0207705_10352190 Ga0207705_103521902 220
519 3300025909 Ga0207705_10439649 Ga0207705_104396492 220
520 3300025909 Ga0207705_10501189 Ga0207705_105011891 220
521 3300025912 Ga0207707_10005588 Ga0207707_100055888 220
522 3300025912 Ga0207707_10035847 Ga0207707_100358475 220
523 3300025912 Ga0207707_10090820 Ga0207707_100908202 220
524 3300025912 Ga0207707_10171156 Ga0207707_101711563 220
525 3300025912 Ga0207707_10307236 Ga0207707_103072362 220
526 3300025912 Ga0207707_10599257 Ga0207707_105992571 220
527 3300025913 Ga0207695_10006970 Ga0207695_1000697016 220
528 3300025913 Ga0207695_10035556 Ga0207695_100355565 220
529 3300025913 Ga0207695_10127895 Ga0207695_101278953 220
530 3300025914 Ga0207671_10040914 Ga0207671_100409142 220
531 3300025917 Ga0207660_10000711 Ga0207660_100007114 220
532 3300025917 Ga0207660_10016540 Ga0207660_100165403 220
533 3300025917 Ga0207660_10087640 Ga0207660_100876403 220
534 3300025917 Ga0207660_10184895 Ga0207660_101848953 220
535 3300025917 Ga0207660_10376496 Ga0207660_103764962 220
536 3300025917 Ga0207660_10409318 Ga0207660_104093182 220
537 3300025918 Ga0207662_10035033 Ga0207662_100350332 220
538 3300025919 Ga0207657_10000133 Ga0207657_1000013342 220
539 3300025919 Ga0207657_10001177 Ga0207657_1000117717 220
540 3300025919 Ga0207657_10002861 Ga0207657_100028615 220
541 3300025919 Ga0207657_10007733 Ga0207657_100077335 220
542 3300025919 Ga0207657_10024605 Ga0207657_100246053 220
543 3300025919 Ga0207657_10031556 Ga0207657_100315564 220
544 3300025919 Ga0207657_10035921 Ga0207657_100359212 220
545 3300025919 Ga0207657_10036355 Ga0207657_100363553 220
546 3300025919 Ga0207657_10054053 Ga0207657_100540533 220
547 3300025919 Ga0207657_10056827 Ga0207657_100568273 220
548 3300025919 Ga0207657_10057120 Ga0207657_100571204 220
549 3300025919 Ga0207657_10059403 Ga0207657_100594033 220
550 3300025919 Ga0207657_10072397 Ga0207657_100723973 220
551 3300025919 Ga0207657_10076561 Ga0207657_100765613 220
552 3300025919 Ga0207657_10138363 Ga0207657_101383633 220
553 3300025919 Ga0207657_10344149 Ga0207657_103441492 220
554 3300025919 Ga0207657_10470248 Ga0207657_104702482 220
555 3300025919 Ga0207657_10605787 Ga0207657_106057871 220
556 3300025919 Ga0207657_10707003 Ga0207657_107070031 220
557 3300025920 Ga0207649_10000378 Ga0207649_1000037831 220
558 3300025920 Ga0207649_10004499 Ga0207649_100044998 220
559 3300025920 Ga0207649_10006156 Ga0207649_100061566 220
560 3300025920 Ga0207649_10022730 Ga0207649_100227304 220
561 3300025920 Ga0207649_10023114 Ga0207649_100231146 220
562 3300025920 Ga0207649_10040298 Ga0207649_100402982 220
563 3300025920 Ga0207649_10044741 Ga0207649_100447413 220
564 3300025920 Ga0207649_10057966 Ga0207649_100579663 220
565 3300025920 Ga0207649_10096667 Ga0207649_100966673 220
566 3300025920 Ga0207649_10164991 Ga0207649_101649913 220
567 3300025920 Ga0207649_10337593 Ga0207649_103375932 220
568 3300025921 Ga0207652_10115194 Ga0207652_101151943 220
569 3300025921 Ga0207652_10128090 Ga0207652_101280902 220
570 3300025921 Ga0207652_10316497 Ga0207652_103164972 220
571 3300025921 Ga0207652_10406594 Ga0207652_104065942 220
572 3300025921 Ga0207652_10466938 Ga0207652_104669381 220
573 3300025921 Ga0207652_10537508 Ga0207652_105375081 220
574 3300025923 Ga0207681_10001740 Ga0207681_100017404 220
575 3300025923 Ga0207681_10055073 Ga0207681_100550733 220
576 3300025924 Ga0207694_10001964 Ga0207694_1000196415 220
577 3300025924 Ga0207694_10057322 Ga0207694_100573222 220
578 3300025925 Ga0207650_10002035 Ga0207650_1000203511 220
579 3300025925 Ga0207650_10028542 Ga0207650_100285423 220
580 3300025925 Ga0207650_10296609 Ga0207650_102966092 220
581 3300025925 Ga0207650_10915959 Ga0207650_109159591 220
582 3300025926 Ga0207659_10021624 Ga0207659_100216245 220
583 3300025926 Ga0207659_10157434 Ga0207659_101574342 220
584 3300025926 Ga0207659_10410769 Ga0207659_104107692 220
585 3300025928 Ga0207700_10171740 Ga0207700_101717402 220
586 3300025928 Ga0207700_10527050 Ga0207700_105270502 220
587 3300025929 Ga0207664_10072803 Ga0207664_100728032 220
588 3300025929 Ga0207664_10075297 Ga0207664_100752972 220
589 3300025929 Ga0207664_10101062 Ga0207664_101010623 220
590 3300025929 Ga0207664_10131175 Ga0207664_101311753 220
591 3300025929 Ga0207664_10536803 Ga0207664_105368032 220
592 3300025931 Ga0207644_10000656 Ga0207644_100006567 220
593 3300025931 Ga0207644_10000810 Ga0207644_1000081019 220
594 3300025931 Ga0207644_10000892 Ga0207644_100008922 220
