F489546
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1074 | 309 | 2148 | 70 |
Family's Representative Sequence
| Representative Sequence | 3300049583|Ga0501067_0030375|Ga0501067_0030375_1547_1780 |
| Length | 77 |
| Sequence | MPRDLAEGAVTTQATVSLLRWLRRQLREPSPLRERLEAAIENDDPAEARRIVSNAPFSDAQRRHVERLLDEWEHGAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 102 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 190 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 191 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 196 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 197 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 198 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 200 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 202 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 204 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 208 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 212 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 213 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 214 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 215 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 216 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 217 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 219 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 220 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 221 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 222 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 223 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 224 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 225 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 226 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 227 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 228 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 229 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 230 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 231 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 232 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 233 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 234 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 235 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 236 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 237 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 238 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 239 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 240 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 241 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 250 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 258 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 259 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 260 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 263 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 305 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 306 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 307 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 308 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.44 |
| Metatranscriptomes | 0.56 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.03 |
| Rhizosphere | 94.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 20.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501067_0030375 | 3300049583 | Bacteria | 2997 |
| 2 | Ga0070658_10086833 | 3300005327 | Bacteria | 2574 |
| 3 | Ga0070658_10533517 | 3300005327 | Bacteria | 1015 |
| 4 | Ga0070658_10802688 | 3300005327 | Bacteria | 818 |
| 5 | Ga0070658_10914885 | 3300005327 | Unclassified | 763 |
| 6 | Ga0070676_10792585 | 3300005328 | Bacteria | 699 |
| 7 | Ga0070683_100049689 | 3300005329 | Bacteria | 3880 |
| 8 | Ga0070683_100117354 | 3300005329 | Bacteria | 2513 |
| 9 | Ga0070683_100299275 | 3300005329 | Bacteria | 1530 |
| 10 | Ga0070683_101062570 | 3300005329 | Bacteria | 777 |
| 11 | Ga0070683_102122879 | 3300005329 | Unclassified | 539 |
| 12 | Ga0070670_100121050 | 3300005331 | Bacteria | 2258 |
| 13 | Ga0070670_100257384 | 3300005331 | Bacteria | 1521 |
| 14 | Ga0070670_100805547 | 3300005331 | Bacteria | 848 |
| 15 | Ga0070677_10722496 | 3300005333 | Unclassified | 563 |
| 16 | Ga0068869_100149486 | 3300005334 | Bacteria | 1810 |
| 17 | Ga0068869_100815153 | 3300005334 | Bacteria | 803 |
| 18 | Ga0068869_101261467 | 3300005334 | Bacteria | 651 |
| 19 | Ga0070666_10157180 | 3300005335 | Bacteria | 1588 |
| 20 | Ga0070680_100018540 | 3300005336 | Bacteria | 5500 |
| 21 | Ga0070680_100072322 | 3300005336 | Bacteria | 2834 |
| 22 | Ga0070680_101051017 | 3300005336 | Bacteria | 704 |
| 23 | Ga0070682_100029320 | 3300005337 | Bacteria | 3312 |
| 24 | Ga0070682_100111676 | 3300005337 | Bacteria | 1822 |
| 25 | Ga0070682_100200674 | 3300005337 | Bacteria | 1407 |
| 26 | Ga0070682_100265707 | 3300005337 | Bacteria | 1244 |
| 27 | Ga0070682_100300470 | 3300005337 | Bacteria | 1178 |
| 28 | Ga0070682_100635289 | 3300005337 | Unclassified | 848 |
| 29 | Ga0068868_100074981 | 3300005338 | Bacteria | 2703 |
| 30 | Ga0068868_100132822 | 3300005338 | Bacteria | 2038 |
| 31 | Ga0068868_100134574 | 3300005338 | Bacteria | 2025 |
| 32 | Ga0068868_100361093 | 3300005338 | Bacteria | 1246 |
| 33 | Ga0070660_100000633 | 3300005339 | Bacteria | 23391 |
| 34 | Ga0070660_100021968 | 3300005339 | Bacteria | 4713 |
| 35 | Ga0070660_100154204 | 3300005339 | Bacteria | 1848 |
| 36 | Ga0070660_100188360 | 3300005339 | Bacteria | 1671 |
| 37 | Ga0070660_100476574 | 3300005339 | Bacteria | 1037 |
| 38 | Ga0070660_101310834 | 3300005339 | Bacteria | 614 |
| 39 | Ga0070689_100027744 | 3300005340 | Bacteria | 4271 |
| 40 | Ga0070689_100055360 | 3300005340 | Bacteria | 3074 |
| 41 | Ga0070691_10190904 | 3300005341 | Bacteria | 1072 |
| 42 | Ga0070691_10677819 | 3300005341 | Bacteria | 617 |
| 43 | Ga0070687_100133781 | 3300005343 | Bacteria | 1435 |
| 44 | Ga0070661_100016213 | 3300005344 | Bacteria | 5263 |
| 45 | Ga0070661_100039051 | 3300005344 | Bacteria | 3457 |
| 46 | Ga0070661_100584573 | 3300005344 | Unclassified | 901 |
| 47 | Ga0070661_100663101 | 3300005344 | Bacteria | 848 |
| 48 | Ga0070661_100791387 | 3300005344 | Unclassified | 778 |
| 49 | Ga0070661_101163214 | 3300005344 | Bacteria | 644 |
| 50 | Ga0070692_10002758 | 3300005345 | Bacteria | 6914 |
