F489546

General Info

Members Datasets Scaffolds Average Seq Length
1074 309 2148 70

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0030375|Ga0501067_0030375_1547_1780
Length 77
Sequence MPRDLAEGAVTTQATVSLLRWLRRQLREPSPLRERLEAAIENDDPAEARRIVSNAPFSDAQRRHVERLLDEWEHGAR

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
102 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
198 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
199 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
200 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
201 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
202 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
203 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
204 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
205 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
206 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
207 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
215 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
216 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
217 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
218 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
219 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
220 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
221 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
222 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
223 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
224 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
225 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
226 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
227 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
228 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
229 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
230 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
231 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
232 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
233 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
234 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
235 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
236 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
237 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
242 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
243 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
244 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
245 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
246 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
282 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
283 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
284 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
285 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
286 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
287 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
288 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
291 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
295 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
296 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
297 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
298 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
299 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
300 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
301 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
302 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
303 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
304 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
305 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
306 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
307 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
308 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
309 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.03
Rhizosphere 94.79
Stem 0
Stem Tuber 0
Unclassified 20.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0030375 3300049583 Bacteria 2997
2 Ga0070658_10086833 3300005327 Bacteria 2574
3 Ga0070658_10533517 3300005327 Bacteria 1015
4 Ga0070658_10802688 3300005327 Bacteria 818
5 Ga0070658_10914885 3300005327 Unclassified 763
6 Ga0070676_10792585 3300005328 Bacteria 699
7 Ga0070683_100049689 3300005329 Bacteria 3880
8 Ga0070683_100117354 3300005329 Bacteria 2513
9 Ga0070683_100299275 3300005329 Bacteria 1530
10 Ga0070683_101062570 3300005329 Bacteria 777
11 Ga0070683_102122879 3300005329 Unclassified 539
12 Ga0070670_100121050 3300005331 Bacteria 2258
13 Ga0070670_100257384 3300005331 Bacteria 1521
14 Ga0070670_100805547 3300005331 Bacteria 848
15 Ga0070677_10722496 3300005333 Unclassified 563
16 Ga0068869_100149486 3300005334 Bacteria 1810
17 Ga0068869_100815153 3300005334 Bacteria 803
18 Ga0068869_101261467 3300005334 Bacteria 651
19 Ga0070666_10157180 3300005335 Bacteria 1588
20 Ga0070680_100018540 3300005336 Bacteria 5500
21 Ga0070680_100072322 3300005336 Bacteria 2834
22 Ga0070680_101051017 3300005336 Bacteria 704
23 Ga0070682_100029320 3300005337 Bacteria 3312
24 Ga0070682_100111676 3300005337 Bacteria 1822
25 Ga0070682_100200674 3300005337 Bacteria 1407
26 Ga0070682_100265707 3300005337 Bacteria 1244
27 Ga0070682_100300470 3300005337 Bacteria 1178
28 Ga0070682_100635289 3300005337 Unclassified 848
29 Ga0068868_100074981 3300005338 Bacteria 2703
30 Ga0068868_100132822 3300005338 Bacteria 2038
31 Ga0068868_100134574 3300005338 Bacteria 2025
32 Ga0068868_100361093 3300005338 Bacteria 1246
33 Ga0070660_100000633 3300005339 Bacteria 23391
34 Ga0070660_100021968 3300005339 Bacteria 4713
35 Ga0070660_100154204 3300005339 Bacteria 1848
36 Ga0070660_100188360 3300005339 Bacteria 1671
37 Ga0070660_100476574 3300005339 Bacteria 1037
38 Ga0070660_101310834 3300005339 Bacteria 614
39 Ga0070689_100027744 3300005340 Bacteria 4271
40 Ga0070689_100055360 3300005340 Bacteria 3074
41 Ga0070691_10190904 3300005341 Bacteria 1072
42 Ga0070691_10677819 3300005341 Bacteria 617
43 Ga0070687_100133781 3300005343 Bacteria 1435
44 Ga0070661_100016213 3300005344 Bacteria 5263
45 Ga0070661_100039051 3300005344 Bacteria 3457
46 Ga0070661_100584573 3300005344 Unclassified 901
47 Ga0070661_100663101 3300005344 Bacteria 848
48 Ga0070661_100791387 3300005344 Unclassified 778
49 Ga0070661_101163214 3300005344 Bacteria 644
50 Ga0070692_10002758 3300005345 Bacteria 6914
51 Ga0070692_10235194 3300005345 Unclassified 1089
52 Ga0070692_10393801 3300005345 Bacteria 873
53 Ga0070668_100081789 3300005347 Bacteria 2532
54 Ga0070668_101378021 3300005347 Bacteria 642
55 Ga0070669_100272160 3300005353 Unclassified 1355
56 Ga0070669_100793312 3300005353 Bacteria 805
57 Ga0070675_100009177 3300005354 Bacteria 7681
58 Ga0070675_100039981 3300005354 Bacteria 3828
59 Ga0070675_100503610 3300005354 Unclassified 1091
60 Ga0070675_100711602 3300005354 Bacteria 915
61 Ga0070675_101954622 3300005354 Bacteria 541
62 Ga0070671_100095733 3300005355 Bacteria 2489
63 Ga0070671_100125150 3300005355 Bacteria 2164
64 Ga0070671_100794346 3300005355 Bacteria 824
65 Ga0070671_101260512 3300005355 Unclassified 651
66 Ga0070671_101270308 3300005355 Bacteria 649
67 Ga0070674_100007213 3300005356 Bacteria 6543
68 Ga0070674_100163114 3300005356 Bacteria 1692
69 Ga0070674_100495528 3300005356 Bacteria 1016
70 Ga0070673_100019858 3300005364 Bacteria 4833
71 Ga0070673_100036452 3300005364 Bacteria 3739
72 Ga0070673_100804132 3300005364 Bacteria 868
73 Ga0070673_101249799 3300005364 Unclassified 697
74 Ga0070673_101596514 3300005364 Bacteria 616
75 Ga0070673_102046133 3300005364 Unclassified 544
76 Ga0070688_100002575 3300005365 Bacteria 9188
77 Ga0070688_100006031 3300005365 Bacteria 6432
78 Ga0070688_100617943 3300005365 Unclassified 831
79 Ga0070659_100004465 3300005366 Bacteria 9992
80 Ga0070659_100018645 3300005366 Bacteria 5238
81 Ga0070659_100033431 3300005366 Bacteria 3994
82 Ga0070659_100494019 3300005366 Bacteria 1042
83 Ga0070659_100564431 3300005366 Bacteria 975
84 Ga0070659_100638604 3300005366 Bacteria 917
85 Ga0070659_100787089 3300005366 Unclassified 826
86 Ga0070659_100930586 3300005366 Bacteria 761
87 Ga0070659_100950557 3300005366 Unclassified 753
88 Ga0070667_100088116 3300005367 Bacteria 2665
89 Ga0070667_100683427 3300005367 Bacteria 949
90 Ga0070667_100735942 3300005367 Bacteria 914
91 Ga0070703_10021633 3300005406 Bacteria 1882
92 Ga0070703_10312121 3300005406 Unclassified 659
93 Ga0070709_11360427 3300005434 Unclassified 574
94 Ga0070714_100909282 3300005435 Unclassified 855
95 Ga0070714_101228910 3300005435 Bacteria 731
96 Ga0070710_10289824 3300005437 Bacteria 1065
97 Ga0070701_10015521 3300005438 Bacteria 3520
98 Ga0070701_10601297 3300005438 Unclassified 728
99 Ga0070711_100936001 3300005439 Unclassified 741
100 Ga0070705_100293521 3300005440 Bacteria 1161
101 Ga0070705_100939885 3300005440 Unclassified 698
102 Ga0070700_100041073 3300005441 Bacteria 2834
103 Ga0070700_101762555 3300005441 Unclassified 533
104 Ga0070694_100564523 3300005444 Bacteria 913
105 Ga0070694_100655177 3300005444 Archaea 850
106 Ga0070708_100562014 3300005445 Bacteria 1076
107 Ga0070663_100362622 3300005455 Unclassified 1176
108 Ga0070678_100080679 3300005456 Bacteria 2464
109 Ga0070678_100467415 3300005456 Unclassified 1108
110 Ga0070678_100476634 3300005456 Unclassified 1097
111 Ga0070678_100486812 3300005456 Bacteria 1086
112 Ga0070678_100636077 3300005456 Bacteria 956
113 Ga0070678_101405572 3300005456 Unclassified 652
114 Ga0070662_100026426 3300005457 Bacteria 4021
115 Ga0070662_100187537 3300005457 Unclassified 1633
116 Ga0070662_100311662 3300005457 Unclassified 1281
117 Ga0070662_100474000 3300005457 Unclassified 1041
118 Ga0070662_100834373 3300005457 Bacteria 784
119 Ga0070662_101035804 3300005457 Bacteria 703
120 Ga0070681_10013679 3300005458 Bacteria 8076
121 Ga0070681_10051781 3300005458 Bacteria 4095
122 Ga0070681_10052927 3300005458 Bacteria 4047
123 Ga0070681_10070972 3300005458 Bacteria 3447
124 Ga0070681_10790965 3300005458 Unclassified 865
125 Ga0068867_100036199 3300005459 Bacteria 3581
126 Ga0068867_100801772 3300005459 Unclassified 840
127 Ga0068867_101115103 3300005459 Unclassified 721
128 Ga0070685_10007211 3300005466 Bacteria 5680
129 Ga0070685_10025361 3300005466 Unclassified 3264
130 Ga0070685_10384070 3300005466 Unclassified 968
131 Ga0070706_100988656 3300005467 Unclassified 776