595 3300025931 Ga0207644_10015229 Ga0207644_100152296 220
596 3300025931 Ga0207644_10025888 Ga0207644_100258883 220
597 3300025931 Ga0207644_10057697 Ga0207644_100576974 220
598 3300025931 Ga0207644_10228630 Ga0207644_102286302 220
599 3300025931 Ga0207644_10358558 Ga0207644_103585581 220
600 3300025932 Ga0207690_10000080 Ga0207690_1000008031 220
601 3300025932 Ga0207690_10004717 Ga0207690_100047172 220
602 3300025932 Ga0207690_10005265 Ga0207690_1000526511 220
603 3300025932 Ga0207690_10011578 Ga0207690_100115783 220
604 3300025932 Ga0207690_10094282 Ga0207690_100942823 220
605 3300025932 Ga0207690_10117985 Ga0207690_101179853 220
606 3300025932 Ga0207690_10144746 Ga0207690_101447463 220
607 3300025932 Ga0207690_10177674 Ga0207690_101776743 220
608 3300025932 Ga0207690_10205872 Ga0207690_102058723 220
609 3300025932 Ga0207690_10312281 Ga0207690_103122812 220
610 3300025932 Ga0207690_10332471 Ga0207690_103324711 220
611 3300025932 Ga0207690_10332540 Ga0207690_103325402 220
612 3300025932 Ga0207690_10388887 Ga0207690_103888872 220
613 3300025932 Ga0207690_10681185 Ga0207690_106811851 220
614 3300025932 Ga0207690_10697975 Ga0207690_106979751 220
615 3300025933 Ga0207706_10000159 Ga0207706_1000015942 220
616 3300025933 Ga0207706_10000255 Ga0207706_1000025527 220
617 3300025933 Ga0207706_10002178 Ga0207706_100021783 220
618 3300025933 Ga0207706_10002993 Ga0207706_100029936 220
619 3300025933 Ga0207706_10003045 Ga0207706_100030459 220
620 3300025933 Ga0207706_10015017 Ga0207706_100150176 220
621 3300025933 Ga0207706_10021322 Ga0207706_100213223 220
622 3300025933 Ga0207706_10030118 Ga0207706_100301184 220
623 3300025933 Ga0207706_10066839 Ga0207706_100668392 220
624 3300025933 Ga0207706_10068352 Ga0207706_100683523 220
625 3300025933 Ga0207706_10079929 Ga0207706_100799292 220
626 3300025933 Ga0207706_10084251 Ga0207706_100842513 220
627 3300025933 Ga0207706_10138953 Ga0207706_101389533 220
628 3300025933 Ga0207706_10167340 Ga0207706_101673402 220
629 3300025933 Ga0207706_10222335 Ga0207706_102223354 220
630 3300025933 Ga0207706_10709300 Ga0207706_107093002 220
631 3300025937 Ga0207669_10007854 Ga0207669_100078542 220
632 3300025937 Ga0207669_10024724 Ga0207669_100247245 220
633 3300025937 Ga0207669_10307044 Ga0207669_103070442 220
634 3300025937 Ga0207669_10349834 Ga0207669_103498341 220
635 3300025938 Ga0207704_10061087 Ga0207704_100610873 220
636 3300025939 Ga0207665_10098665 Ga0207665_100986653 220
637 3300025940 Ga0207691_10000926 Ga0207691_1000092626 220
638 3300025940 Ga0207691_10000965 Ga0207691_1000096512 220
639 3300025940 Ga0207691_10026492 Ga0207691_100264928 220
640 3300025940 Ga0207691_10062910 Ga0207691_100629103 220
641 3300025940 Ga0207691_10175086 Ga0207691_101750862 220
642 3300025940 Ga0207691_10185603 Ga0207691_101856033 220
643 3300025940 Ga0207691_10222498 Ga0207691_102224982 220
644 3300025940 Ga0207691_10778747 Ga0207691_107787471 220
645 3300025941 Ga0207711_10000744 Ga0207711_1000074411 220
646 3300025941 Ga0207711_10002185 Ga0207711_1000218521 220
647 3300025941 Ga0207711_10003526 Ga0207711_100035265 220
648 3300025941 Ga0207711_10008994 Ga0207711_100089943 220
649 3300025941 Ga0207711_10012570 Ga0207711_100125704 220
650 3300025941 Ga0207711_10076604 Ga0207711_100766042 220
651 3300025941 Ga0207711_10321478 Ga0207711_103214783 220
652 3300025941 Ga0207711_10625216 Ga0207711_106252161 220
653 3300025942 Ga0207689_10089895 Ga0207689_100898953 220
654 3300025944 Ga0207661_10001549 Ga0207661_1000154913 220
655 3300025944 Ga0207661_10027951 Ga0207661_100279515 220
656 3300025944 Ga0207661_10117244 Ga0207661_101172443 220
657 3300025944 Ga0207661_10546325 Ga0207661_105463252 220
658 3300025945 Ga0207679_10000155 Ga0207679_1000015540 220
659 3300025945 Ga0207679_10003647 Ga0207679_100036477 220
660 3300025945 Ga0207679_10004206 Ga0207679_100042068 220
661 3300025945 Ga0207679_10006641 Ga0207679_100066415 220
662 3300025945 Ga0207679_10023013 Ga0207679_100230133 220
663 3300025945 Ga0207679_10028940 Ga0207679_100289404 220
664 3300025945 Ga0207679_10035538 Ga0207679_100355384 220
665 3300025945 Ga0207679_10088787 Ga0207679_100887873 220
666 3300025945 Ga0207679_10339379 Ga0207679_103393792 220
667 3300025945 Ga0207679_10442109 Ga0207679_104421091 220
668 3300025949 Ga0207667_10004439 Ga0207667_1000443916 220
669 3300025949 Ga0207667_10011412 Ga0207667_100114125 220
670 3300025949 Ga0207667_10040922 Ga0207667_100409227 220
671 3300025949 Ga0207667_10059703 Ga0207667_100597033 220