| 51 | Ga0070692_10235194 | 3300005345 | Unclassified | 1089 |
| 52 | Ga0070692_10393801 | 3300005345 | Bacteria | 873 |
| 53 | Ga0070668_100081789 | 3300005347 | Bacteria | 2532 |
| 54 | Ga0070668_101378021 | 3300005347 | Bacteria | 642 |
| 55 | Ga0070669_100272160 | 3300005353 | Unclassified | 1355 |
| 56 | Ga0070669_100793312 | 3300005353 | Bacteria | 805 |
| 57 | Ga0070675_100009177 | 3300005354 | Bacteria | 7681 |
| 58 | Ga0070675_100039981 | 3300005354 | Bacteria | 3828 |
| 59 | Ga0070675_100503610 | 3300005354 | Unclassified | 1091 |
| 60 | Ga0070675_100711602 | 3300005354 | Bacteria | 915 |
| 61 | Ga0070675_101954622 | 3300005354 | Bacteria | 541 |
| 62 | Ga0070671_100095733 | 3300005355 | Bacteria | 2489 |
| 63 | Ga0070671_100125150 | 3300005355 | Bacteria | 2164 |
| 64 | Ga0070671_100794346 | 3300005355 | Bacteria | 824 |
| 65 | Ga0070671_101260512 | 3300005355 | Unclassified | 651 |
| 66 | Ga0070671_101270308 | 3300005355 | Bacteria | 649 |
| 67 | Ga0070674_100007213 | 3300005356 | Bacteria | 6543 |
| 68 | Ga0070674_100163114 | 3300005356 | Bacteria | 1692 |
| 69 | Ga0070674_100495528 | 3300005356 | Bacteria | 1016 |
| 70 | Ga0070673_100019858 | 3300005364 | Bacteria | 4833 |
| 71 | Ga0070673_100036452 | 3300005364 | Bacteria | 3739 |
| 72 | Ga0070673_100804132 | 3300005364 | Bacteria | 868 |
| 73 | Ga0070673_101249799 | 3300005364 | Unclassified | 697 |
| 74 | Ga0070673_101596514 | 3300005364 | Bacteria | 616 |
| 75 | Ga0070673_102046133 | 3300005364 | Unclassified | 544 |
| 76 | Ga0070688_100002575 | 3300005365 | Bacteria | 9188 |
| 77 | Ga0070688_100006031 | 3300005365 | Bacteria | 6432 |
| 78 | Ga0070688_100617943 | 3300005365 | Unclassified | 831 |
| 79 | Ga0070659_100004465 | 3300005366 | Bacteria | 9992 |
| 80 | Ga0070659_100018645 | 3300005366 | Bacteria | 5238 |
| 81 | Ga0070659_100033431 | 3300005366 | Bacteria | 3994 |
| 82 | Ga0070659_100494019 | 3300005366 | Bacteria | 1042 |
| 83 | Ga0070659_100564431 | 3300005366 | Bacteria | 975 |
| 84 | Ga0070659_100638604 | 3300005366 | Bacteria | 917 |
| 85 | Ga0070659_100787089 | 3300005366 | Unclassified | 826 |
| 86 | Ga0070659_100930586 | 3300005366 | Bacteria | 761 |
| 87 | Ga0070659_100950557 | 3300005366 | Unclassified | 753 |
| 88 | Ga0070667_100088116 | 3300005367 | Bacteria | 2665 |
| 89 | Ga0070667_100683427 | 3300005367 | Bacteria | 949 |
| 90 | Ga0070667_100735942 | 3300005367 | Bacteria | 914 |
| 91 | Ga0070703_10021633 | 3300005406 | Bacteria | 1882 |
| 92 | Ga0070703_10312121 | 3300005406 | Unclassified | 659 |
| 93 | Ga0070709_11360427 | 3300005434 | Unclassified | 574 |
| 94 | Ga0070714_100909282 | 3300005435 | Unclassified | 855 |
| 95 | Ga0070714_101228910 | 3300005435 | Bacteria | 731 |
| 96 | Ga0070710_10289824 | 3300005437 | Bacteria | 1065 |
| 97 | Ga0070701_10015521 | 3300005438 | Bacteria | 3520 |
| 98 | Ga0070701_10601297 | 3300005438 | Unclassified | 728 |
| 99 | Ga0070711_100936001 | 3300005439 | Unclassified | 741 |
| 100 | Ga0070705_100293521 | 3300005440 | Bacteria | 1161 |
| 101 | Ga0070705_100939885 | 3300005440 | Unclassified | 698 |
| 102 | Ga0070700_100041073 | 3300005441 | Bacteria | 2834 |