132 Ga0070698_100043820 3300005471 Bacteria 4585
133 Ga0070698_101843244 3300005471 Bacteria 558
134 Ga0070698_102200931 3300005471 Bacteria 505
135 Ga0070699_100067520 3300005518 Bacteria 3105
136 Ga0070679_100006282 3300005530 Bacteria 11060
137 Ga0070679_100052895 3300005530 Bacteria 4043
138 Ga0070679_100562728 3300005530 Unclassified 1084
139 Ga0070679_100821108 3300005530 Unclassified 873
140 Ga0070679_101058722 3300005530 Unclassified 755
141 Ga0070679_101829318 3300005530 Bacteria 556
142 Ga0070684_100008111 3300005535 Bacteria 8197
143 Ga0070684_100045881 3300005535 Bacteria 3785
144 Ga0070684_100072681 3300005535 Bacteria 3029
145 Ga0070684_100133362 3300005535 Bacteria 2242
146 Ga0070684_100708317 3300005535 Unclassified 939
147 Ga0070684_101315577 3300005535 Bacteria 680
148 Ga0070684_101471202 3300005535 Bacteria 642
149 Ga0070684_101646980 3300005535 Unclassified 605
150 Ga0068853_100011217 3300005539 Bacteria 7273
151 Ga0068853_100051377 3300005539 Bacteria 3548
152 Ga0068853_100190379 3300005539 Bacteria 1864
153 Ga0068853_100297165 3300005539 Bacteria 1492
154 Ga0068853_102493552 3300005539 Unclassified 501
155 Ga0070672_100034033 3300005543 Bacteria 3864
156 Ga0070672_100132649 3300005543 Bacteria 2049
157 Ga0070686_100010484 3300005544 Bacteria 5228
158 Ga0070686_100046839 3300005544 Bacteria 2731
159 Ga0070696_100172967 3300005546 Bacteria 1598
160 Ga0070696_100193062 3300005546 Bacteria 1516
161 Ga0070696_100459180 3300005546 Unclassified 1006
162 Ga0070693_100685860 3300005547 Unclassified 748
163 Ga0070665_100006229 3300005548 Bacteria 12206
164 Ga0070665_100025531 3300005548 Bacteria 5951
165 Ga0070665_100114296 3300005548 Bacteria 2702
166 Ga0070665_100523298 3300005548 Bacteria 1198
167 Ga0070704_100040027 3300005549 Bacteria 3223
168 Ga0070704_100530726 3300005549 Unclassified 1026
169 Ga0070704_101661162 3300005549 Bacteria 590
170 Ga0070704_101838651 3300005549 Unclassified 561
171 Ga0068855_100023380 3300005563 Bacteria 7402
172 Ga0068855_100104589 3300005563 Bacteria 3256
173 Ga0068855_100192032 3300005563 Bacteria 2303
174 Ga0068855_100442433 3300005563 Bacteria 1419
175 Ga0068855_100474251 3300005563 Bacteria 1363
176 Ga0068855_101946587 3300005563 Unclassified 595
177 Ga0070664_100010134 3300005564 Bacteria 7642
178 Ga0070664_100017988 3300005564 Bacteria 5803
179 Ga0070664_100086943 3300005564 Bacteria 2701
180 Ga0070664_100332796 3300005564 Bacteria 1378
181 Ga0070664_100407164 3300005564 Unclassified 1244
182 Ga0068857_100033549 3300005577 Bacteria 4540
183 Ga0068857_100041363 3300005577 Bacteria 4087
184 Ga0068857_100211359 3300005577 Bacteria 1770
185 Ga0068857_100248312 3300005577 Unclassified 1631
186 Ga0068857_100806508 3300005577 Bacteria 897
187 Ga0068857_101046682 3300005577 Bacteria 787
188 Ga0068857_101660612 3300005577 Bacteria 624
189 Ga0068857_101877655 3300005577 Bacteria 587
190 Ga0068854_100002029 3300005578 Bacteria 12407
191 Ga0068854_100503885 3300005578 Unclassified 1020
192 Ga0068854_100654255 3300005578 Bacteria 902
193 Ga0068854_101018438 3300005578 Bacteria 734
194 Ga0068854_101515435 3300005578 Unclassified 609
195 Ga0068854_101549583 3300005578 Unclassified 603
196 Ga0068856_100430163 3300005614 Unclassified 1340
197 Ga0068856_100487967 3300005614 Bacteria 1253
198 Ga0068856_100621762 3300005614 Bacteria 1101
199 Ga0068856_100851577 3300005614 Bacteria 931
200 Ga0070702_100111644 3300005615 Unclassified 1696
201 Ga0070702_100153874 3300005615 Bacteria 1479
202 Ga0068852_100048123 3300005616 Bacteria 3642
203 Ga0068852_100156046 3300005616 Bacteria 2126
204 Ga0068852_100170286 3300005616 Bacteria 2041
205 Ga0068852_100348754 3300005616 Bacteria 1445
206 Ga0068852_101237433 3300005616 Archaea 768
207 Ga0068859_100015815 3300005617 Bacteria 7581
208 Ga0068859_101724886 3300005617 Bacteria 692
209 Ga0068864_100011033 3300005618 Bacteria 7468
210 Ga0068864_100332577 3300005618 Unclassified 1430
211 Ga0068864_102093684 3300005618 Bacteria 572
212 Ga0068866_10004415 3300005718 Bacteria 5775
213 Ga0068866_10213278 3300005718 Bacteria 1161
214 Ga0068866_10240087 3300005718 Bacteria 1103
215 Ga0068866_10768385 3300005718 Unclassified 667
216 Ga0068866_10927788 3300005718 Unclassified 614
217 Ga0068861_100011331 3300005719 Bacteria 6192
218 Ga0068861_100577876 3300005719 Bacteria 1028
219 Ga0068861_101750244 3300005719 Unclassified 615
220 Ga0068851_10132174 3300005834 Bacteria 1351
221 Ga0068851_10199361 3300005834 Bacteria 1116
222 Ga0068870_10001003 3300005840 Bacteria 11148
223 Ga0068870_10003881 3300005840 Bacteria 6374
224 Ga0068870_10008337 3300005840 Bacteria 4659
225 Ga0068870_10057630 3300005840 Unclassified 2077
226 Ga0068870_10082898 3300005840 Bacteria 1777
227 Ga0068863_100105864 3300005841 Bacteria 2676
228 Ga0068858_100007230 3300005842 Bacteria 10760
229 Ga0068860_100066714 3300005843 Bacteria 3419
230 Ga0068862_100028166 3300005844 Bacteria 4730
231 Ga0068862_100696459 3300005844 Bacteria 984
232 Ga0068862_101014878 3300005844 Unclassified 821
233 Ga0081455_10273227 3300005937 Bacteria 1225
234 Ga0081455_10663204 3300005937 Bacteria 670
235 Ga0081455_10815365 3300005937 Unclassified 585
236 Ga0081455_11009112 3300005937 Bacteria 515
237 Ga0070717_10337186 3300006028 Bacteria 1346
238 Ga0075432_10021425 3300006058 Bacteria 2210
239 Ga0070712_100056702 3300006175 Bacteria 2749
240 Ga0097621_100017273 3300006237 Bacteria 5475
241 Ga0097621_100177324 3300006237 Bacteria 1840
242 Ga0097621_100461622 3300006237 Bacteria 1145
243 Ga0097621_102295504 3300006237 Bacteria 516
244 Ga0068871_100043606 3300006358 Bacteria 3603
245 Ga0068871_100329559 3300006358 Unclassified 1346
246 Ga0068871_101683145 3300006358 Archaea 601
247 Ga0068871_101708911 3300006358 Bacteria 597
248 Ga0075428_100146241 3300006844 Bacteria 2568
249 Ga0075430_100585373 3300006846 Bacteria 921
250 Ga0075431_100053006 3300006847 Bacteria 4182
251 Ga0075431_100435488 3300006847 Unclassified 1309
252 Ga0075431_100877211 3300006847 Bacteria 868
253 Ga0075433_10034678 3300006852 Bacteria 4335
254 Ga0075434_100439844 3300006871 Bacteria 1325
255 Ga0075434_101413828 3300006871 Unclassified 706
256 Ga0075429_100102391 3300006880 Bacteria 2500
257 Ga0068865_100002899 3300006881 Bacteria 10226
258 Ga0068865_100084563 3300006881 Bacteria 2286
259 Ga0068865_100125464 3300006881 Bacteria 1915
260 Ga0068865_100322996 3300006881 Bacteria 1242
261 Ga0068865_100388447 3300006881 Bacteria 1140
262 Ga0068865_100483227 3300006881 Bacteria 1030
263 Ga0097620_100015816 3300006931 Bacteria 7581
264 Ga0097620_101724940 3300006931 Bacteria 692
265 Ga0105244_10196835 3300009036 Bacteria 951
266 Ga0105240_10448263 3300009093 Bacteria 1445
267 Ga0111539_10016235 3300009094 Bacteria 9236
268 Ga0111539_10030637 3300009094 Bacteria 6539
269 Ga0111539_10090436 3300009094 Bacteria 3597
270 Ga0111539_10226752 3300009094 Bacteria 2176
271 Ga0111539_10389818 3300009094 Bacteria 1622
272 Ga0111539_10465031 3300009094 Bacteria 1473
273 Ga0111539_10573128 3300009094 Unclassified 1315
274 Ga0111539_11963190 3300009094 Unclassified 679
275 Ga0105245_10050595 3300009098 Bacteria 3724
276 Ga0105245_10294034 3300009098 Unclassified 1592
277 Ga0105245_10330032 3300009098 Bacteria 1505
278 Ga0105245_10453012 3300009098 Bacteria 1292
279 Ga0105245_10466339 3300009098 Bacteria 1274
280 Ga0105245_10601185 3300009098 Bacteria 1126
281 Ga0105245_10818093 3300009098 Bacteria 970
282 Ga0105245_10835307 3300009098 Unclassified 961
283 Ga0105245_11092135 3300009098 Bacteria 844
284 Ga0105245_11912924 3300009098 Unclassified 646
285 Ga0105245_13150569 3300009098 Bacteria 511
286 Ga0105247_10011070 3300009101 Bacteria 5443
287 Ga0114129_10009207 3300009147 Bacteria 14081
288 Ga0114129_10063203 3300009147 Bacteria 5170
289 Ga0114129_10278651 3300009147 Bacteria 2235
290 Ga0114129_10617029 3300009147 Bacteria 1403
291 Ga0114129_10797797 3300009147 Bacteria 1205
292 Ga0114129_11367646 3300009147 Bacteria 875
293 Ga0105243_10007846 3300009148 Bacteria 8204
294 Ga0105243_10061550 3300009148 Unclassified 3003
295 Ga0105243_10149023 3300009148 Bacteria 2005
296 Ga0105243_10234916 3300009148 Bacteria 1628
297 Ga0105243_10627272 3300009148 Bacteria 1039
298 Ga0105243_11389398 3300009148 Bacteria 722
299 Ga0105241_10010013 3300009174 Bacteria 6960
300 Ga0105241_10099377 3300009174 Bacteria 2311
301 Ga0105241_10174286 3300009174 Bacteria 1779
302 Ga0105241_10403910 3300009174 Bacteria 1199
303 Ga0105241_11845107 3300009174 Unclassified 591
304 Ga0105242_10048974 3300009176 Bacteria 3437
305 Ga0105242_10218143 3300009176 Bacteria 1703
306 Ga0105242_10226955 3300009176 Bacteria 1672
307 Ga0105242_10342147 3300009176 Unclassified 1379
308 Ga0105242_10435191 3300009176 Bacteria 1233
309 Ga0105242_11836557 3300009176 Unclassified 645
310 Ga0105242_12344823 3300009176 Unclassified 580
311 Ga0105248_10050536 3300009177 Bacteria 4663
312 Ga0105248_10497149 3300009177 Unclassified 1375
313 Ga0105248_12888562 3300009177 Unclassified 548
314 Ga0105237_10174871 3300009545 Bacteria 2147
315 Ga0105237_10372604 3300009545 Bacteria 1432
316 Ga0105237_12466084 3300009545 Unclassified 530
317 Ga0105238_10007268 3300009551 Bacteria 11087
318 Ga0105238_10048620 3300009551 Bacteria 4273
319 Ga0105238_10213991 3300009551 Bacteria 1904
320 Ga0105238_10345070 3300009551 Bacteria 1477
321 Ga0105238_10953130 3300009551 Unclassified 878
322 Ga0105238_11891090 3300009551 Bacteria 630
323 Ga0105238_13052158 3300009551 Unclassified 502
324 Ga0105249_10642927 3300009553 Unclassified 1118
325 Ga0105239_10065565 3300010375 Bacteria 3988
326 Ga0105239_10152209 3300010375 Bacteria 2582
327 Ga0105239_10354671 3300010375 Bacteria 1656
328 Ga0105239_11827137 3300010375 Bacteria 704
329 Ga0105239_11909657 3300010375 Bacteria 689
330 Ga0105239_12157021 3300010375 Archaea 648
331 Ga0105239_13139960 3300010375 Unclassified 538
332 Ga0105246_10103566 3300011119 Bacteria 2077
333 Ga0105246_10189919 3300011119 Bacteria 1589
334 Ga0105246_11426052 3300011119 Unclassified 647
335 Ga0105246_11802636 3300011119 Unclassified 585
336 Ga0157314_1013205 3300012500 Unclassified 753
337 Ga0157347_1066986 3300012502 Bacteria 524
338 Ga0157373_10046743 3300013100 Bacteria 3088
339 Ga0157373_10125310 3300013100 Bacteria 1806
340 Ga0157371_10008275 3300013102 Bacteria 8309
341 Ga0157371_10147925 3300013102 Bacteria 1675
342 Ga0157371_10183972 3300013102 Bacteria 1495