672 3300025949 Ga0207667_10066806 Ga0207667_100668064 220
673 3300025949 Ga0207667_10140685 Ga0207667_101406851 220
674 3300025949 Ga0207667_10203377 Ga0207667_102033773 220
675 3300025949 Ga0207667_10256379 Ga0207667_102563792 220
676 3300025949 Ga0207667_10289616 Ga0207667_102896161 220
677 3300025949 Ga0207667_10365274 Ga0207667_103652743 220
678 3300025949 Ga0207667_10481785 Ga0207667_104817851 220
679 3300025949 Ga0207667_10517245 Ga0207667_105172452 220
680 3300025949 Ga0207667_10538856 Ga0207667_105388562 220
681 3300025949 Ga0207667_10576857 Ga0207667_105768572 220
682 3300025949 Ga0207667_10626209 Ga0207667_106262091 220
683 3300025949 Ga0207667_10683821 Ga0207667_106838211 220
684 3300025960 Ga0207651_10004095 Ga0207651_100040953 220
685 3300025960 Ga0207651_10004660 Ga0207651_100046602 220
686 3300025960 Ga0207651_10013504 Ga0207651_100135042 220
687 3300025960 Ga0207651_10191607 Ga0207651_101916073 220
688 3300025960 Ga0207651_10257631 Ga0207651_102576311 220
689 3300025972 Ga0207668_10000079 Ga0207668_1000007935 220
690 3300025981 Ga0207640_10005286 Ga0207640_100052862 220
691 3300025981 Ga0207640_10043194 Ga0207640_100431943 220
692 3300025981 Ga0207640_10127241 Ga0207640_101272412 220
693 3300025981 Ga0207640_10129347 Ga0207640_101293472 220
694 3300025981 Ga0207640_10136720 Ga0207640_101367203 220
695 3300025981 Ga0207640_10173625 Ga0207640_101736253 220
696 3300025986 Ga0207658_10000180 Ga0207658_1000018029 220
697 3300025986 Ga0207658_10015617 Ga0207658_100156174 220
698 3300025986 Ga0207658_10015618 Ga0207658_100156185 220
699 3300025986 Ga0207658_10023378 Ga0207658_100233784 220
700 3300025986 Ga0207658_10433006 Ga0207658_104330062 220
701 3300026023 Ga0207677_10023936 Ga0207677_100239362 220
702 3300026023 Ga0207677_10088686 Ga0207677_100886863 220
703 3300026023 Ga0207677_10581500 Ga0207677_105815002 220
704 3300026035 Ga0207703_10010603 Ga0207703_100106033 220
705 3300026035 Ga0207703_10275919 Ga0207703_102759192 220
706 3300026041 Ga0207639_10000137 Ga0207639_1000013715 220
707 3300026041 Ga0207639_10001284 Ga0207639_100012846 220
708 3300026041 Ga0207639_10102760 Ga0207639_101027602 220
709 3300026041 Ga0207639_10151577 Ga0207639_101515773 220
710 3300026041 Ga0207639_10160989 Ga0207639_101609893 220
711 3300026041 Ga0207639_10177388 Ga0207639_101773881 220
712 3300026041 Ga0207639_10542520 Ga0207639_105425202 220
713 3300026041 Ga0207639_10568704 Ga0207639_105687041 220
714 3300026041 Ga0207639_10679060 Ga0207639_106790602 220
715 3300026041 Ga0207639_11001763 Ga0207639_110017631 220
716 3300026067 Ga0207678_10000973 Ga0207678_1000097312 220
717 3300026067 Ga0207678_10003440 Ga0207678_100034403 220
718 3300026067 Ga0207678_10004199 Ga0207678_1000419914 220
719 3300026067 Ga0207678_10011875 Ga0207678_100118753 220
720 3300026067 Ga0207678_10012002 Ga0207678_100120027 220
721 3300026067 Ga0207678_10013248 Ga0207678_100132486 220
722 3300026067 Ga0207678_10113165 Ga0207678_101131654 220
723 3300026067 Ga0207678_10150477 Ga0207678_101504773 220
724 3300026067 Ga0207678_10167683 Ga0207678_101676833 220
725 3300026067 Ga0207678_10218191 Ga0207678_102181913 220
726 3300026067 Ga0207678_10487854 Ga0207678_104878542 220
727 3300026067 Ga0207678_10502305 Ga0207678_105023052 220
728 3300026078 Ga0207702_10000246 Ga0207702_1000024649 220
729 3300026078 Ga0207702_10019937 Ga0207702_100199375 220
730 3300026078 Ga0207702_10050920 Ga0207702_100509203 220
731 3300026078 Ga0207702_10070804 Ga0207702_100708041 220
732 3300026078 Ga0207702_10073124 Ga0207702_100731244 220
733 3300026078 Ga0207702_10111533 Ga0207702_101115332 220
734 3300026078 Ga0207702_10140025 Ga0207702_101400252 220
735 3300026078 Ga0207702_10206789 Ga0207702_102067892 220
736 3300026078 Ga0207702_10344058 Ga0207702_103440582 220
737 3300026078 Ga0207702_10364495 Ga0207702_103644953 220
738 3300026078 Ga0207702_10515357 Ga0207702_105153573 220
739 3300026078 Ga0207702_10526528 Ga0207702_105265283 220
740 3300026088 Ga0207641_10000256 Ga0207641_1000025632 220
741 3300026088 Ga0207641_10030030 Ga0207641_100300305 220
742 3300026089 Ga0207648_10002746 Ga0207648_100027464 220
743 3300026089 Ga0207648_10175494 Ga0207648_101754943 220
744 3300026095 Ga0207676_10055230 Ga0207676_100552304 220
745 3300026095 Ga0207676_10094583 Ga0207676_100945832 220
746 3300026095 Ga0207676_10269433 Ga0207676_102694333 220
747 3300026095 Ga0207676_10289152 Ga0207676_102891523 220