| 103 | Ga0070700_101762555 | 3300005441 | Unclassified | 533 |
| 104 | Ga0070694_100564523 | 3300005444 | Bacteria | 913 |
| 105 | Ga0070694_100655177 | 3300005444 | Archaea | 850 |
| 106 | Ga0070708_100562014 | 3300005445 | Bacteria | 1076 |
| 107 | Ga0070663_100362622 | 3300005455 | Unclassified | 1176 |
| 108 | Ga0070678_100080679 | 3300005456 | Bacteria | 2464 |
| 109 | Ga0070678_100467415 | 3300005456 | Unclassified | 1108 |
| 110 | Ga0070678_100476634 | 3300005456 | Unclassified | 1097 |
| 111 | Ga0070678_100486812 | 3300005456 | Bacteria | 1086 |
| 112 | Ga0070678_100636077 | 3300005456 | Bacteria | 956 |
| 113 | Ga0070678_101405572 | 3300005456 | Unclassified | 652 |
| 114 | Ga0070662_100026426 | 3300005457 | Bacteria | 4021 |
| 115 | Ga0070662_100187537 | 3300005457 | Unclassified | 1633 |
| 116 | Ga0070662_100311662 | 3300005457 | Unclassified | 1281 |
| 117 | Ga0070662_100474000 | 3300005457 | Unclassified | 1041 |
| 118 | Ga0070662_100834373 | 3300005457 | Bacteria | 784 |
| 119 | Ga0070662_101035804 | 3300005457 | Bacteria | 703 |
| 120 | Ga0070681_10013679 | 3300005458 | Bacteria | 8076 |
| 121 | Ga0070681_10051781 | 3300005458 | Bacteria | 4095 |
| 122 | Ga0070681_10052927 | 3300005458 | Bacteria | 4047 |
| 123 | Ga0070681_10070972 | 3300005458 | Bacteria | 3447 |
| 124 | Ga0070681_10790965 | 3300005458 | Unclassified | 865 |
| 125 | Ga0068867_100036199 | 3300005459 | Bacteria | 3581 |
| 126 | Ga0068867_100801772 | 3300005459 | Unclassified | 840 |
| 127 | Ga0068867_101115103 | 3300005459 | Unclassified | 721 |
| 128 | Ga0070685_10007211 | 3300005466 | Bacteria | 5680 |
| 129 | Ga0070685_10025361 | 3300005466 | Unclassified | 3264 |
| 130 | Ga0070685_10384070 | 3300005466 | Unclassified | 968 |
| 131 | Ga0070706_100988656 | 3300005467 | Unclassified | 776 |
| 132 | Ga0070698_100043820 | 3300005471 | Bacteria | 4585 |
| 133 | Ga0070698_101843244 | 3300005471 | Bacteria | 558 |
| 134 | Ga0070698_102200931 | 3300005471 | Bacteria | 505 |
| 135 | Ga0070699_100067520 | 3300005518 | Bacteria | 3105 |
| 136 | Ga0070679_100006282 | 3300005530 | Bacteria | 11060 |
| 137 | Ga0070679_100052895 | 3300005530 | Bacteria | 4043 |
| 138 | Ga0070679_100562728 | 3300005530 | Unclassified | 1084 |
| 139 | Ga0070679_100821108 | 3300005530 | Unclassified | 873 |
| 140 | Ga0070679_101058722 | 3300005530 | Unclassified | 755 |
| 141 | Ga0070679_101829318 | 3300005530 | Bacteria | 556 |
| 142 | Ga0070684_100008111 | 3300005535 | Bacteria | 8197 |
| 143 | Ga0070684_100045881 | 3300005535 | Bacteria | 3785 |
| 144 | Ga0070684_100072681 | 3300005535 | Bacteria | 3029 |
| 145 | Ga0070684_100133362 | 3300005535 | Bacteria | 2242 |
| 146 | Ga0070684_100708317 | 3300005535 | Unclassified | 939 |
| 147 | Ga0070684_101315577 | 3300005535 | Bacteria | 680 |
| 148 | Ga0070684_101471202 | 3300005535 | Bacteria | 642 |
| 149 | Ga0070684_101646980 | 3300005535 | Unclassified | 605 |
| 150 | Ga0068853_100011217 | 3300005539 | Bacteria | 7273 |
| 151 | Ga0068853_100051377 | 3300005539 | Bacteria | 3548 |
| 152 | Ga0068853_100190379 | 3300005539 | Bacteria | 1864 |
| 153 | Ga0068853_100297165 | 3300005539 | Bacteria | 1492 |
| 154 | Ga0068853_102493552 | 3300005539 | Unclassified | 501 |