343 Ga0157371_10431856 3300013102 Bacteria 967
344 Ga0157370_10028771 3300013104 Bacteria 5463
345 Ga0157370_10082477 3300013104 Bacteria 3024
346 Ga0157370_10232346 3300013104 Bacteria 1707
347 Ga0157369_10184273 3300013105 Bacteria 2195
348 Ga0157369_10213454 3300013105 Bacteria 2022
349 Ga0157369_10312884 3300013105 Bacteria 1633
350 Ga0157374_10140233 3300013296 Bacteria 2346
351 Ga0157374_10650362 3300013296 Bacteria 1066
352 Ga0157374_10850665 3300013296 Unclassified 929
353 Ga0157374_10863396 3300013296 Bacteria 922
354 Ga0157374_11453637 3300013296 Bacteria 709
355 Ga0157374_11621919 3300013296 Bacteria 671
356 Ga0157374_11654437 3300013296 Unclassified 665
357 Ga0157378_10186973 3300013297 Unclassified 1951
358 Ga0157378_11117527 3300013297 Unclassified 825
359 Ga0157378_12927604 3300013297 Unclassified 529
360 Ga0163162_10524182 3300013306 Bacteria 1314
361 Ga0157372_10024231 3300013307 Bacteria 6588
362 Ga0157372_10063800 3300013307 Bacteria 4132
363 Ga0157372_10066412 3300013307 Bacteria 4052
364 Ga0157372_10133714 3300013307 Bacteria 2855
365 Ga0157372_10395222 3300013307 Bacteria 1611
366 Ga0157372_10833996 3300013307 Bacteria 1070
367 Ga0157372_10915202 3300013307 Bacteria 1017
368 Ga0157372_11010694 3300013307 Unclassified 963
369 Ga0157375_10008715 3300013308 Bacteria 8886
370 Ga0157375_10039371 3300013308 Bacteria 4549
371 Ga0157375_10205090 3300013308 Bacteria 2128
372 Ga0163163_10097475 3300014325 Bacteria 2960
373 Ga0163163_10311006 3300014325 Unclassified 1628
374 Ga0163163_11491121 3300014325 Unclassified 738
375 Ga0163163_12758276 3300014325 Unclassified 548
376 Ga0157380_10030921 3300014326 Bacteria 4106
377 Ga0157380_10058951 3300014326 Bacteria 3062
378 Ga0157380_10633454 3300014326 Unclassified 1064
379 Ga0157380_11549824 3300014326 Bacteria 717
380 Ga0157380_12905149 3300014326 Bacteria 545
381 Ga0182008_10821719 3300014497 Bacteria 541
382 Ga0157377_10013583 3300014745 Bacteria 4125
383 Ga0157377_10149549 3300014745 Bacteria 1442
384 Ga0157377_10648557 3300014745 Bacteria 760
385 Ga0157377_11199121 3300014745 Bacteria 588
386 Ga0157379_10036587 3300014968 Bacteria 4376
387 Ga0157379_11330168 3300014968 Bacteria 695
388 Ga0157376_10021308 3300014969 Bacteria 5033
389 Ga0157376_11127277 3300014969 Bacteria 811
390 Ga0163161_10019407 3300017792 Bacteria 4770
391 Ga0163161_10765798 3300017792 Bacteria 809
392 Ga0206356_10074813 3300020070 Archaea 822
393 Ga0206356_11026427 3300020070 Bacteria 2375
394 Ga0206354_10520300 3300020081 Bacteria 1057
395 Ga0206354_10868705 3300020081 Bacteria 699
396 Ga0206353_11653627 3300020082 Bacteria 3092
397 Ga0206353_11718206 3300020082 Unclassified 1089
398 Ga0207656_10191397 3300025321 Unclassified 985
399 Ga0207656_10401854 3300025321 Bacteria 689
400 Ga0207653_10007755 3300025885 Bacteria 3348
401 Ga0207682_10554894 3300025893 Unclassified 543
402 Ga0207642_10023887 3300025899 Bacteria 2450
403 Ga0207642_10350240 3300025899 Bacteria 871
404 Ga0207642_10736763 3300025899 Unclassified 623
405 Ga0207642_10946210 3300025899 Unclassified 553
406 Ga0207710_10062274 3300025900 Bacteria 1695
407 Ga0207688_10003380 3300025901 Bacteria 8707
408 Ga0207688_10011445 3300025901 Bacteria 4831
409 Ga0207688_10025323 3300025901 Bacteria 3257
410 Ga0207688_11005603 3300025901 Unclassified 527
411 Ga0207680_10673735 3300025903 Bacteria 741
412 Ga0207647_10190983 3300025904 Bacteria 1187
413 Ga0207645_10024812 3300025907 Bacteria 3884
414 Ga0207645_10391930 3300025907 Bacteria 933
415 Ga0207645_10844533 3300025907 Bacteria 622
416 Ga0207643_10004645 3300025908 Bacteria 7377
417 Ga0207643_10006379 3300025908 Bacteria 6317
418 Ga0207643_10007430 3300025908 Bacteria 5878
419 Ga0207643_10051829 3300025908 Bacteria 2330
420 Ga0207705_10295968 3300025909 Bacteria 1240
421 Ga0207684_10547595 3300025910 Bacteria 990
422 Ga0207684_10974837 3300025910 Bacteria 710
423 Ga0207684_11321966 3300025910 Unclassified 593
424 Ga0207654_10463004 3300025911 Bacteria 891
425 Ga0207707_10018617 3300025912 Bacteria 6054
426 Ga0207707_10022270 3300025912 Bacteria 5540
427 Ga0207707_10051099 3300025912 Bacteria 3600
428 Ga0207707_10173461 3300025912 Bacteria 1884
429 Ga0207707_10471082 3300025912 Bacteria 1073
430 Ga0207707_10634084 3300025912 Unclassified 902
431 Ga0207695_11213011 3300025913 Bacteria 635
432 Ga0207695_11406487 3300025913 Bacteria 578
433 Ga0207671_10150027 3300025914 Bacteria 1801
434 Ga0207671_10270080 3300025914 Bacteria 1340
435 Ga0207693_10229625 3300025915 Bacteria 1457
436 Ga0207660_10047819 3300025917 Bacteria 3026
437 Ga0207660_10057473 3300025917 Bacteria 2786
438 Ga0207660_10181005 3300025917 Bacteria 1637
439 Ga0207660_10203646 3300025917 Bacteria 1547
440 Ga0207660_10261399 3300025917 Bacteria 1369
441 Ga0207660_10527447 3300025917 Bacteria 959
442 Ga0207662_10139030 3300025918 Bacteria 1537
443 Ga0207657_10000275 3300025919 Bacteria 54762
444 Ga0207657_10001621 3300025919 Bacteria 24215
445 Ga0207657_10060290 3300025919 Bacteria 3257
446 Ga0207657_10101655 3300025919 Bacteria 2385
447 Ga0207657_10308213 3300025919 Bacteria 1253
448 Ga0207657_10967514 3300025919 Bacteria 654
449 Ga0207649_10085816 3300025920 Bacteria 2049
450 Ga0207649_10144914 3300025920 Bacteria 1629
451 Ga0207649_10160865 3300025920 Bacteria 1555
452 Ga0207649_10980377 3300025920 Bacteria 665
453 Ga0207649_11497305 3300025920 Unclassified 534
454 Ga0207652_10040605 3300025921 Bacteria 3951
455 Ga0207652_10045550 3300025921 Bacteria 3740
456 Ga0207652_10080380 3300025921 Bacteria 2850
457 Ga0207652_10143537 3300025921 Bacteria 2135
458 Ga0207652_10183239 3300025921 Bacteria 1882
459 Ga0207652_10331184 3300025921 Bacteria 1375
460 Ga0207652_10350047 3300025921 Bacteria 1333
461 Ga0207652_10511367 3300025921 Bacteria 1081
462 Ga0207681_10018673 3300025923 Bacteria 4372
463 Ga0207694_10024324 3300025924 Bacteria 4598
464 Ga0207694_10119575 3300025924 Bacteria 2102
465 Ga0207694_10388741 3300025924 Bacteria 1159
466 Ga0207694_10494788 3300025924 Bacteria 1023
467 Ga0207650_10002681 3300025925 Bacteria 12310
468 Ga0207650_10010855 3300025925 Bacteria 6260
469 Ga0207650_10269163 3300025925 Bacteria 1384
470 Ga0207650_10463923 3300025925 Unclassified 1055
471 Ga0207650_10872902 3300025925 Bacteria 763
472 Ga0207650_10874591 3300025925 Bacteria 763
473 Ga0207659_10016197 3300025926 Bacteria 4847
474 Ga0207659_10026366 3300025926 Bacteria 3920
475 Ga0207659_10436276 3300025926 Bacteria 1101
476 Ga0207687_10006518 3300025927 Bacteria 7711
477 Ga0207687_10207530 3300025927 Bacteria 1535
478 Ga0207687_10402333 3300025927 Bacteria 1126
479 Ga0207687_10825863 3300025927 Unclassified 791
480 Ga0207700_10715222 3300025928 Unclassified 894
481 Ga0207664_10815720 3300025929 Unclassified 839
482 Ga0207644_10021923 3300025931 Bacteria 4357
483 Ga0207644_10206249 3300025931 Bacteria 1552
484 Ga0207644_10524578 3300025931 Bacteria 979
485 Ga0207690_10016947 3300025932 Bacteria 4443
486 Ga0207690_10037450 3300025932 Bacteria 3149
487 Ga0207690_10119313 3300025932 Bacteria 1913
488 Ga0207690_10289422 3300025932 Bacteria 1278
489 Ga0207690_10415258 3300025932 Bacteria 1076
490 Ga0207690_10432271 3300025932 Bacteria 1055
491 Ga0207690_10559654 3300025932 Bacteria 930
492 Ga0207690_10636635 3300025932 Bacteria 873
493 Ga0207690_11088221 3300025932 Bacteria 666
494 Ga0207706_10021103 3300025933 Bacteria 5850
495 Ga0207706_10072559 3300025933 Bacteria 3027
496 Ga0207706_10598156 3300025933 Bacteria 947
497 Ga0207706_10769325 3300025933 Unclassified 820
498 Ga0207706_11000976 3300025933 Unclassified 702
499 Ga0207686_10080616 3300025934 Bacteria 2122
500 Ga0207686_10289793 3300025934 Bacteria 1212
501 Ga0207686_10597087 3300025934 Bacteria 868
502 Ga0207686_11040945 3300025934 Unclassified 665
503 Ga0207709_10024013 3300025935 Bacteria 3477
504 Ga0207709_10106035 3300025935 Unclassified 1869
505 Ga0207709_10347824 3300025935 Bacteria 1118
506 Ga0207709_10579563 3300025935 Bacteria 886
507 Ga0207709_11862627 3300025935 Unclassified 501
508 Ga0207670_10009107 3300025936 Bacteria 5642
509 Ga0207670_10137607 3300025936 Bacteria 1797
510 Ga0207669_10013786 3300025937 Bacteria 4030
511 Ga0207669_10064407 3300025937 Bacteria 2268
512 Ga0207669_10126815 3300025937 Unclassified 1745
513 Ga0207669_10235747 3300025937 Bacteria 1353
514 Ga0207669_10449630 3300025937 Bacteria 1021
515 Ga0207669_10607739 3300025937 Unclassified 889
516 Ga0207704_10068882 3300025938 Bacteria 2233
517 Ga0207704_10129335 3300025938 Unclassified 1745
518 Ga0207704_10140875 3300025938 Unclassified 1687
519 Ga0207704_11916031 3300025938 Unclassified 510
520 Ga0207691_10007140 3300025940 Bacteria 10779
521 Ga0207691_10019534 3300025940 Bacteria 6411
522 Ga0207691_10023030 3300025940 Bacteria 5867
523 Ga0207691_10303925 3300025940 Bacteria 1370
524 Ga0207711_10162710 3300025941 Bacteria 2021
525 Ga0207711_10373772 3300025941 Bacteria 1322
526 Ga0207689_10134248 3300025942 Bacteria 2038
527 Ga0207689_10173199 3300025942 Bacteria 1779
528 Ga0207689_10224667 3300025942 Bacteria 1552
529 Ga0207689_11746224 3300025942 Unclassified 515
530 Ga0207661_10075898 3300025944 Unclassified 2759
531 Ga0207661_10109403 3300025944 Bacteria 2335
532 Ga0207661_10115852 3300025944 Bacteria 2274
533 Ga0207661_10218836 3300025944 Bacteria 1682
534 Ga0207661_10410832 3300025944 Bacteria 1228
535 Ga0207661_10844511 3300025944 Unclassified 843
536 Ga0207661_11104460 3300025944 Bacteria 730
537 Ga0207661_11430705 3300025944 Bacteria 634
538 Ga0207679_10173594 3300025945 Bacteria 1777
539 Ga0207679_10291775 3300025945 Bacteria 1402
540 Ga0207679_10431081 3300025945 Bacteria 1165
541 Ga0207679_10472424 3300025945 Unclassified 1115
542 Ga0207679_10867004 3300025945 Unclassified 825
543 Ga0207667_10213750 3300025949 Bacteria 1976
544 Ga0207667_10250275 3300025949 Bacteria 1812
545 Ga0207667_10597373 3300025949 Bacteria 1113
546 Ga0207651_10043346 3300025960 Bacteria 3002
547 Ga0207651_10625429 3300025960 Unclassified 943
548 Ga0207651_11261851 3300025960 Unclassified 664
549 Ga0207651_11342628 3300025960 Unclassified 643
550 Ga0207651_11431660 3300025960 Unclassified 622
551 Ga0207712_11590884 3300025961 Unclassified 586
552 Ga0207668_10031906 3300025972 Bacteria 3475
553 Ga0207668_10097404 3300025972 Bacteria 2177
554 Ga0207640_10365254 3300025981 Bacteria 1164
555 Ga0207640_10622732 3300025981 Bacteria 916
556 Ga0207640_10818700 3300025981 Unclassified 808