748 3300026095 Ga0207676_11009548 Ga0207676_110095481 220
749 3300026116 Ga0207674_10004899 Ga0207674_1000489914 220
750 3300026116 Ga0207674_10012992 Ga0207674_100129929 220
751 3300026116 Ga0207674_10018670 Ga0207674_100186704 220
752 3300026116 Ga0207674_10034836 Ga0207674_100348367 220
753 3300026116 Ga0207674_10064334 Ga0207674_100643345 220
754 3300026116 Ga0207674_10177549 Ga0207674_101775492 220
755 3300026121 Ga0207683_10002872 Ga0207683_1000287212 220
756 3300026121 Ga0207683_10004561 Ga0207683_100045618 220
757 3300026121 Ga0207683_10007564 Ga0207683_100075648 220
758 3300026121 Ga0207683_10039722 Ga0207683_100397224 220
759 3300026121 Ga0207683_10046329 Ga0207683_100463292 220
760 3300026121 Ga0207683_10217735 Ga0207683_102177353 220
761 3300026121 Ga0207683_10541921 Ga0207683_105419212 220
762 3300026142 Ga0207698_10001619 Ga0207698_1000161914 220
763 3300026142 Ga0207698_10001854 Ga0207698_1000185410 220
764 3300026142 Ga0207698_10002932 Ga0207698_100029327 220
765 3300026142 Ga0207698_10003776 Ga0207698_100037765 220
766 3300026142 Ga0207698_10006751 Ga0207698_100067512 220
767 3300026142 Ga0207698_10077796 Ga0207698_100777962 220
768 3300026142 Ga0207698_10175991 Ga0207698_101759913 220
769 3300026142 Ga0207698_10191769 Ga0207698_101917693 220
770 3300026142 Ga0207698_10219689 Ga0207698_102196892 220
771 3300026142 Ga0207698_10449317 Ga0207698_104493172 220
772 3300026142 Ga0207698_10460633 Ga0207698_104606333 220
773 3300026142 Ga0207698_10573614 Ga0207698_105736142 220
774 3300028379 Ga0268266_10006664 Ga0268266_100066645 220
775 3300028379 Ga0268266_10307593 Ga0268266_103075933 220
776 3300028379 Ga0268266_10484597 Ga0268266_104845972 220
777 3300028381 Ga0268264_10009751 Ga0268264_100097513 220
778 3300028381 Ga0268264_10095412 Ga0268264_100954123 220
779 3300028381 Ga0268264_10266100 Ga0268264_102661003 220
780 3300028381 Ga0268264_10504436 Ga0268264_105044362 220
781 3300031456 Ga0307513_10110056 Ga0307513_101100561 220
782 3300031456 Ga0307513_10585415 Ga0307513_105854151 220
783 3300031548 Ga0307408_100121145 Ga0307408_1001211453 220
784 3300031824 Ga0307413_10125564 Ga0307413_101255642 220
785 3300031901 Ga0307406_10081730 Ga0307406_100817303 220
786 3300031901 Ga0307406_10193313 Ga0307406_101933132 220
787 3300031901 Ga0307406_10245341 Ga0307406_102453411 220
788 3300031901 Ga0307406_10536361 Ga0307406_105363612 220
789 3300031903 Ga0307407_10519987 Ga0307407_105199871 220
790 3300031911 Ga0307412_10008170 Ga0307412_1000817010 220
791 3300031995 Ga0307409_100019646 Ga0307409_1000196464 220
792 3300031995 Ga0307409_100061380 Ga0307409_1000613804 220
793 3300031995 Ga0307409_100103585 Ga0307409_1001035852 220
794 3300031995 Ga0307409_100243607 Ga0307409_1002436073 220
795 3300031995 Ga0307409_100411279 Ga0307409_1004112792 220
796 3300032002 Ga0307416_101018825 Ga0307416_1010188251 220
797 3300032002 Ga0307416_101537883 Ga0307416_1015378832 220
798 3300032004 Ga0307414_10019216 Ga0307414_100192165 220
799 3300032004 Ga0307414_10096348 Ga0307414_100963482 220
800 3300032004 Ga0307414_10209105 Ga0307414_102091053 220
801 3300032004 Ga0307414_10359906 Ga0307414_103599062 220
802 3300032004 Ga0307414_10680128 Ga0307414_106801281 220
803 3300032005 Ga0307411_10020238 Ga0307411_100202386 220
804 3300032005 Ga0307411_10175929 Ga0307411_101759293 220
805 3300032005 Ga0307411_10180405 Ga0307411_101804052 220
806 3300032005 Ga0307411_10358860 Ga0307411_103588602 220
807 3300032126 Ga0307415_100000364 Ga0307415_10000036419 220
808 3300032126 Ga0307415_100157617 Ga0307415_1001576172 220
809 3300035088 Ga0373940_0021905 Ga0373940_0021905_146_808 220
810 3300035111 Ga0373923_0039690 Ga0373923_0039690_692_1354 220
811 3300035117 Ga0373953_0130300 Ga0373953_0130300_112_774 220
812 3300035118 Ga0373954_0015739 Ga0373954_0015739_889_1551 220
813 3300035170 Ga0373943_0007559 Ga0373943_0007559_1878_2540 220
814 3300035172 Ga0373955_0002938 Ga0373955_0002938_249_911 220
815 3300035692 Ga0373935_0068434 Ga0373935_0068434_816_1478 220
816 3300035695 Ga0373927_0101826 Ga0373927_0101826_840_1502 220
817 3300035724 Ga0373933_0017201 Ga0373933_0017201_541_1203 220
818 3300035725 Ga0373947_0056008 Ga0373947_0056008_268_930 220
819 3300036401 Ga0373937_0008086 Ga0373937_0008086_106_768 220
820 3300037068 Ga0373925_0324439 Ga0373925_0324439_285_947 220
821 3300037312 Ga0395899_0004378 Ga0395899_0004378_9557_10219 220
822 3300037312 Ga0395899_0009083 Ga0395899_0009083_1816_2478 220