557 Ga0207640_11341945 3300025981 Bacteria 639
558 Ga0207658_11332785 3300025986 Bacteria 656
559 Ga0207677_10052484 3300026023 Bacteria 2770
560 Ga0207677_10057290 3300026023 Bacteria 2675
561 Ga0207677_10797824 3300026023 Unclassified 845
562 Ga0207677_11022161 3300026023 Bacteria 750
563 Ga0207677_11552835 3300026023 Bacteria 612
564 Ga0207703_10063357 3300026035 Bacteria 3031
565 Ga0207703_11638631 3300026035 Bacteria 619
566 Ga0207639_10099245 3300026041 Bacteria 2349
567 Ga0207639_10194878 3300026041 Bacteria 1733
568 Ga0207639_10225313 3300026041 Bacteria 1622
569 Ga0207639_10275307 3300026041 Bacteria 1478
570 Ga0207639_10384497 3300026041 Bacteria 1261
571 Ga0207678_10272869 3300026067 Bacteria 1450
572 Ga0207678_11138254 3300026067 Bacteria 691
573 Ga0207708_10100160 3300026075 Bacteria 2242
574 Ga0207708_10638319 3300026075 Bacteria 905
575 Ga0207708_11074376 3300026075 Bacteria 701
576 Ga0207702_10258744 3300026078 Bacteria 1638
577 Ga0207702_10387636 3300026078 Bacteria 1345
578 Ga0207702_10873762 3300026078 Bacteria 890
579 Ga0207702_11145106 3300026078 Bacteria 772
580 Ga0207702_12253410 3300026078 Unclassified 533
581 Ga0207641_10040480 3300026088 Bacteria 3903
582 Ga0207648_10009519 3300026089 Bacteria 9297
583 Ga0207648_10343550 3300026089 Bacteria 1344
584 Ga0207648_10419461 3300026089 Bacteria 1215
585 Ga0207648_10565715 3300026089 Unclassified 1045
586 Ga0207648_10802945 3300026089 Bacteria 876
587 Ga0207648_11504329 3300026089 Archaea 633
588 Ga0207676_10007259 3300026095 Bacteria 7850
589 Ga0207676_10030356 3300026095 Bacteria 4057
590 Ga0207674_10019671 3300026116 Bacteria 7311
591 Ga0207674_10056109 3300026116 Bacteria 4001
592 Ga0207674_10085799 3300026116 Bacteria 3143
593 Ga0207674_10119249 3300026116 Bacteria 2608
594 Ga0207674_10548499 3300026116 Unclassified 1117
595 Ga0207674_10950108 3300026116 Bacteria 828
596 Ga0207674_11270458 3300026116 Bacteria 706
597 Ga0207674_11300532 3300026116 Bacteria 697
598 Ga0207675_100021620 3300026118 Bacteria 5991
599 Ga0207675_100556557 3300026118 Unclassified 1146
600 Ga0207675_100569224 3300026118 Bacteria 1134
601 Ga0207675_100618666 3300026118 Unclassified 1087
602 Ga0207675_100770412 3300026118 Unclassified 974
603 Ga0207683_10011999 3300026121 Bacteria 7397
604 Ga0207683_10031149 3300026121 Bacteria 4628
605 Ga0207683_10240423 3300026121 Bacteria 1651
606 Ga0207683_10484213 3300026121 Bacteria 1142
607 Ga0207683_10560909 3300026121 Bacteria 1056
608 Ga0207683_10846077 3300026121 Bacteria 849
609 Ga0207698_10201288 3300026142 Bacteria 1783
610 Ga0207698_10210947 3300026142 Bacteria 1747
611 Ga0207698_10370653 3300026142 Bacteria 1359
612 Ga0207698_10561567 3300026142 Bacteria 1120
613 Ga0207698_12402593 3300026142 Unclassified 538
614 Ga0207428_10040060 3300027907 Bacteria 3803
615 Ga0207428_10115678 3300027907 Bacteria 2060
616 Ga0207428_10391949 3300027907 Bacteria 1018
617 Ga0268266_10118932 3300028379 Bacteria 2349
618 Ga0268266_10181142 3300028379 Bacteria 1918
619 Ga0268265_10082405 3300028380 Bacteria 2544
620 Ga0268264_10015948 3300028381 Bacteria 6155
621 Ga0268264_12457686 3300028381 Unclassified 527
622 Ga0307408_100447464 3300031548 Bacteria 1120
623 Ga0307405_10727433 3300031731 Bacteria 825
624 Ga0307410_10409048 3300031852 Bacteria 1098
625 Ga0307406_10207248 3300031901 Bacteria 1448
626 Ga0307407_10190304 3300031903 Bacteria 1367
627 Ga0307412_11021556 3300031911 Bacteria 732
628 Ga0307409_100005094 3300031995 Bacteria 7497
629 Ga0307409_100134133 3300031995 Bacteria 2121
630 Ga0307409_100396615 3300031995 Unclassified 1317
631 Ga0307416_100212267 3300032002 Bacteria 1848
632 Ga0307416_100249906 3300032002 Bacteria 1725
633 Ga0307416_100312190 3300032002 Bacteria 1569
634 Ga0307416_101405142 3300032002 Unclassified 804
635 Ga0307416_101604404 3300032002 Unclassified 756
636 Ga0307416_102350675 3300032002 Bacteria 633
637 Ga0307411_12018462 3300032005 Bacteria 539
638 Ga0307415_100367195 3300032126 Bacteria 1217
639 Ga0373930_0019466 3300034816 Unclassified 1314
640 Ga0373958_0021602 3300034819 Unclassified 1196
641 Ga0373928_0286815 3300035084 Unclassified 501
642 Ga0373949_0058652 3300035090 Unclassified 986
643 Ga0373952_0020770 3300035092 Unclassified 1379
644 Ga0373932_0064108 3300035112 Unclassified 1124
645 Ga0373939_0012144 3300035114 Bacteria 2190
646 Ga0373960_0004403 3300035121 Bacteria 3223
647 Ga0373942_0019234 3300035207 Unclassified 1703
648 Ga0373961_0075387 3300035241 Bacteria 1051
649 Ga0373962_0044781 3300035242 Unclassified 1258
650 Ga0373931_0046024 3300035691 Bacteria 2305
651 Ga0395899_0339329 3300037312 Bacteria 1008
652 Ga0395899_0497353 3300037312 Bacteria 791
653 Ga0395900_0124006 3300037418 Bacteria 2650
654 Ga0395900_1059201 3300037418 Bacteria 729
655 Ga0395900_1183543 3300037418 Unclassified 680
656 Ga0395898_0634061 3300037466 Bacteria 1011
657 Ga0395905_0254193 3300037471 Bacteria 1641
658 Ga0395901_0031897 3300038443 Bacteria 5433
659 Ga0395901_0053859 3300038443 Bacteria 4181
660 Ga0395901_0766262 3300038443 Unclassified 957
661 Ga0439438_123980 3300041405 Unclassified 621
662 Ga0439439_0014769 3300041406 Bacteria 1903
663 Ga0439461_0020875 3300041410 Bacteria 1301
664 Ga0451807_0973115 3300041486 Unclassified 1094
665 Ga0451849_0781224 3300041505 Unclassified 599
666 Ga0451853_2221785 3300041512 Unclassified 530
667 Ga0439431_0048789 3300041997 Unclassified 1094
668 Ga0439431_0139511 3300041997 Unclassified 684
669 Ga0439433_0021549 3300041999 Bacteria 1442
670 Ga0439445_0096585 3300042004 Bacteria 836
671 Ga0439449_0098692 3300042007 Unclassified 1079
672 Ga0439450_059821 3300042008 Archaea 919
673 Ga0439454_092704 3300042011 Unclassified 560
674 Ga0439455_0175258 3300042012 Bacteria 617
675 Ga0439462_0004588 3300042015 Bacteria 3381
676 Ga0439463_078155 3300042016 Unclassified 850
677 Ga0450920_053379 3300042122 Bacteria 812
678 Ga0450898_154336 3300042134 Bacteria 504
679 Ga0450906_035143 3300042145 Bacteria 885
680 Ga0450907_003036 3300042146 Bacteria 3055
681 Ga0439446_0041446 3300042156 Bacteria 1357
682 Ga0439435_0043386 3300042436 Unclassified 1265
683 Ga0439435_0370315 3300042436 Bacteria 500
684 Ga0450916_090013 3300042530 Unclassified 533
685 Ga0450918_067960 3300042531 Bacteria 666
686 Ga0450918_117423 3300042531 Bacteria 530
687 Ga0439440_0166296 3300042993 Bacteria 639
688 Ga0466963_0007102 3300044694 Bacteria 6671
689 Ga0466964_0045668 3300044706 Bacteria 1783
690 Ga0466967_0030922 3300045976 Bacteria 4499
691 Ga0466967_0054799 3300045976 Bacteria 3511
692 Ga0466967_0185904 3300045976 Bacteria 1962
693 Ga0466967_0366793 3300045976 Bacteria 1396
694 Ga0466967_1723754 3300045976 Unclassified 624
695 Ga0495584_0188589 3300046491 Bacteria 1048
696 Ga0495584_0713865 3300046491 Bacteria 511
697 Ga0495656_0376622 3300046615 Bacteria 739
698 Ga0495659_0462418 3300046664 Viruses 553
699 Ga0495588_0333495 3300046674 Bacteria 798
700 Ga0495649_0299434 3300046694 Unclassified 819
701 Ga0495581_0341787 3300047315 Bacteria 874
702 Ga0496100_0045745 3300048903 Bacteria 2810
703 Ga0496100_0423550 3300048903 Unclassified 1017
704 Ga0496100_0656406 3300048903 Bacteria 817
705 Ga0496100_1531304 3300048903 Unclassified 527
706 Ga0496101_0025365 3300048904 Bacteria 4113
707 Ga0496101_0038271 3300048904 Bacteria 3406
708 Ga0496101_1461375 3300048904 Unclassified 533
709 Ga0496101_1590123 3300048904 Bacteria 508
710 Ga0496102_0019916 3300048905 Bacteria 5917
711 Ga0496102_0141661 3300048905 Bacteria 2255
712 Ga0496102_0165526 3300048905 Unclassified 2081
713 Ga0496102_0552542 3300048905 Unclassified 1074
714 Ga0496102_1585797 3300048905 Bacteria 573
715 Ga0496103_0047469 3300048906 Bacteria 2654
716 Ga0496103_0054239 3300048906 Bacteria 2485
717 Ga0496103_0343613 3300048906 Bacteria 960
718 Ga0496104_0135316 3300048907 Bacteria 2367
719 Ga0496105_0035991 3300048908 Bacteria 4076
720 Ga0496105_0048768 3300048908 Bacteria 3495
721 Ga0496105_0563176 3300048908 Bacteria 888
722 Ga0496106_0017853 3300048909 Bacteria 5246
723 Ga0496106_0031742 3300048909 Bacteria 3936
724 Ga0496106_0713033 3300048909 Bacteria 799
725 Ga0496106_1194923 3300048909 Unclassified 593
726 Ga0496106_1434130 3300048909 Bacteria 533
727 Ga0496107_0021077 3300048910 Bacteria 4605
728 Ga0496107_0083658 3300048910 Bacteria 2327
729 Ga0496107_0286157 3300048910 Unclassified 1227
730 Ga0496108_0035867 3300048911 Bacteria 4124
731 Ga0496108_0051537 3300048911 Bacteria 3448
732 Ga0496108_0286817 3300048911 Unclassified 1433
733 Ga0496109_0034539 3300048912 Bacteria 4556
734 Ga0496109_0084951 3300048912 Unclassified 2921
735 Ga0496109_0331691 3300048912 Bacteria 1436
736 Ga0496110_0045052 3300048913 Bacteria 3853
737 Ga0496110_0070098 3300048913 Bacteria 3105
738 Ga0496110_0464844 3300048913 Bacteria 1153
739 Ga0496110_0868620 3300048913 Bacteria 807
740 Ga0496111_0008744 3300048914 Bacteria 6721
741 Ga0496111_0017607 3300048914 Bacteria 4940
742 Ga0496111_0023055 3300048914 Bacteria 4366
743 Ga0496111_0296524 3300048914 Bacteria 1199
744 Ga0496111_1268839 3300048914 Bacteria 520
745 Ga0496112_0535290 3300048915 Bacteria 1106
746 Ga0496113_0018473 3300048916 Bacteria 4857
747 Ga0496113_0143759 3300048916 Bacteria 1878
748 Ga0496114_0006536 3300048917 Bacteria 9186
749 Ga0496114_0021606 3300048917 Bacteria 5237
750 Ga0496114_0048296 3300048917 Unclassified 3540
751 Ga0496114_0183742 3300048917 Unclassified 1827
752 Ga0496114_0295273 3300048917 Bacteria 1430
753 Ga0496115_0010987 3300048918 Bacteria 6778
754 Ga0496115_0803849 3300048918 Bacteria 732
755 Ga0501031_0000628 3300049568 Bacteria 20865
756 Ga0501031_0008032 3300049568 Bacteria 6870
757 Ga0501031_0025953 3300049568 Bacteria 3822
758 Ga0501031_0030183 3300049568 Bacteria 3535
759 Ga0501031_0240615 3300049568 Bacteria 1177
760 Ga0501032_0021813 3300049569 Bacteria 4448
761 Ga0501032_0027034 3300049569 Bacteria 3944
762 Ga0501032_0048974 3300049569 Bacteria 2852
763 Ga0501032_0052793 3300049569 Bacteria 2739
764 Ga0501033_0010372 3300049570 Bacteria 7147
765 Ga0501033_0039778 3300049570 Bacteria 3512
766 Ga0501033_0084755 3300049570 Bacteria 2322
767 Ga0501033_0171652 3300049570 Bacteria 1557
768 Ga0501033_0552822 3300049570 Bacteria 793
769 Ga0501033_0954342 3300049570 Unclassified 575
770 Ga0501034_0136518 3300049571 Bacteria 2434
771 Ga0501034_0714999 3300049571 Unclassified 899
772 Ga0501036_0000812 3300049572 Bacteria 23195
773 Ga0501036_0008588 3300049572 Bacteria 8379
774 Ga0501036_0013667 3300049572 Bacteria 6749
775 Ga0501036_0039539 3300049572 Bacteria 3991
776 Ga0501036_0044446 3300049572 Bacteria 3762
777 Ga0501036_0201410 3300049572 Bacteria 1674
778 Ga0501036_0492246 3300049572 Unclassified 1020
779 Ga0501036_0495590 3300049572 Bacteria 1017
780 Ga0501036_0575256 3300049572 Bacteria 935
781 Ga0501036_0848264 3300049572 Bacteria 751
782 Ga0501036_1194512 3300049572 Bacteria 620
783 Ga0501037_0011722 3300049573 Bacteria 6454
784 Ga0501037_0015086 3300049573 Bacteria 5683
785 Ga0501037_0077612 3300049573 Bacteria 2410
786 Ga0501037_0651317 3300049573 Bacteria 704
787 Ga0501037_1010942 3300049573 Bacteria 541
788 Ga0501037_1100390 3300049573 Unclassified 515
789 Ga0501038_0068752 3300049574 Bacteria 3011
790 Ga0501038_0092417 3300049574 Bacteria 2533
791 Ga0501038_0119581 3300049574 Bacteria 2174
792 Ga0501038_0147318 3300049574 Bacteria 1921
793 Ga0501038_0161531 3300049574 Bacteria 1820
794 Ga0501038_0170301 3300049574 Bacteria 1763
795 Ga0501038_0203195 3300049574 Bacteria 1589
796 Ga0501038_0510165 3300049574 Unclassified 919
797 Ga0501038_0567234 3300049574 Bacteria 862
798 Ga0501038_1303786 3300049574 Bacteria 524
799 Ga0501039_0001256 3300049575 Bacteria 18532
800 Ga0501039_0027322 3300049575 Bacteria 4388
801 Ga0501039_0091909 3300049575 Bacteria 2365
802 Ga0501039_0105273 3300049575 Bacteria 2203
803 Ga0501039_0148989 3300049575 Bacteria 1838
804 Ga0501039_0154996 3300049575 Bacteria 1799
805 Ga0501039_0241933 3300049575 Unclassified 1419
806 Ga0501039_0356272 3300049575 Unclassified 1149
807 Ga0501039_0620700 3300049575 Bacteria 847
808 Ga0501039_0623227 3300049575 Bacteria 845
809 Ga0501040_0004583 3300049576 Bacteria 8966
810 Ga0501040_0026470 3300049576 Bacteria 3901
811 Ga0501040_0087471 3300049576 Bacteria 2163
812 Ga0501040_0100315 3300049576 Bacteria 2018
813 Ga0501040_0197930 3300049576 Bacteria 1426
814 Ga0501040_0631582 3300049576 Bacteria 774
815 Ga0501040_0960209 3300049576 Unclassified 619
816 Ga0501040_1138592 3300049576 Bacteria 566
817 Ga0501041_0003684 3300049577 Bacteria 8808
818 Ga0501041_0014075 3300049577 Bacteria 4747
819 Ga0501041_0026519 3300049577 Bacteria 3486
820 Ga0501041_0065808 3300049577 Bacteria 2220
821 Ga0501041_0087671 3300049577 Bacteria 1921
822 Ga0501041_0103034 3300049577 Bacteria 1767
823 Ga0501041_0118325 3300049577 Unclassified 1646
824 Ga0501041_0350942 3300049577 Bacteria 932
825 Ga0501041_0598818 3300049577 Bacteria 703
826 Ga0501042_0000147 3300049578 Bacteria 31455
827 Ga0501042_0013484 3300049578 Bacteria 5564
828 Ga0501042_0025146 3300049578 Bacteria 4181
829 Ga0501042_0027502 3300049578 Bacteria 3999
830 Ga0501042_0113230 3300049578 Bacteria 1953
831 Ga0501042_0170045 3300049578 Bacteria 1572
832 Ga0501042_0230264 3300049578 Unclassified 1337
833 Ga0501042_0245216 3300049578 Bacteria 1293
834 Ga0501042_0332816 3300049578 Bacteria 1097
835 Ga0501042_1165933 3300049578 Unclassified 562
836 Ga0501043_0026625 3300049579 Bacteria 4537
837 Ga0501043_0081779 3300049579 Bacteria 2538
838 Ga0501043_0334079 3300049579 Unclassified 1154
839 Ga0501043_0541915 3300049579 Bacteria 865
840 Ga0501043_0738763 3300049579 Bacteria 716
841 Ga0501043_1121696 3300049579 Bacteria 555
842 Ga0501046_0009845 3300049580 Bacteria 8237
843 Ga0501046_0066165 3300049580 Bacteria 2817
844 Ga0501046_0075095 3300049580 Bacteria 2621
845 Ga0501046_0246854 3300049580 Bacteria 1315
846 Ga0501046_0295736 3300049580 Unclassified 1183
847 Ga0501046_0559655 3300049580 Bacteria 814
848 Ga0501047_0082855 3300049581 Bacteria 3083
849 Ga0501047_0549053 3300049581 Bacteria 980
850 Ga0501048_0001203 3300049582 Bacteria 19590
851 Ga0501048_0012158 3300049582 Bacteria 6413
852 Ga0501048_0024597 3300049582 Bacteria 4395
853 Ga0501048_0062628 3300049582 Bacteria 2632
854 Ga0501048_0077336 3300049582 Bacteria 2348
855 Ga0501048_0177750 3300049582 Bacteria 1508
856 Ga0501048_0441683 3300049582 Bacteria 931
857 Ga0501048_0443392 3300049582 Bacteria 929
858 Ga0501048_0785450 3300049582 Bacteria 684
859 Ga0501048_1298107 3300049582 Bacteria 523
860 Ga0501067_0017123 3300049583 Bacteria 4004
861 Ga0501067_0039274 3300049583 Bacteria 2628
862 Ga0501067_0089183 3300049583 Bacteria 1711
863 Ga0501067_0228883 3300049583 Unclassified 1035
864 Ga0501067_0236018 3300049583 Bacteria 1018
865 Ga0501067_0250672 3300049583 Bacteria 985
866 Ga0501067_0553387 3300049583 Bacteria 644
867 Ga0501068_0022664 3300049584 Bacteria 3674
868 Ga0501068_0030547 3300049584 Bacteria 3196
869 Ga0501068_0042836 3300049584 Bacteria 2722
870 Ga0501068_0071606 3300049584 Bacteria 2116
871 Ga0501068_0172061 3300049584 Bacteria 1367
872 Ga0501068_0371684 3300049584 Unclassified 920
873 Ga0501069_0001115 3300049585 Bacteria 12962
874 Ga0501069_0005154 3300049585 Bacteria 6785
875 Ga0501069_0011374 3300049585 Bacteria 4719
876 Ga0501069_0024604 3300049585 Bacteria 3285
877 Ga0501069_0604849 3300049585 Bacteria 658
878 Ga0501069_0760067 3300049585 Archaea 586
879 Ga0501070_0084634 3300049586 Bacteria 2625
880 Ga0501070_0185255 3300049586 Bacteria 1712
881 Ga0501070_0222062 3300049586 Bacteria 1549
882 Ga0501070_0250639 3300049586 Bacteria 1448
883 Ga0501070_0464901 3300049586 Bacteria 1019
884 Ga0501071_0000047 3300049587 Bacteria 42225
885 Ga0501071_0003972 3300049587 Bacteria 9330
886 Ga0501071_0048083 3300049587 Bacteria 3066
887 Ga0501071_0072205 3300049587 Bacteria 2517
888 Ga0501071_0127993 3300049587 Unclassified 1886
889 Ga0501071_0207478 3300049587 Bacteria 1473
890 Ga0501071_0288035 3300049587 Bacteria 1243
891 Ga0501071_0301963 3300049587 Bacteria 1214
892 Ga0501071_0347443 3300049587 Bacteria 1128
893 Ga0501071_0367933 3300049587 Bacteria 1095
894 Ga0501071_0470457 3300049587 Bacteria 963
895 Ga0501071_1100414 3300049587 Bacteria 614
896 Ga0501071_1134200 3300049587 Bacteria 604
897 Ga0501072_0005337 3300049588 Bacteria 9780
898 Ga0501072_0007176 3300049588 Bacteria 8452
899 Ga0501072_0036448 3300049588 Bacteria 3856
900 Ga0501072_0116877 3300049588 Bacteria 2124
901 Ga0501072_0129168 3300049588 Bacteria 2014
902 Ga0501072_0159229 3300049588 Bacteria 1801
903 Ga0501072_0161806 3300049588 Unclassified 1785
904 Ga0501072_0203746 3300049588 Bacteria 1577
905 Ga0501072_0244759 3300049588 Bacteria 1428
906 Ga0501072_0250670 3300049588 Bacteria 1410
907 Ga0501072_0337719 3300049588 Bacteria 1197
908 Ga0501072_1170422 3300049588 Bacteria 598
909 Ga0501073_0015162 3300049589 Bacteria 5591
910 Ga0501073_0046061 3300049589 Bacteria 3069
911 Ga0501073_0098653 3300049589 Bacteria 2028
912 Ga0501073_0246005 3300049589 Unclassified 1235
913 Ga0501073_0266021 3300049589 Bacteria 1183
914 Ga0501073_0445776 3300049589 Bacteria 895
915 Ga0501073_0491230 3300049589 Bacteria 849
916 Ga0501074_0002330 3300049590 Bacteria 13214
917 Ga0501074_0088901 3300049590 Bacteria 2212
918 Ga0501074_0111833 3300049590 Bacteria 1954
919 Ga0501074_0242244 3300049590 Unclassified 1282
920 Ga0501074_0269553 3300049590 Bacteria 1210
921 Ga0501074_0330249 3300049590 Bacteria 1082
922 Ga0501074_0352501 3300049590 Unclassified 1044
923 Ga0501074_0482649 3300049590 Unclassified 878
924 Ga0501074_0587897 3300049590 Bacteria 787
925 Ga0501074_1090968 3300049590 Bacteria 561
926 Ga0501075_0000079 3300049591 Bacteria 43500
927 Ga0501075_0022784 3300049591 Bacteria 4579
928 Ga0501075_0039892 3300049591 Bacteria 3515
929 Ga0501075_0051207 3300049591 Bacteria 3104
930 Ga0501075_0061201 3300049591 Bacteria 2836
931 Ga0501075_0201223 3300049591 Unclassified 1519
932 Ga0501075_0220812 3300049591 Bacteria 1446
933 Ga0501075_0310962 3300049591 Unclassified 1201
934 Ga0501075_0316855 3300049591 Bacteria 1189
935 Ga0501075_0347914 3300049591 Unclassified 1129
936 Ga0501075_0445439 3300049591 Unclassified 987
937 Ga0501075_0544007 3300049591 Bacteria 886
938 Ga0501075_1430735 3300049591 Bacteria 523
939 Ga0501076_0020207 3300049592 Bacteria 5096
940 Ga0501076_0025447 3300049592 Bacteria 4579
941 Ga0501076_0045344 3300049592 Bacteria 3471
942 Ga0501076_0048998 3300049592 Bacteria 3339
943 Ga0501076_0056095 3300049592 Bacteria 3125
944 Ga0501076_0071070 3300049592 Bacteria 2784
945 Ga0501076_0084118 3300049592 Bacteria 2555
946 Ga0501076_0089383 3300049592 Bacteria 2476
947 Ga0501076_0136617 3300049592 Bacteria 1990
948 Ga0501076_0272929 3300049592 Bacteria 1385
949 Ga0501076_0528236 3300049592 Unclassified 973
950 Ga0501076_0575936 3300049592 Unclassified 928
951 Ga0501076_0692582 3300049592 Bacteria 841
952 Ga0501076_0928123 3300049592 Bacteria 717
953 Ga0501076_1814360 3300049592 Bacteria 500
954 Ga0501077_0002534 3300049593 Bacteria 10948
955 Ga0501077_0004906 3300049593 Bacteria 8121
956 Ga0501077_0007994 3300049593 Bacteria 6536
957 Ga0501077_0037902 3300049593 Bacteria 3069
958 Ga0501077_0040757 3300049593 Bacteria 2957
959 Ga0501077_0526013 3300049593 Unclassified 759
960 Ga0501077_0642820 3300049593 Bacteria 682
961 Ga0501077_0912883 3300049593 Unclassified 565
962 Ga0501079_0012883 3300049741 Bacteria 6382
963 Ga0501079_0043429 3300049741 Bacteria 3469
964 Ga0501079_0081732 3300049741 Bacteria 2498
965 Ga0501079_0170385 3300049741 Bacteria 1697
966 Ga0501079_0192003 3300049741 Bacteria 1594
967 Ga0501079_0229768 3300049741 Bacteria 1449
968 Ga0501079_0273037 3300049741 Bacteria 1322
969 Ga0501079_0341710 3300049741 Bacteria 1173
970 Ga0501079_1175411 3300049741 Bacteria 604
971 Ga0501080_0008633 3300049742 Bacteria 9246
972 Ga0501080_0053015 3300049742 Bacteria 3776
973 Ga0501080_0069831 3300049742 Bacteria 3267
974 Ga0501080_0099897 3300049742 Bacteria 2692
975 Ga0501080_0125366 3300049742 Bacteria 2379
976 Ga0501080_0196662 3300049742 Unclassified 1852
977 Ga0501080_1160780 3300049742 Bacteria 665
978 Ga0501080_1803952 3300049742 Unclassified 514
979 Ga0501081_0001935 3300049743 Bacteria 12869
980 Ga0501081_0002356 3300049743 Bacteria 11895
981 Ga0501081_0059171 3300049743 Bacteria 2652
982 Ga0501081_0079155 3300049743 Bacteria 2298
983 Ga0501081_0080075 3300049743 Bacteria 2285
984 Ga0501081_0121895 3300049743 Bacteria 1858
985 Ga0501081_0182676 3300049743 Bacteria 1517
986 Ga0501081_0235816 3300049743 Bacteria 1333
987 Ga0501081_0421206 3300049743 Bacteria 990
988 Ga0501081_1267623 3300049743 Archaea 559
989 Ga0501083_0010147 3300049744 Bacteria 6636
990 Ga0501083_0164307 3300049744 Unclassified 1451
991 Ga0501083_0325700 3300049744 Unclassified 999