823 3300037312 Ga0395899_0026252 Ga0395899_0026252_2887_3549 220
824 3300037312 Ga0395899_0034693 Ga0395899_0034693_2964_3626 220
825 3300037312 Ga0395899_0036423 Ga0395899_0036423_1113_1775 220
826 3300037312 Ga0395899_0053426 Ga0395899_0053426_53_715 220
827 3300037312 Ga0395899_0073457 Ga0395899_0073457_943_1605 220
828 3300037312 Ga0395899_0083038 Ga0395899_0083038_68_730 220
829 3300037312 Ga0395899_0103504 Ga0395899_0103504_733_1395 220
830 3300037312 Ga0395899_0114025 Ga0395899_0114025_88_750 220
831 3300037312 Ga0395899_0170533 Ga0395899_0170533_636_1298 220
832 3300037312 Ga0395899_0457420 Ga0395899_0457420_94_756 220
833 3300037312 Ga0395899_0482101 Ga0395899_0482101_61_723 220
834 3300037312 Ga0395899_0489858 Ga0395899_0489858_96_758 220
835 3300037418 Ga0395900_0000192 Ga0395900_0000192_91029_91691 220
836 3300037418 Ga0395900_0000605 Ga0395900_0000605_39201_39863 220
837 3300037418 Ga0395900_0007106 Ga0395900_0007106_3102_3764 220
838 3300037418 Ga0395900_0036057 Ga0395900_0036057_283_945 220
839 3300037418 Ga0395900_0051097 Ga0395900_0051097_2290_2952 220
840 3300037418 Ga0395900_0055607 Ga0395900_0055607_2560_3222 220
841 3300037418 Ga0395900_0058668 Ga0395900_0058668_3275_3937 220
842 3300037418 Ga0395900_0061192 Ga0395900_0061192_94_756 220
843 3300037418 Ga0395900_0072413 Ga0395900_0072413_1834_2496 220
844 3300037418 Ga0395900_0080857 Ga0395900_0080857_1688_2350 220
845 3300037418 Ga0395900_0090507 Ga0395900_0090507_2188_2850 220
846 3300037418 Ga0395900_0155034 Ga0395900_0155034_1624_2286 220
847 3300037418 Ga0395900_0179656 Ga0395900_0179656_886_1548 220
848 3300037418 Ga0395900_0183756 Ga0395900_0183756_398_1060 220
849 3300037418 Ga0395900_0214332 Ga0395900_0214332_445_1107 220
850 3300037418 Ga0395900_0215400 Ga0395900_0215400_301_963 220
851 3300037418 Ga0395900_0219135 Ga0395900_0219135_359_1021 220
852 3300037418 Ga0395900_0241083 Ga0395900_0241083_242_904 220
853 3300037418 Ga0395900_0289362 Ga0395900_0289362_429_1091 220
854 3300037418 Ga0395900_0326469 Ga0395900_0326469_353_1015 220
855 3300037418 Ga0395900_0350590 Ga0395900_0350590_211_873 220
856 3300037418 Ga0395900_0359661 Ga0395900_0359661_664_1326 220
857 3300037418 Ga0395900_0411276 Ga0395900_0411276_357_1019 220
858 3300037418 Ga0395900_0550502 Ga0395900_0550502_365_1027 220
859 3300037418 Ga0395900_0570000 Ga0395900_0570000_153_815 220
860 3300037418 Ga0395900_0574719 Ga0395900_0574719_324_986 220
861 3300037418 Ga0395900_0586485 Ga0395900_0586485_202_864 220
862 3300037418 Ga0395900_0610473 Ga0395900_0610473_20_682 220
863 3300037418 Ga0395900_0681563 Ga0395900_0681563_11_673 220
864 3300037418 Ga0395900_0792504 Ga0395900_0792504_165_827 220
865 3300037466 Ga0395898_0001129 Ga0395898_0001129_2257_2919 220
866 3300037466 Ga0395898_0003738 Ga0395898_0003738_1060_1722 220
867 3300037466 Ga0395898_0011773 Ga0395898_0011773_6923_7585 220
868 3300037466 Ga0395898_0029448 Ga0395898_0029448_3850_4512 220
869 3300037466 Ga0395898_0031906 Ga0395898_0031906_3523_4185 220
870 3300037466 Ga0395898_0042068 Ga0395898_0042068_2265_2927 220
871 3300037466 Ga0395898_0047931 Ga0395898_0047931_2113_2775 220
872 3300037466 Ga0395898_0070952 Ga0395898_0070952_2040_2702 220
873 3300037466 Ga0395898_0122081 Ga0395898_0122081_58_720 220
874 3300037466 Ga0395898_0136377 Ga0395898_0136377_1231_1893 220
875 3300037466 Ga0395898_0168757 Ga0395898_0168757_1318_1980 220
876 3300037466 Ga0395898_0177449 Ga0395898_0177449_555_1217 220
877 3300037466 Ga0395898_0226453 Ga0395898_0226453_72_734 220
878 3300037466 Ga0395898_0250581 Ga0395898_0250581_93_755 220
879 3300037466 Ga0395898_0264317 Ga0395898_0264317_491_1153 220
880 3300037466 Ga0395898_0313339 Ga0395898_0313339_579_1241 220
881 3300037466 Ga0395898_0670119 Ga0395898_0670119_226_945 220
882 3300037471 Ga0395905_0000109 Ga0395905_0000109_12406_13068 220
883 3300037471 Ga0395905_0000187 Ga0395905_0000187_73413_74075 220
884 3300037471 Ga0395905_0002154 Ga0395905_0002154_3695_4357 220
885 3300037471 Ga0395905_0006616 Ga0395905_0006616_2129_2791 220
886 3300037471 Ga0395905_0025223 Ga0395905_0025223_1996_2658 220
887 3300037471 Ga0395905_0027230 Ga0395905_0027230_576_1238 220
888 3300037471 Ga0395905_0029352 Ga0395905_0029352_4075_4737 220
889 3300037471 Ga0395905_0033872 Ga0395905_0033872_3238_3900 220
890 3300037471 Ga0395905_0039368 Ga0395905_0039368_3499_4161 220
891 3300037471 Ga0395905_0042141 Ga0395905_0042141_727_1389 220
892 3300037471 Ga0395905_0049315 Ga0395905_0049315_1297_1959 220
893 3300037471 Ga0395905_0108633 Ga0395905_0108633_1737_2399 220
894 3300037471 Ga0395905_0117672 Ga0395905_0117672_1173_1835 220
895 3300037471 Ga0395905_0130213 Ga0395905_0130213_592_1254 220
896 3300037471 Ga0395905_0142446 Ga0395905_0142446_953_1615 220
897 3300037471 Ga0395905_0158899 Ga0395905_0158899_657_1319 220
898 3300037471 Ga0395905_0181629 Ga0395905_0181629_1283_1945 220
899 3300037471 Ga0395905_0182779 Ga0395905_0182779_943_1605 220
900 3300037471 Ga0395905_0280826 Ga0395905_0280826_753_1415 220
901 3300037471 Ga0395905_0281084 Ga0395905_0281084_600_1262 220
902 3300037471 Ga0395905_0356849 Ga0395905_0356849_82_744 220
903 3300037471 Ga0395905_0374954 Ga0395905_0374954_599_1261 220
904 3300037471 Ga0395905_0390295 Ga0395905_0390295_308_970 220
905 3300037471 Ga0395905_0434626 Ga0395905_0434626_96_758 220
906 3300037471 Ga0395905_0464968 Ga0395905_0464968_123_785 220
907 3300037471 Ga0395905_0565474 Ga0395905_0565474_120_836 220
908 3300037853 Ga0436364_1351497 Ga0436364_1351497_11281_11943 220
909 3300038443 Ga0395901_0000041 Ga0395901_0000041_143277_143939 220
910 3300038443 Ga0395901_0007639 Ga0395901_0007639_8819_9481 220
911 3300038443 Ga0395901_0013118 Ga0395901_0013118_1069_1731 220
912 3300038443 Ga0395901_0013360 Ga0395901_0013360_3871_4533 220
913 3300038443 Ga0395901_0030568 Ga0395901_0030568_1322_1984 220
914 3300038443 Ga0395901_0031771 Ga0395901_0031771_2272_2934 220
915 3300038443 Ga0395901_0035701 Ga0395901_0035701_4411_5073 220
916 3300038443 Ga0395901_0037112 Ga0395901_0037112_2288_2950 220
917 3300038443 Ga0395901_0038923 Ga0395901_0038923_3102_3764 220
918 3300038443 Ga0395901_0057791 Ga0395901_0057791_909_1571 220
919 3300038443 Ga0395901_0069305 Ga0395901_0069305_1226_1888 220
920 3300038443 Ga0395901_0074062 Ga0395901_0074062_718_1380 220
921 3300038443 Ga0395901_0088925 Ga0395901_0088925_325_987 220
922 3300038443 Ga0395901_0089778 Ga0395901_0089778_2257_2919 220
923 3300038443 Ga0395901_0095770 Ga0395901_0095770_1050_1712 220
924 3300038443 Ga0395901_0156521 Ga0395901_0156521_1427_2089 220
925 3300038443 Ga0395901_0206096 Ga0395901_0206096_388_1050 220
926 3300038443 Ga0395901_0230938 Ga0395901_0230938_1109_1771 220
927 3300038443 Ga0395901_0386550 Ga0395901_0386550_326_1030 220
928 3300038443 Ga0395901_0551323 Ga0395901_0551323_77_739 220
929 3300038443 Ga0395901_0928889 Ga0395901_0928889_98_760 220
930 3300038443 Ga0395901_1123004 Ga0395901_1123004_53_715 220
931 3300039437 Ga0436365_0252769 Ga0436365_0252769_8155_8817 220
932 3300041404 Ga0439436_0064799 Ga0439436_0064799_326_988 220
933 3300042005 Ga0439448_0021361 Ga0439448_0021361_272_934 220
934 3300042005 Ga0439448_0066848 Ga0439448_0066848_118_780 220
935 3300042005 Ga0439448_0151430 Ga0439448_0151430_113_775 220
936 3300042006 Ga0439432_060816 Ga0439432_060816_318_980 220
937 3300042006 Ga0439432_083516 Ga0439432_083516_198_860 220
938 3300042130 Ga0450892_006643 Ga0450892_006643_110_772 220
939 3300042157 Ga0439458_0000134 Ga0439458_0000134_383_1045 220
940 3300044656 Ga0466969_0044867 Ga0466969_0044867_323_985 220
941 3300044658 Ga0466972_0048226 Ga0466972_0048226_1129_1791 220
942 3300044683 Ga0466965_0045810 Ga0466965_0045810_92_754 220
943 3300044683 Ga0466965_0047661 Ga0466965_0047661_938_1600 220
944 3300044683 Ga0466965_0174651 Ga0466965_0174651_87_749 220
945 3300044683 Ga0466965_0196599 Ga0466965_0196599_181_843 220
946 3300044684 Ga0466966_0000315 Ga0466966_0000315_26351_27013 220
947 3300044684 Ga0466966_0004143 Ga0466966_0004143_2899_3561 220
948 3300044684 Ga0466966_0055259 Ga0466966_0055259_1395_2057 220
949 3300044684 Ga0466966_0074540 Ga0466966_0074540_86_748 220
950 3300044684 Ga0466966_0092760 Ga0466966_0092760_830_1492 220
951 3300044684 Ga0466966_0120045 Ga0466966_0120045_150_812 220
952 3300044684 Ga0466966_0156182 Ga0466966_0156182_527_1189 220
953 3300044684 Ga0466966_0174323 Ga0466966_0174323_387_1049 220
954 3300044684 Ga0466966_0250981 Ga0466966_0250981_252_914 220
955 3300044693 Ga0466961_0024915 Ga0466961_0024915_1550_2212 220
956 3300044693 Ga0466961_0050574 Ga0466961_0050574_1189_1851 220
957 3300044693 Ga0466961_0051000 Ga0466961_0051000_238_900 220
958 3300044693 Ga0466961_0122377 Ga0466961_0122377_398_1060 220
959 3300044693 Ga0466961_0244039 Ga0466961_0244039_23_685 220
960 3300044693 Ga0466961_0291035 Ga0466961_0291035_185_847 220
961 3300044694 Ga0466963_0010173 Ga0466963_0010173_3078_3740 220
962 3300044694 Ga0466963_0027784 Ga0466963_0027784_1173_1835 220