992 Ga0501083_0476694 3300049744 Bacteria 812
993 Ga0501035_0117664 3300049822 Bacteria 2325
994 Ga0501035_0128176 3300049822 Bacteria 2214
995 Ga0501035_0129006 3300049822 Bacteria 2205
996 Ga0501035_0169383 3300049822 Bacteria 1887
997 Ga0501035_0571699 3300049822 Unclassified 924
998 Ga0501035_0995086 3300049822 Bacteria 660
999 Ga0501035_1516330 3300049822 Unclassified 511
1000 Ga0501044_0097347 3300049823 Bacteria 2964
1001 Ga0501044_0107146 3300049823 Bacteria 2806
1002 Ga0501044_0239384 3300049823 Bacteria 1759
1003 Ga0501044_0588359 3300049823 Bacteria 1007
1004 Ga0501044_0945492 3300049823 Unclassified 735
1005 Ga0501045_0000967 3300049824 Bacteria 18795
1006 Ga0501045_0007845 3300049824 Bacteria 7427
1007 Ga0501045_0028388 3300049824 Bacteria 4036
1008 Ga0501045_0165382 3300049824 Bacteria 1647
1009 Ga0501045_0189574 3300049824 Bacteria 1532
1010 Ga0501045_0246561 3300049824 Bacteria 1330
1011 Ga0501045_0333605 3300049824 Bacteria 1128
1012 Ga0501045_0466980 3300049824 Bacteria 938
1013 Ga0501045_0502991 3300049824 Unclassified 900
1014 Ga0501045_0658173 3300049824 Bacteria 774
1015 Ga0501045_1152955 3300049824 Bacteria 566
1016 Ga0501045_1203158 3300049824 Unclassified 553
1017 nmdc:mga05p37_1163417_c1 3300050507 Bacteria 801
1018 nmdc:mga05p37_12914_c1 3300050507 Bacteria 9989
1019 nmdc:mga05p37_189715_c1 3300050507 Bacteria 2496
1020 nmdc:mga05p37_440517_c1 3300050507 Bacteria 1511
1021 nmdc:mga05p37_570696_c1 3300050507 Bacteria 1283
1022 nmdc:mga09592_105428_c1 3300050508 Bacteria 2417
1023 nmdc:mga09592_376187_c1 3300050508 Bacteria 1228
1024 nmdc:mga06r32_583803_c1 3300050510 Bacteria 1089
1025 nmdc:mga08y16_1074261_c1 3300050511 Unclassified 781
1026 nmdc:mga08y16_1077376_c1 3300050511 Bacteria 780
1027 nmdc:mga08y16_201766_c1 3300050511 Bacteria 2061
1028 nmdc:mga08y16_24599_c1 3300050511 Bacteria 6355
1029 nmdc:mga08y16_256872_c2 3300050511 Bacteria 926
1030 nmdc:mga0n895_336279_c1 3300050512 Unclassified 1530
1031 nmdc:mga0rr50_273559_c1 3300050513 Unclassified 1408
1032 nmdc:mga0a205_109261_c1 3300050515 Bacteria 2352
1033 nmdc:mga0a205_1576986_c1 3300050515 Bacteria 505
1034 nmdc:mga0a205_254669_c1 3300050515 Bacteria 1634
1035 nmdc:mga0a205_347292_c1 3300050515 Bacteria 1351
1036 Ga0495655_0150465 3300053083 Bacteria 731
1037 Ga0501084_0000362 3300054114 Bacteria 34708
1038 Ga0501084_0006930 3300054114 Bacteria 9332
1039 Ga0501084_0013345 3300054114 Bacteria 6797
1040 Ga0501084_0021022 3300054114 Bacteria 5444
1041 Ga0501084_0087248 3300054114 Bacteria 2620
1042 Ga0501084_0102635 3300054114 Bacteria 2402
1043 Ga0501084_0139307 3300054114 Bacteria 2042
1044 Ga0501084_0152503 3300054114 Bacteria 1948
1045 Ga0501084_0192067 3300054114 Unclassified 1723
1046 Ga0501084_0537710 3300054114 Unclassified 987
1047 Ga0590071_005283 3300059421 Bacteria 3113
1048 Ga0590074_032162 3300059423 Bacteria 929
1049 Ga0590075_019485 3300059424 Bacteria 1684
1050 Ga0590075_022336 3300059424 Bacteria 1583
1051 Ga0590075_033820 3300059424 Bacteria 1299
1052 Ga0590077_036449 3300059426 Bacteria 1085
1053 Ga0501082_0002526 3300060353 Bacteria 16018
1054 Ga0501082_0009168 3300060353 Bacteria 8534
1055 Ga0501082_0057418 3300060353 Bacteria 3353
1056 Ga0501082_0075329 3300060353 Bacteria 2907
1057 Ga0501082_0160276 3300060353 Bacteria 1955
1058 Ga0501082_0240216 3300060353 Bacteria 1576
1059 Ga0501082_1044956 3300060353 Bacteria 714
1060 Ga0501082_1285355 3300060353 Bacteria 639
1061 Ga0530510_0006973 3300061734 Bacteria 7877
1062 Ga0530510_0015968 3300061734 Bacteria 5307
1063 Ga0530510_0048100 3300061734 Bacteria 3082
1064 Ga0530510_0087285 3300061734 Bacteria 2273
1065 Ga0530510_0101484 3300061734 Bacteria 2104
1066 Ga0530510_0152139 3300061734 Bacteria 1709
1067 Ga0530510_0198061 3300061734 Bacteria 1491
1068 Ga0530510_0229339 3300061734 Bacteria 1381
1069 Ga0530510_0245693 3300061734 Bacteria 1333
1070 Ga0530510_0254947 3300061734 Bacteria 1307
1071 Ga0530510_0290464 3300061734 Bacteria 1222
1072 Ga0530510_0810715 3300061734 Bacteria 714
1073 Ga0530510_0854505 3300061734 Bacteria 695
1074 Ga0530510_0922827 3300061734 Bacteria 667
1075 Ga0501067_0030375
1076 Ga0070658_10086833
1077 Ga0070658_10533517
1078 Ga0070658_10802688
1079 Ga0070658_10914885
1080 Ga0070676_10792585
1081 Ga0070683_100049689
1082 Ga0070683_100117354
1083 Ga0070683_100299275
1084 Ga0070683_101062570
1085 Ga0070683_102122879
1086 Ga0070670_100121050
1087 Ga0070670_100257384
1088 Ga0070670_100805547
1089 Ga0070677_10722496
1090 Ga0068869_100149486
1091 Ga0068869_100815153
1092 Ga0068869_101261467
1093 Ga0070666_10157180
1094 Ga0070680_100018540
1095 Ga0070680_100072322
1096 Ga0070680_101051017
1097 Ga0070682_100029320
1098 Ga0070682_100111676
1099 Ga0070682_100200674
1100 Ga0070682_100265707
1101 Ga0070682_100300470
1102 Ga0070682_100635289
1103 Ga0068868_100074981
1104 Ga0068868_100132822
1105 Ga0068868_100134574
1106 Ga0068868_100361093
1107 Ga0070660_100000633
1108 Ga0070660_100021968
1109 Ga0070660_100154204
1110 Ga0070660_100188360
1111 Ga0070660_100476574
1112 Ga0070660_101310834
1113 Ga0070689_100027744
1114 Ga0070689_100055360
1115 Ga0070691_10190904
1116 Ga0070691_10677819
1117 Ga0070687_100133781
1118 Ga0070661_100016213
1119 Ga0070661_100039051
1120 Ga0070661_100584573
1121 Ga0070661_100663101
1122 Ga0070661_100791387
1123 Ga0070661_101163214
1124 Ga0070692_10002758
1125 Ga0070692_10235194
1126 Ga0070692_10393801
1127 Ga0070668_100081789
1128 Ga0070668_101378021
1129 Ga0070669_100272160
1130 Ga0070669_100793312
1131 Ga0070675_100009177
1132 Ga0070675_100039981
1133 Ga0070675_100503610
1134 Ga0070675_100711602
1135 Ga0070675_101954622
1136 Ga0070671_100095733
1137 Ga0070671_100125150
1138 Ga0070671_100794346
1139 Ga0070671_101260512
1140 Ga0070671_101270308
1141 Ga0070674_100007213
1142 Ga0070674_100163114
1143 Ga0070674_100495528
1144 Ga0070673_100019858
1145 Ga0070673_100036452
1146 Ga0070673_100804132
1147 Ga0070673_101249799
1148 Ga0070673_101596514
1149 Ga0070673_102046133
1150 Ga0070688_100002575
1151 Ga0070688_100006031
1152 Ga0070688_100617943
1153 Ga0070659_100004465
1154 Ga0070659_100018645
1155 Ga0070659_100033431
1156 Ga0070659_100494019
1157 Ga0070659_100564431
1158 Ga0070659_100638604
1159 Ga0070659_100787089
1160 Ga0070659_100930586
1161 Ga0070659_100950557
1162 Ga0070667_100088116
1163 Ga0070667_100683427
1164 Ga0070667_100735942
1165 Ga0070703_10021633
1166 Ga0070703_10312121
1167 Ga0070709_11360427
1168 Ga0070714_100909282
1169 Ga0070714_101228910
1170 Ga0070710_10289824
1171 Ga0070701_10015521
1172 Ga0070701_10601297
1173 Ga0070711_100936001
1174 Ga0070705_100293521
1175 Ga0070705_100939885
1176 Ga0070700_100041073
1177 Ga0070700_101762555
1178 Ga0070694_100564523
1179 Ga0070694_100655177
1180 Ga0070708_100562014
1181 Ga0070663_100362622
1182 Ga0070678_100080679
1183 Ga0070678_100467415
1184 Ga0070678_100476634
1185 Ga0070678_100486812
1186 Ga0070678_100636077
1187 Ga0070678_101405572
1188 Ga0070662_100026426
1189 Ga0070662_100187537
1190 Ga0070662_100311662
1191 Ga0070662_100474000
1192 Ga0070662_100834373
1193 Ga0070662_101035804
1194 Ga0070681_10013679
1195 Ga0070681_10051781
1196 Ga0070681_10052927
1197 Ga0070681_10070972
1198 Ga0070681_10790965
1199 Ga0068867_100036199
1200 Ga0068867_100801772
1201 Ga0068867_101115103
1202 Ga0070685_10007211
1203 Ga0070685_10025361
1204 Ga0070685_10384070
1205 Ga0070706_100988656
1206 Ga0070698_100043820
1207 Ga0070698_101843244
1208 Ga0070698_102200931
1209 Ga0070699_100067520
1210 Ga0070679_100006282
1211 Ga0070679_100052895
1212 Ga0070679_100562728
1213 Ga0070679_100821108
1214 Ga0070679_101058722
1215 Ga0070679_101829318
1216 Ga0070684_100008111
1217 Ga0070684_100045881
1218 Ga0070684_100072681
1219 Ga0070684_100133362
1220 Ga0070684_100708317
1221 Ga0070684_101315577
1222 Ga0070684_101471202
1223 Ga0070684_101646980
1224 Ga0068853_100011217
1225 Ga0068853_100051377
1226 Ga0068853_100190379
1227 Ga0068853_100297165
1228 Ga0068853_102493552
1229 Ga0070672_100034033
1230 Ga0070672_100132649
1231 Ga0070686_100010484
1232 Ga0070686_100046839
1233 Ga0070696_100172967
1234 Ga0070696_100193062
1235 Ga0070696_100459180
1236 Ga0070693_100685860
1237 Ga0070665_100006229
1238 Ga0070665_100025531
1239 Ga0070665_100114296
1240 Ga0070665_100523298
1241 Ga0070704_100040027
1242 Ga0070704_100530726
1243 Ga0070704_101661162
1244 Ga0070704_101838651
1245 Ga0068855_100023380
1246 Ga0068855_100104589
1247 Ga0068855_100192032
1248 Ga0068855_100442433
1249 Ga0068855_100474251
1250 Ga0068855_101946587
1251 Ga0070664_100010134
1252 Ga0070664_100017988
1253 Ga0070664_100086943
1254 Ga0070664_100332796
1255 Ga0070664_100407164
1256 Ga0068857_100033549
1257 Ga0068857_100041363
1258 Ga0068857_100211359
1259 Ga0068857_100248312
1260 Ga0068857_100806508
1261 Ga0068857_101046682
1262 Ga0068857_101660612
1263 Ga0068857_101877655
1264 Ga0068854_100002029
1265 Ga0068854_100503885
1266 Ga0068854_100654255
1267 Ga0068854_101018438
1268 Ga0068854_101515435
1269 Ga0068854_101549583
1270 Ga0068856_100430163
1271 Ga0068856_100487967
1272 Ga0068856_100621762
1273 Ga0068856_100851577
1274 Ga0070702_100111644
1275 Ga0070702_100153874
1276 Ga0068852_100048123
1277 Ga0068852_100156046
1278 Ga0068852_100170286
1279 Ga0068852_100348754
1280 Ga0068852_101237433
1281 Ga0068859_100015815
1282 Ga0068859_101724886
1283 Ga0068864_100011033
1284 Ga0068864_100332577
1285 Ga0068864_102093684
1286 Ga0068866_10004415
1287 Ga0068866_10213278
1288 Ga0068866_10240087
1289 Ga0068866_10768385
1290 Ga0068866_10927788
1291 Ga0068861_100011331
1292 Ga0068861_100577876
1293 Ga0068861_101750244
1294 Ga0068851_10132174
1295 Ga0068851_10199361
1296 Ga0068870_10001003
1297 Ga0068870_10003881
1298 Ga0068870_10008337
1299 Ga0068870_10057630
1300 Ga0068870_10082898
1301 Ga0068863_100105864
1302 Ga0068858_100007230
1303 Ga0068860_100066714
1304 Ga0068862_100028166
1305 Ga0068862_100696459
1306 Ga0068862_101014878
1307 Ga0081455_10273227
1308 Ga0081455_10663204
1309 Ga0081455_10815365
1310 Ga0081455_11009112
1311 Ga0070717_10337186
1312 Ga0075432_10021425
1313 Ga0070712_100056702
1314 Ga0097621_100017273
1315 Ga0097621_100177324
1316 Ga0097621_100461622
1317 Ga0097621_102295504
1318 Ga0068871_100043606
1319 Ga0068871_100329559
1320 Ga0068871_101683145
1321 Ga0068871_101708911
1322 Ga0075428_100146241
1323 Ga0075430_100585373
1324 Ga0075431_100053006
1325 Ga0075431_100435488
1326 Ga0075431_100877211
1327 Ga0075433_10034678
1328 Ga0075434_100439844