963 3300044694 Ga0466963_0040764 Ga0466963_0040764_49_711 220
964 3300044694 Ga0466963_0114922 Ga0466963_0114922_17_679 220
965 3300044694 Ga0466963_0162869 Ga0466963_0162869_553_1215 220
966 3300044694 Ga0466963_0198462 Ga0466963_0198462_60_722 220
967 3300044694 Ga0466963_0311009 Ga0466963_0311009_39_701 220
968 3300044694 Ga0466963_0633197 Ga0466963_0633197_61_723 220
969 3300044706 Ga0466964_0225265 Ga0466964_0225265_19_681 220
970 3300044706 Ga0466964_0293274 Ga0466964_0293274_67_729 220
971 3300044719 Ga0466971_0021929 Ga0466971_0021929_1230_1892 220
972 3300044719 Ga0466971_0057700 Ga0466971_0057700_627_1289 220
973 3300044719 Ga0466971_0062662 Ga0466971_0062662_1000_1662 220
974 3300044735 Ga0466968_0022389 Ga0466968_0022389_418_1080 220
975 3300044765 Ga0466970_0003329 Ga0466970_0003329_4010_4672 220
976 3300044765 Ga0466970_0016667 Ga0466970_0016667_2484_3146 220
977 3300044765 Ga0466970_0095969 Ga0466970_0095969_621_1283 220
978 3300044765 Ga0466970_0121439 Ga0466970_0121439_295_957 220
979 3300044765 Ga0466970_0183450 Ga0466970_0183450_271_933 220
980 3300044842 Ga0466957_0009707 Ga0466957_0009707_2137_2799 220
981 3300044842 Ga0466957_0012172 Ga0466957_0012172_3557_4219 220
982 3300044842 Ga0466957_0024075 Ga0466957_0024075_1291_1953 220
983 3300044842 Ga0466957_0102757 Ga0466957_0102757_110_772 220
984 3300044901 Ga0466960_0033802 Ga0466960_0033802_677_1339 220
985 3300044901 Ga0466960_0035956 Ga0466960_0035956_1371_2033 220
986 3300045049 Ga0466959_0047926 Ga0466959_0047926_1998_2660 220
987 3300045049 Ga0466959_0057935 Ga0466959_0057935_1773_2435 220
988 3300045049 Ga0466959_0110060 Ga0466959_0110060_1197_1859 220
989 3300045049 Ga0466959_0331208 Ga0466959_0331208_339_1001 220
990 3300045836 Ga0466958_0016669 Ga0466958_0016669_354_1016 220
991 3300045836 Ga0466958_0042520 Ga0466958_0042520_533_1195 220
992 3300045836 Ga0466958_0076409 Ga0466958_0076409_457_1119 220
993 3300045836 Ga0466958_0161531 Ga0466958_0161531_626_1288 220
994 3300045836 Ga0466958_0283648 Ga0466958_0283648_389_1051 220
995 3300045976 Ga0466967_0004243 Ga0466967_0004243_8368_9030 220
996 3300045976 Ga0466967_0004539 Ga0466967_0004539_3362_4024 220
997 3300045976 Ga0466967_0017060 Ga0466967_0017060_4621_5283 220
998 3300045976 Ga0466967_0154906 Ga0466967_0154906_1050_1712 220
999 3300045976 Ga0466967_0184774 Ga0466967_0184774_139_801 220
1000 3300045976 Ga0466967_0265372 Ga0466967_0265372_938_1600 220
1001 3300045976 Ga0466967_0323247 Ga0466967_0323247_507_1253 220
1002 3300045976 Ga0466967_0323264 Ga0466967_0323264_230_892 220
1003 3300045976 Ga0466967_0463969 Ga0466967_0463969_177_839 220
1004 3300045976 Ga0466967_0573786 Ga0466967_0573786_364_1026 220
1005 3300045976 Ga0466967_0634022 Ga0466967_0634022_276_938 220
1006 3300045976 Ga0466967_0767515 Ga0466967_0767515_205_867 220
1007 3300045976 Ga0466967_0820954 Ga0466967_0820954_71_733 220
1008 3300045976 Ga0466967_0852389 Ga0466967_0852389_98_760 220
1009 3300045976 Ga0466967_0868741 Ga0466967_0868741_36_698 220
1010 3300045976 Ga0466967_0983231 Ga0466967_0983231_110_772 220
1011 3300046471 Ga0495650_0003691 Ga0495650_0003691_9144_9806 220
1012 3300046473 Ga0495582_0344488 Ga0495582_0344488_131_793 220
1013 3300046507 Ga0495606_0145845 Ga0495606_0145845_299_961 220
1014 3300046528 Ga0495642_0032662 Ga0495642_0032662_1401_2063 220
1015 3300046528 Ga0495642_0082667 Ga0495642_0082667_438_1100 220
1016 3300046536 Ga0495587_0203892 Ga0495587_0203892_34_696 220
1017 3300046537 Ga0495598_0000354 Ga0495598_0000354_1495_2157 220
1018 3300046539 Ga0495621_0000064 Ga0495621_0000064_5168_5830 220
1019 3300046616 Ga0495668_0046220 Ga0495668_0046220_1329_1991 220
1020 3300046660 Ga0495625_0117641 Ga0495625_0117641_407_1069 220
1021 3300046684 Ga0495669_0001578 Ga0495669_0001578_484_1146 220
1022 3300046684 Ga0495669_0001675 Ga0495669_0001675_6022_6684 220
1023 3300046684 Ga0495669_0002837 Ga0495669_0002837_1654_2316 220
1024 3300046684 Ga0495669_0016653 Ga0495669_0016653_491_1153 220
1025 3300046684 Ga0495669_0020251 Ga0495669_0020251_1763_2425 220
1026 3300046684 Ga0495669_0063397 Ga0495669_0063397_477_1139 220
1027 3300046691 Ga0495670_0000346 Ga0495670_0000346_18324_18986 220
1028 3300046691 Ga0495670_0187632 Ga0495670_0187632_183_845 220
1029 3300047445 Ga0495677_0037518 Ga0495677_0037518_54_716 220
1030 3300047447 Ga0495685_126577 Ga0495685_126577_131_793 220
1031 3300048088 Ga0495602_0050257 Ga0495602_0050257_912_1574 220
1032 3300048903 Ga0496100_0008370 Ga0496100_0008370_3102_3764 220
1033 3300048903 Ga0496100_0157809 Ga0496100_0157809_438_1100 220
1034 3300048903 Ga0496100_0293475 Ga0496100_0293475_441_1103 220
1035 3300048903 Ga0496100_0299083 Ga0496100_0299083_148_810 220
1036 3300048904 Ga0496101_0623762 Ga0496101_0623762_80_742 220
1037 3300048905 Ga0496102_0166675 Ga0496102_0166675_613_1275 220
1038 3300048905 Ga0496102_0233237 Ga0496102_0233237_573_1235 220
1039 3300048905 Ga0496102_0242635 Ga0496102_0242635_25_687 220
1040 3300048905 Ga0496102_0426603 Ga0496102_0426603_146_808 220
1041 3300048905 Ga0496102_0482565 Ga0496102_0482565_198_860 220
1042 3300048906 Ga0496103_0269164 Ga0496103_0269164_377_1039 220
1043 3300048906 Ga0496103_0367997 Ga0496103_0367997_98_760 220
1044 3300048907 Ga0496104_0119290 Ga0496104_0119290_322_984 220
1045 3300048909 Ga0496106_0004149 Ga0496106_0004149_7696_8358 220
1046 3300048909 Ga0496106_0274125 Ga0496106_0274125_402_1064 220
1047 3300048910 Ga0496107_0013433 Ga0496107_0013433_3246_3908 220
1048 3300048910 Ga0496107_0430084 Ga0496107_0430084_112_774 220
1049 3300048911 Ga0496108_0002723 Ga0496108_0002723_2099_2761 220
1050 3300048911 Ga0496108_0004380 Ga0496108_0004380_8896_9558 220
1051 3300048911 Ga0496108_0011863 Ga0496108_0011863_172_834 220
1052 3300048911 Ga0496108_0051136 Ga0496108_0051136_1137_1799 220
1053 3300048911 Ga0496108_0283727 Ga0496108_0283727_680_1342 220
1054 3300048912 Ga0496109_0003002 Ga0496109_0003002_9418_10080 220
1055 3300048912 Ga0496109_0017473 Ga0496109_0017473_5495_6157 220
1056 3300048912 Ga0496109_0045279 Ga0496109_0045279_3047_3709 220
1057 3300048912 Ga0496109_0060780 Ga0496109_0060780_458_1120 220
1058 3300048912 Ga0496109_0280719 Ga0496109_0280719_499_1161 220
1059 3300048913 Ga0496110_0000298 Ga0496110_0000298_5542_6204 220
1060 3300048913 Ga0496110_0053866 Ga0496110_0053866_414_1076 220
1061 3300048913 Ga0496110_0244316 Ga0496110_0244316_179_841 220
1062 3300048914 Ga0496111_0020065 Ga0496111_0020065_3041_3703 220
1063 3300048914 Ga0496111_0084054 Ga0496111_0084054_1334_1996 220
1064 3300048914 Ga0496111_0485986 Ga0496111_0485986_195_857 220
1065 3300048915 Ga0496112_0007247 Ga0496112_0007247_9086_9748 220
1066 3300048915 Ga0496112_0014536 Ga0496112_0014536_3495_4157 220
1067 3300048915 Ga0496112_0074884 Ga0496112_0074884_450_1112 220
1068 3300048915 Ga0496112_0142481 Ga0496112_0142481_1537_2199 220
1069 3300048915 Ga0496112_0937187 Ga0496112_0937187_10_672 220
1070 3300048916 Ga0496113_0013322 Ga0496113_0013322_1542_2204 220
1071 3300048916 Ga0496113_0074138 Ga0496113_0074138_778_1440 220
1072 3300048917 Ga0496114_0011356 Ga0496114_0011356_4637_5299 220
1073 3300048918 Ga0496115_0063673 Ga0496115_0063673_199_861 220
1074 3300049583 Ga0501067_0112865 Ga0501067_0112865_601_1263 220
1075 3300049742 Ga0501080_0114902 Ga0501080_0114902_1725_2387 220
1076 3300061719 Ga0466962_0005370 Ga0466962_0005370_2703_3365 220
1077 3300061719 Ga0466962_0050158 Ga0466962_0050158_528_1190 220

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nvp-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.8034 3 218
6nvo-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.8032 3 218
6nvo-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.7886 3 218
6nvp-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.7885 3 218
1kjq-assembly1.cif.gz_A crystal structure of glycinamide ribonucleotide transformylase in complex with mg-adp 0.6715 53 105
ID Description Score Start End Superfamily
af_Q2FVI2_1_263_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6975 28 111 3.60.21.10
2p90C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;PAC-like subunit 0.688 56 74 3.40.50.10900
4m0vA01 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.653 26 112 3.60.21.10
3d03A01 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;GpdQ, catalytic alpha/beta sandwich domain 0.6504 26 112 3.60.21.40
af_Q60344_23_147_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6402 28 143 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A520ISP3-F1-model_v4 Phosphoesterase 0.9686 58 220
AF-A0A520ISP3-F1-model_v4 Phosphoesterase 0.9571 58 220
AF-A0A6L3ZYX5-F1-model_v4 deleted 0.948 93 220
AF-A0A2A2M410-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.946 1 220
AF-A0A245ZKW7-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9449 1 220 GO:0016787

Feature Viewer

pLDDT pTM Quality
89.37 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map