1329 Ga0075434_101413828
1330 Ga0075429_100102391
1331 Ga0068865_100002899
1332 Ga0068865_100084563
1333 Ga0068865_100125464
1334 Ga0068865_100322996
1335 Ga0068865_100388447
1336 Ga0068865_100483227
1337 Ga0097620_100015816
1338 Ga0097620_101724940
1339 Ga0105244_10196835
1340 Ga0105240_10448263
1341 Ga0111539_10016235
1342 Ga0111539_10030637
1343 Ga0111539_10090436
1344 Ga0111539_10226752
1345 Ga0111539_10389818
1346 Ga0111539_10465031
1347 Ga0111539_10573128
1348 Ga0111539_11963190
1349 Ga0105245_10050595
1350 Ga0105245_10294034
1351 Ga0105245_10330032
1352 Ga0105245_10453012
1353 Ga0105245_10466339
1354 Ga0105245_10601185
1355 Ga0105245_10818093
1356 Ga0105245_10835307
1357 Ga0105245_11092135
1358 Ga0105245_11912924
1359 Ga0105245_13150569
1360 Ga0105247_10011070
1361 Ga0114129_10009207
1362 Ga0114129_10063203
1363 Ga0114129_10278651
1364 Ga0114129_10617029
1365 Ga0114129_10797797
1366 Ga0114129_11367646
1367 Ga0105243_10007846
1368 Ga0105243_10061550
1369 Ga0105243_10149023
1370 Ga0105243_10234916
1371 Ga0105243_10627272
1372 Ga0105243_11389398
1373 Ga0105241_10010013
1374 Ga0105241_10099377
1375 Ga0105241_10174286
1376 Ga0105241_10403910
1377 Ga0105241_11845107
1378 Ga0105242_10048974
1379 Ga0105242_10218143
1380 Ga0105242_10226955
1381 Ga0105242_10342147
1382 Ga0105242_10435191
1383 Ga0105242_11836557
1384 Ga0105242_12344823
1385 Ga0105248_10050536
1386 Ga0105248_10497149
1387 Ga0105248_12888562
1388 Ga0105237_10174871
1389 Ga0105237_10372604
1390 Ga0105237_12466084
1391 Ga0105238_10007268
1392 Ga0105238_10048620
1393 Ga0105238_10213991
1394 Ga0105238_10345070
1395 Ga0105238_10953130
1396 Ga0105238_11891090
1397 Ga0105238_13052158
1398 Ga0105249_10642927
1399 Ga0105239_10065565
1400 Ga0105239_10152209
1401 Ga0105239_10354671
1402 Ga0105239_11827137
1403 Ga0105239_11909657
1404 Ga0105239_12157021
1405 Ga0105239_13139960
1406 Ga0105246_10103566
1407 Ga0105246_10189919
1408 Ga0105246_11426052
1409 Ga0105246_11802636
1410 Ga0157314_1013205
1411 Ga0157347_1066986
1412 Ga0157373_10046743
1413 Ga0157373_10125310
1414 Ga0157371_10008275
1415 Ga0157371_10147925
1416 Ga0157371_10183972
1417 Ga0157371_10431856
1418 Ga0157370_10028771
1419 Ga0157370_10082477
1420 Ga0157370_10232346
1421 Ga0157369_10184273
1422 Ga0157369_10213454
1423 Ga0157369_10312884
1424 Ga0157374_10140233
1425 Ga0157374_10650362
1426 Ga0157374_10850665
1427 Ga0157374_10863396
1428 Ga0157374_11453637
1429 Ga0157374_11621919
1430 Ga0157374_11654437
1431 Ga0157378_10186973
1432 Ga0157378_11117527
1433 Ga0157378_12927604
1434 Ga0163162_10524182
1435 Ga0157372_10024231
1436 Ga0157372_10063800
1437 Ga0157372_10066412
1438 Ga0157372_10133714
1439 Ga0157372_10395222
1440 Ga0157372_10833996
1441 Ga0157372_10915202
1442 Ga0157372_11010694
1443 Ga0157375_10008715
1444 Ga0157375_10039371
1445 Ga0157375_10205090
1446 Ga0163163_10097475
1447 Ga0163163_10311006
1448 Ga0163163_11491121
1449 Ga0163163_12758276
1450 Ga0157380_10030921
1451 Ga0157380_10058951
1452 Ga0157380_10633454
1453 Ga0157380_11549824
1454 Ga0157380_12905149
1455 Ga0182008_10821719
1456 Ga0157377_10013583
1457 Ga0157377_10149549
1458 Ga0157377_10648557
1459 Ga0157377_11199121
1460 Ga0157379_10036587
1461 Ga0157379_11330168
1462 Ga0157376_10021308
1463 Ga0157376_11127277
1464 Ga0163161_10019407
1465 Ga0163161_10765798
1466 Ga0206356_10074813
1467 Ga0206356_11026427
1468 Ga0206354_10520300
1469 Ga0206354_10868705
1470 Ga0206353_11653627
1471 Ga0206353_11718206
1472 Ga0207656_10191397
1473 Ga0207656_10401854
1474 Ga0207653_10007755
1475 Ga0207682_10554894
1476 Ga0207642_10023887
1477 Ga0207642_10350240
1478 Ga0207642_10736763
1479 Ga0207642_10946210
1480 Ga0207710_10062274
1481 Ga0207688_10003380
1482 Ga0207688_10011445
1483 Ga0207688_10025323
1484 Ga0207688_11005603
1485 Ga0207680_10673735
1486 Ga0207647_10190983
1487 Ga0207645_10024812
1488 Ga0207645_10391930
1489 Ga0207645_10844533
1490 Ga0207643_10004645
1491 Ga0207643_10006379
1492 Ga0207643_10007430
1493 Ga0207643_10051829
1494 Ga0207705_10295968
1495 Ga0207684_10547595
1496 Ga0207684_10974837
1497 Ga0207684_11321966
1498 Ga0207654_10463004
1499 Ga0207707_10018617
1500 Ga0207707_10022270
1501 Ga0207707_10051099
1502 Ga0207707_10173461
1503 Ga0207707_10471082
1504 Ga0207707_10634084
1505 Ga0207695_11213011
1506 Ga0207695_11406487
1507 Ga0207671_10150027
1508 Ga0207671_10270080
1509 Ga0207693_10229625
1510 Ga0207660_10047819
1511 Ga0207660_10057473
1512 Ga0207660_10181005
1513 Ga0207660_10203646
1514 Ga0207660_10261399
1515 Ga0207660_10527447
1516 Ga0207662_10139030
1517 Ga0207657_10000275
1518 Ga0207657_10001621
1519 Ga0207657_10060290
1520 Ga0207657_10101655
1521 Ga0207657_10308213
1522 Ga0207657_10967514
1523 Ga0207649_10085816
1524 Ga0207649_10144914
1525 Ga0207649_10160865
1526 Ga0207649_10980377
1527 Ga0207649_11497305
1528 Ga0207652_10040605
1529 Ga0207652_10045550
1530 Ga0207652_10080380
1531 Ga0207652_10143537
1532 Ga0207652_10183239
1533 Ga0207652_10331184
1534 Ga0207652_10350047
1535 Ga0207652_10511367
1536 Ga0207681_10018673
1537 Ga0207694_10024324
1538 Ga0207694_10119575
1539 Ga0207694_10388741
1540 Ga0207694_10494788
1541 Ga0207650_10002681
1542 Ga0207650_10010855
1543 Ga0207650_10269163
1544 Ga0207650_10463923
1545 Ga0207650_10872902
1546 Ga0207650_10874591
1547 Ga0207659_10016197
1548 Ga0207659_10026366
1549 Ga0207659_10436276
1550 Ga0207687_10006518
1551 Ga0207687_10207530
1552 Ga0207687_10402333
1553 Ga0207687_10825863
1554 Ga0207700_10715222
1555 Ga0207664_10815720
1556 Ga0207644_10021923
1557 Ga0207644_10206249
1558 Ga0207644_10524578
1559 Ga0207690_10016947
1560 Ga0207690_10037450
1561 Ga0207690_10119313
1562 Ga0207690_10289422
1563 Ga0207690_10415258
1564 Ga0207690_10432271
1565 Ga0207690_10559654
1566 Ga0207690_10636635
1567 Ga0207690_11088221
1568 Ga0207706_10021103
1569 Ga0207706_10072559
1570 Ga0207706_10598156
1571 Ga0207706_10769325
1572 Ga0207706_11000976
1573 Ga0207686_10080616
1574 Ga0207686_10289793
1575 Ga0207686_10597087
1576 Ga0207686_11040945
1577 Ga0207709_10024013
1578 Ga0207709_10106035
1579 Ga0207709_10347824
1580 Ga0207709_10579563
1581 Ga0207709_11862627
1582 Ga0207670_10009107
1583 Ga0207670_10137607
1584 Ga0207669_10013786
1585 Ga0207669_10064407
1586 Ga0207669_10126815
1587 Ga0207669_10235747
1588 Ga0207669_10449630
1589 Ga0207669_10607739
1590 Ga0207704_10068882
1591 Ga0207704_10129335
1592 Ga0207704_10140875
1593 Ga0207704_11916031
1594 Ga0207691_10007140
1595 Ga0207691_10019534
1596 Ga0207691_10023030
1597 Ga0207691_10303925
1598 Ga0207711_10162710
1599 Ga0207711_10373772
1600 Ga0207689_10134248
1601 Ga0207689_10173199
1602 Ga0207689_10224667
1603 Ga0207689_11746224
1604 Ga0207661_10075898
1605 Ga0207661_10109403
1606 Ga0207661_10115852
1607 Ga0207661_10218836
1608 Ga0207661_10410832
1609 Ga0207661_10844511
1610 Ga0207661_11104460
1611 Ga0207661_11430705
1612 Ga0207679_10173594
1613 Ga0207679_10291775
1614 Ga0207679_10431081
1615 Ga0207679_10472424
1616 Ga0207679_10867004
1617 Ga0207667_10213750
1618 Ga0207667_10250275
1619 Ga0207667_10597373
1620 Ga0207651_10043346
1621 Ga0207651_10625429
1622 Ga0207651_11261851
1623 Ga0207651_11342628
1624 Ga0207651_11431660
1625 Ga0207712_11590884
1626 Ga0207668_10031906
1627 Ga0207668_10097404
1628 Ga0207640_10365254
1629 Ga0207640_10622732
1630 Ga0207640_10818700
1631 Ga0207640_11341945
1632 Ga0207658_11332785
1633 Ga0207677_10052484
1634 Ga0207677_10057290
1635 Ga0207677_10797824
1636 Ga0207677_11022161
1637 Ga0207677_11552835
1638 Ga0207703_10063357
1639 Ga0207703_11638631
1640 Ga0207639_10099245
1641 Ga0207639_10194878
1642 Ga0207639_10225313
1643 Ga0207639_10275307
1644 Ga0207639_10384497
1645 Ga0207678_10272869
1646 Ga0207678_11138254
1647 Ga0207708_10100160
1648 Ga0207708_10638319
1649 Ga0207708_11074376
1650 Ga0207702_10258744
1651 Ga0207702_10387636
1652 Ga0207702_10873762
1653 Ga0207702_11145106
1654 Ga0207702_12253410
1655 Ga0207641_10040480
1656 Ga0207648_10009519
1657 Ga0207648_10343550
1658 Ga0207648_10419461
1659 Ga0207648_10565715
1660 Ga0207648_10802945
1661 Ga0207648_11504329
1662 Ga0207676_10007259
1663 Ga0207676_10030356
1664 Ga0207674_10019671
1665 Ga0207674_10056109
1666 Ga0207674_10085799
1667 Ga0207674_10119249
1668 Ga0207674_10548499
1669 Ga0207674_10950108
1670 Ga0207674_11270458
1671 Ga0207674_11300532
1672 Ga0207675_100021620
1673 Ga0207675_100556557
1674 Ga0207675_100569224
1675 Ga0207675_100618666
1676 Ga0207675_100770412
1677 Ga0207683_10011999
1678 Ga0207683_10031149
1679 Ga0207683_10240423
1680 Ga0207683_10484213
1681 Ga0207683_10560909
1682 Ga0207683_10846077
1683 Ga0207698_10201288
1684 Ga0207698_10210947
1685 Ga0207698_10370653
1686 Ga0207698_10561567
1687 Ga0207698_12402593
1688 Ga0207428_10040060
1689 Ga0207428_10115678
1690 Ga0207428_10391949
1691 Ga0268266_10118932
1692 Ga0268266_10181142
1693 Ga0268265_10082405
1694 Ga0268264_10015948
1695 Ga0268264_12457686
1696 Ga0307408_100447464
1697 Ga0307405_10727433
1698 Ga0307410_10409048
1699 Ga0307406_10207248
1700 Ga0307407_10190304
1701 Ga0307412_11021556
1702 Ga0307409_100005094
1703 Ga0307409_100134133
1704 Ga0307409_100396615
1705 Ga0307416_100212267
1706 Ga0307416_100249906
1707 Ga0307416_100312190
1708 Ga0307416_101405142
1709 Ga0307416_101604404
1710 Ga0307416_102350675
1711 Ga0307411_12018462
1712 Ga0307415_100367195
1713 Ga0373930_0019466
1714 Ga0373958_0021602
1715 Ga0373928_0286815
1716 Ga0373949_0058652
1717 Ga0373952_0020770
1718 Ga0373932_0064108
1719 Ga0373939_0012144
1720 Ga0373960_0004403
1721 Ga0373942_0019234
1722 Ga0373961_0075387
1723 Ga0373962_0044781
1724 Ga0373931_0046024
1725 Ga0395899_0339329
1726 Ga0395899_0497353
1727 Ga0395900_0124006
1728 Ga0395900_1059201
1729 Ga0395900_1183543
1730 Ga0395898_0634061
1731 Ga0395905_0254193
1732 Ga0395901_0031897
1733 Ga0395901_0053859
1734 Ga0395901_0766262
1735 Ga0439438_123980
1736 Ga0439439_0014769
1737 Ga0439461_0020875
1738 Ga0451807_0973115
1739 Ga0451849_0781224
1740 Ga0451853_2221785
1741 Ga0439431_0048789
1742 Ga0439431_0139511
1743 Ga0439433_0021549
1744 Ga0439445_0096585
1745 Ga0439449_0098692
1746 Ga0439450_059821
1747 Ga0439454_092704
1748 Ga0439455_0175258
1749 Ga0439462_0004588
1750 Ga0439463_078155
1751 Ga0450920_053379
1752 Ga0450898_154336
1753 Ga0450906_035143
1754 Ga0450907_003036
1755 Ga0439446_0041446
1756 Ga0439435_0043386
1757 Ga0439435_0370315
1758 Ga0450916_090013
1759 Ga0450918_067960
1760 Ga0450918_117423
1761 Ga0439440_0166296
1762 Ga0466963_0007102
1763 Ga0466964_0045668
1764 Ga0466967_0030922
1765 Ga0466967_0054799
1766 Ga0466967_0185904
1767 Ga0466967_0366793
1768 Ga0466967_1723754
1769 Ga0495584_0188589
1770 Ga0495584_0713865
1771 Ga0495656_0376622
1772 Ga0495659_0462418
1773 Ga0495588_0333495
1774 Ga0495649_0299434
1775 Ga0495581_0341787
1776 Ga0496100_0045745
1777 Ga0496100_0423550
1778 Ga0496100_0656406
1779 Ga0496100_1531304
1780 Ga0496101_0025365
1781 Ga0496101_0038271
1782 Ga0496101_1461375
1783 Ga0496101_1590123
1784 Ga0496102_0019916
1785 Ga0496102_0141661
1786 Ga0496102_0165526
1787 Ga0496102_0552542
1788 Ga0496102_1585797
1789 Ga0496103_0047469
1790 Ga0496103_0054239
1791 Ga0496103_0343613
1792 Ga0496104_0135316
1793 Ga0496105_0035991
1794 Ga0496105_0048768
1795 Ga0496105_0563176
1796 Ga0496106_0017853
1797 Ga0496106_0031742
1798 Ga0496106_0713033
1799 Ga0496106_1194923
1800 Ga0496106_1434130
1801 Ga0496107_0021077
1802 Ga0496107_0083658
1803 Ga0496107_0286157
1804 Ga0496108_0035867
1805 Ga0496108_0051537
1806 Ga0496108_0286817
1807 Ga0496109_0034539
1808 Ga0496109_0084951
1809 Ga0496109_0331691
1810 Ga0496110_0045052
1811 Ga0496110_0070098
1812 Ga0496110_0464844
1813 Ga0496110_0868620
1814 Ga0496111_0008744
1815 Ga0496111_0017607
1816 Ga0496111_0023055
1817 Ga0496111_0296524
1818 Ga0496111_1268839
1819 Ga0496112_0535290
1820 Ga0496113_0018473
1821 Ga0496113_0143759
1822 Ga0496114_0006536
1823 Ga0496114_0021606
1824 Ga0496114_0048296
1825 Ga0496114_0183742
1826 Ga0496114_0295273
1827 Ga0496115_0010987
1828 Ga0496115_0803849
1829 Ga0501031_0000628
1830 Ga0501031_0008032
1831 Ga0501031_0025953
1832 Ga0501031_0030183
1833 Ga0501031_0240615
1834 Ga0501032_0021813
1835 Ga0501032_0027034
1836 Ga0501032_0048974
1837 Ga0501032_0052793
1838 Ga0501033_0010372
1839 Ga0501033_0039778
1840 Ga0501033_0084755
1841 Ga0501033_0171652
1842 Ga0501033_0552822
1843 Ga0501033_0954342
1844 Ga0501034_0136518
1845 Ga0501034_0714999
1846 Ga0501036_0000812
1847 Ga0501036_0008588
1848 Ga0501036_0013667
1849 Ga0501036_0039539
1850 Ga0501036_0044446
1851 Ga0501036_0201410
1852 Ga0501036_0492246
1853 Ga0501036_0495590
1854 Ga0501036_0575256
1855 Ga0501036_0848264
1856 Ga0501036_1194512
1857 Ga0501037_0011722
1858 Ga0501037_0015086
1859 Ga0501037_0077612
1860 Ga0501037_0651317
1861 Ga0501037_1010942
1862 Ga0501037_1100390
1863 Ga0501038_0068752
1864 Ga0501038_0092417
1865 Ga0501038_0119581
1866 Ga0501038_0147318
1867 Ga0501038_0161531
1868 Ga0501038_0170301
1869 Ga0501038_0203195
1870 Ga0501038_0510165
1871 Ga0501038_0567234
1872 Ga0501038_1303786
1873 Ga0501039_0001256
1874 Ga0501039_0027322
1875 Ga0501039_0091909
1876 Ga0501039_0105273
1877 Ga0501039_0148989
1878 Ga0501039_0154996
1879 Ga0501039_0241933
1880 Ga0501039_0356272
1881 Ga0501039_0620700
1882 Ga0501039_0623227
1883 Ga0501040_0004583
1884 Ga0501040_0026470
1885 Ga0501040_0087471
1886 Ga0501040_0100315
1887 Ga0501040_0197930
1888 Ga0501040_0631582
1889 Ga0501040_0960209
1890 Ga0501040_1138592
1891 Ga0501041_0003684
1892 Ga0501041_0014075
1893 Ga0501041_0026519
1894 Ga0501041_0065808
1895 Ga0501041_0087671
1896 Ga0501041_0103034
1897 Ga0501041_0118325
1898 Ga0501041_0350942
1899 Ga0501041_0598818
1900 Ga0501042_0000147
1901 Ga0501042_0013484
1902 Ga0501042_0025146
1903 Ga0501042_0027502
1904 Ga0501042_0113230
1905 Ga0501042_0170045
1906 Ga0501042_0230264
1907 Ga0501042_0245216
1908 Ga0501042_0332816
1909 Ga0501042_1165933
1910 Ga0501043_0026625
1911 Ga0501043_0081779
1912 Ga0501043_0334079
1913 Ga0501043_0541915
1914 Ga0501043_0738763
1915 Ga0501043_1121696
1916 Ga0501046_0009845
1917 Ga0501046_0066165
1918 Ga0501046_0075095
1919 Ga0501046_0246854
1920 Ga0501046_0295736
1921 Ga0501046_0559655
1922 Ga0501047_0082855
1923 Ga0501047_0549053
1924 Ga0501048_0001203
1925 Ga0501048_0012158
1926 Ga0501048_0024597
1927 Ga0501048_0062628
1928 Ga0501048_0077336
1929 Ga0501048_0177750
1930 Ga0501048_0441683
1931 Ga0501048_0443392
1932 Ga0501048_0785450
1933 Ga0501048_1298107
1934 Ga0501067_0017123
1935 Ga0501067_0039274
1936 Ga0501067_0089183
1937 Ga0501067_0228883
1938 Ga0501067_0236018
1939 Ga0501067_0250672
1940 Ga0501067_0553387
1941 Ga0501068_0022664
1942 Ga0501068_0030547
1943 Ga0501068_0042836
1944 Ga0501068_0071606
1945 Ga0501068_0172061
1946 Ga0501068_0371684
1947 Ga0501069_0001115
1948 Ga0501069_0005154
1949 Ga0501069_0011374
1950 Ga0501069_0024604
1951 Ga0501069_0604849
1952 Ga0501069_0760067
1953 Ga0501070_0084634
1954 Ga0501070_0185255
1955 Ga0501070_0222062
1956 Ga0501070_0250639
1957 Ga0501070_0464901
1958 Ga0501071_0000047
1959 Ga0501071_0003972
1960 Ga0501071_0048083
1961 Ga0501071_0072205
1962 Ga0501071_0127993
1963 Ga0501071_0207478
1964 Ga0501071_0288035
1965 Ga0501071_0301963
1966 Ga0501071_0347443
1967 Ga0501071_0367933
1968 Ga0501071_0470457
1969 Ga0501071_1100414
1970 Ga0501071_1134200
1971 Ga0501072_0005337
1972 Ga0501072_0007176
1973 Ga0501072_0036448
1974 Ga0501072_0116877
1975 Ga0501072_0129168
1976 Ga0501072_0159229
1977 Ga0501072_0161806
1978 Ga0501072_0203746
1979 Ga0501072_0244759
1980 Ga0501072_0250670
1981 Ga0501072_0337719
1982 Ga0501072_1170422
1983 Ga0501073_0015162
1984 Ga0501073_0046061
1985 Ga0501073_0098653
1986 Ga0501073_0246005
1987 Ga0501073_0266021
1988 Ga0501073_0445776
1989 Ga0501073_0491230
1990 Ga0501074_0002330
1991 Ga0501074_0088901
1992 Ga0501074_0111833
1993 Ga0501074_0242244
1994 Ga0501074_0269553
1995 Ga0501074_0330249
1996 Ga0501074_0352501
1997 Ga0501074_0482649
1998 Ga0501074_0587897
1999 Ga0501074_1090968
2000 Ga0501075_0000079
2001 Ga0501075_0022784
2002 Ga0501075_0039892
2003 Ga0501075_0051207
2004 Ga0501075_0061201
2005 Ga0501075_0201223
2006 Ga0501075_0220812
2007 Ga0501075_0310962
2008 Ga0501075_0316855
2009 Ga0501075_0347914
2010 Ga0501075_0445439
2011 Ga0501075_0544007
2012 Ga0501075_1430735
2013 Ga0501076_0020207
2014 Ga0501076_0025447
2015 Ga0501076_0045344
2016 Ga0501076_0048998
2017 Ga0501076_0056095
2018 Ga0501076_0071070
2019 Ga0501076_0084118
2020 Ga0501076_0089383
2021 Ga0501076_0136617
2022 Ga0501076_0272929
2023 Ga0501076_0528236
2024 Ga0501076_0575936
2025 Ga0501076_0692582
2026 Ga0501076_0928123
2027 Ga0501076_1814360
2028 Ga0501077_0002534
2029 Ga0501077_0004906
2030 Ga0501077_0007994
2031 Ga0501077_0037902
2032 Ga0501077_0040757
2033 Ga0501077_0526013
2034 Ga0501077_0642820
2035 Ga0501077_0912883
2036 Ga0501079_0012883
2037 Ga0501079_0043429
2038 Ga0501079_0081732
2039 Ga0501079_0170385
2040 Ga0501079_0192003
2041 Ga0501079_0229768
2042 Ga0501079_0273037
2043 Ga0501079_0341710
2044 Ga0501079_1175411
2045 Ga0501080_0008633
2046 Ga0501080_0053015
2047 Ga0501080_0069831
2048 Ga0501080_0099897
2049 Ga0501080_0125366
2050 Ga0501080_0196662
2051 Ga0501080_1160780
2052 Ga0501080_1803952
2053 Ga0501081_0001935
2054 Ga0501081_0002356
2055 Ga0501081_0059171
2056 Ga0501081_0079155
2057 Ga0501081_0080075
2058 Ga0501081_0121895
2059 Ga0501081_0182676
2060 Ga0501081_0235816
2061 Ga0501081_0421206
2062 Ga0501081_1267623
2063 Ga0501083_0010147
2064 Ga0501083_0164307
2065 Ga0501083_0325700
2066 Ga0501083_0476694
2067 Ga0501035_0117664
2068 Ga0501035_0128176
2069 Ga0501035_0129006
2070 Ga0501035_0169383
2071 Ga0501035_0571699
2072 Ga0501035_0995086
2073 Ga0501035_1516330
2074 Ga0501044_0097347
2075 Ga0501044_0107146
2076 Ga0501044_0239384
2077 Ga0501044_0588359
2078 Ga0501044_0945492
2079 Ga0501045_0000967
2080 Ga0501045_0007845
2081 Ga0501045_0028388
2082 Ga0501045_0165382
2083 Ga0501045_0189574
2084 Ga0501045_0246561
2085 Ga0501045_0333605
2086 Ga0501045_0466980
2087 Ga0501045_0502991
2088 Ga0501045_0658173
2089 Ga0501045_1152955
2090 Ga0501045_1203158
2091 nmdc:mga05p37_1163417_c1
2092 nmdc:mga05p37_12914_c1
2093 nmdc:mga05p37_189715_c1
2094 nmdc:mga05p37_440517_c1
2095 nmdc:mga05p37_570696_c1
2096 nmdc:mga09592_105428_c1
2097 nmdc:mga09592_376187_c1
2098 nmdc:mga06r32_583803_c1
2099 nmdc:mga08y16_1074261_c1
2100 nmdc:mga08y16_1077376_c1
2101 nmdc:mga08y16_201766_c1
2102 nmdc:mga08y16_24599_c1
2103 nmdc:mga08y16_256872_c2
2104 nmdc:mga0n895_336279_c1
2105 nmdc:mga0rr50_273559_c1
2106 nmdc:mga0a205_109261_c1
2107 nmdc:mga0a205_1576986_c1
2108 nmdc:mga0a205_254669_c1
2109 nmdc:mga0a205_347292_c1
2110 Ga0495655_0150465
2111 Ga0501084_0000362
2112 Ga0501084_0006930
2113 Ga0501084_0013345
2114 Ga0501084_0021022
2115 Ga0501084_0087248
2116 Ga0501084_0102635
2117 Ga0501084_0139307
2118 Ga0501084_0152503
2119 Ga0501084_0192067
2120 Ga0501084_0537710
2121 Ga0590071_005283
2122 Ga0590074_032162
2123 Ga0590075_019485
2124 Ga0590075_022336
2125 Ga0590075_033820
2126 Ga0590077_036449
2127 Ga0501082_0002526
2128 Ga0501082_0009168
2129 Ga0501082_0057418
2130 Ga0501082_0075329
2131 Ga0501082_0160276
2132 Ga0501082_0240216
2133 Ga0501082_1044956
2134 Ga0501082_1285355
2135 Ga0530510_0006973
2136 Ga0530510_0015968
2137 Ga0530510_0048100
2138 Ga0530510_0087285
2139 Ga0530510_0101484
2140 Ga0530510_0152139
2141 Ga0530510_0198061
2142 Ga0530510_0229339
2143 Ga0530510_0245693
2144 Ga0530510_0254947
2145 Ga0530510_0290464
2146 Ga0530510_0810715
2147 Ga0530510_0854505
2148 Ga0530510_0922827

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1utg-assembly1.cif.gz_A refinement of the c2221 crystal form of oxidized uteroglobin at 1.34 angstroms resolution 0.6926 19 65
4arq-assembly1.cif.gz_A structure of the pesticin s89c, s285c double mutant 0.5929 5 69
8da8-assembly1.cif.gz_A coevolved affibody-z domain pair ll2.c1 0.5871 2 61
4epf-assembly1.cif.gz_A the crystal structure of pesticin from yersinia pestis 0.5838 5 69
4aqn-assembly1.cif.gz_A crystal structure of pesticin from y. pestis 0.5815 5 69
ID Description Score Start End Superfamily
2utgB00 Mainly Alpha;Orthogonal Bundle;Uteroglobin;Secretoglobin 0.6977 22 65 1.10.210.10
1utgA00 Mainly Alpha;Orthogonal Bundle;Uteroglobin;Secretoglobin 0.6926 19 65 1.10.210.10
af_I1J4E0_27_128_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6913 23 67 1.25.40.10
af_Q9UG01_590_768_1.25.40.470 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.6864 19 63 1.25.40.470
4epfB02 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.6587 5 66 1.10.530.40
ID Description Score Start End GO Terms
AF-A0A7Y5XYS5-F1-model_v4 Uncharacterized protein 1.001 3 66
AF-A0A7W0PX69-F1-model_v4 Uncharacterized protein 0.9964 1 70
AF-A0A7Y5XYS5-F1-model_v4 Uncharacterized protein 0.9566 3 66
AF-A0A538L6X6-F1-model_v4 Uncharacterized protein 0.9507 4 70
AF-A0A7V9CUV4-F1-model_v4 Uncharacterized protein 0.9052 19 66

Map