| 155 | Ga0070672_100034033 | 3300005543 | Bacteria | 3864 |
| 156 | Ga0070672_100132649 | 3300005543 | Bacteria | 2049 |
| 157 | Ga0070686_100010484 | 3300005544 | Bacteria | 5228 |
| 158 | Ga0070686_100046839 | 3300005544 | Bacteria | 2731 |
| 159 | Ga0070696_100172967 | 3300005546 | Bacteria | 1598 |
| 160 | Ga0070696_100193062 | 3300005546 | Bacteria | 1516 |
| 161 | Ga0070696_100459180 | 3300005546 | Unclassified | 1006 |
| 162 | Ga0070693_100685860 | 3300005547 | Unclassified | 748 |
| 163 | Ga0070665_100006229 | 3300005548 | Bacteria | 12206 |
| 164 | Ga0070665_100025531 | 3300005548 | Bacteria | 5951 |
| 165 | Ga0070665_100114296 | 3300005548 | Bacteria | 2702 |
| 166 | Ga0070665_100523298 | 3300005548 | Bacteria | 1198 |
| 167 | Ga0070704_100040027 | 3300005549 | Bacteria | 3223 |
| 168 | Ga0070704_100530726 | 3300005549 | Unclassified | 1026 |
| 169 | Ga0070704_101661162 | 3300005549 | Bacteria | 590 |
| 170 | Ga0070704_101838651 | 3300005549 | Unclassified | 561 |
| 171 | Ga0068855_100023380 | 3300005563 | Bacteria | 7402 |
| 172 | Ga0068855_100104589 | 3300005563 | Bacteria | 3256 |
| 173 | Ga0068855_100192032 | 3300005563 | Bacteria | 2303 |
| 174 | Ga0068855_100442433 | 3300005563 | Bacteria | 1419 |
| 175 | Ga0068855_100474251 | 3300005563 | Bacteria | 1363 |
| 176 | Ga0068855_101946587 | 3300005563 | Unclassified | 595 |
| 177 | Ga0070664_100010134 | 3300005564 | Bacteria | 7642 |
| 178 | Ga0070664_100017988 | 3300005564 | Bacteria | 5803 |
| 179 | Ga0070664_100086943 | 3300005564 | Bacteria | 2701 |
| 180 | Ga0070664_100332796 | 3300005564 | Bacteria | 1378 |
| 181 | Ga0070664_100407164 | 3300005564 | Unclassified | 1244 |
| 182 | Ga0068857_100033549 | 3300005577 | Bacteria | 4540 |
| 183 | Ga0068857_100041363 | 3300005577 | Bacteria | 4087 |
| 184 | Ga0068857_100211359 | 3300005577 | Bacteria | 1770 |
| 185 | Ga0068857_100248312 | 3300005577 | Unclassified | 1631 |
| 186 | Ga0068857_100806508 | 3300005577 | Bacteria | 897 |
| 187 | Ga0068857_101046682 | 3300005577 | Bacteria | 787 |
| 188 | Ga0068857_101660612 | 3300005577 | Bacteria | 624 |
| 189 | Ga0068857_101877655 | 3300005577 | Bacteria | 587 |
| 190 | Ga0068854_100002029 | 3300005578 | Bacteria | 12407 |
| 191 | Ga0068854_100503885 | 3300005578 | Unclassified | 1020 |
| 192 | Ga0068854_100654255 | 3300005578 | Bacteria | 902 |
| 193 | Ga0068854_101018438 | 3300005578 | Bacteria | 734 |
| 194 | Ga0068854_101515435 | 3300005578 | Unclassified | 609 |
| 195 | Ga0068854_101549583 | 3300005578 | Unclassified | 603 |
| 196 | Ga0068856_100430163 | 3300005614 | Unclassified | 1340 |
| 197 | Ga0068856_100487967 | 3300005614 | Bacteria | 1253 |
| 198 | Ga0068856_100621762 | 3300005614 | Bacteria | 1101 |
| 199 | Ga0068856_100851577 | 3300005614 | Bacteria | 931 |
| 200 | Ga0070702_100111644 | 3300005615 | Unclassified | 1696 |
| 201 | Ga0070702_100153874 | 3300005615 | Bacteria | 1479 |
| 202 | Ga0068852_100048123 | 3300005616 | Bacteria | 3642 |
| 203 | Ga0068852_100156046 | 3300005616 | Bacteria | 2126 |
| 204 | Ga0068852_100170286 | 3300005616 | Bacteria | 2041 |
| 205 | Ga0068852_100348754 | 3300005616 | Bacteria | 1445 |
| 206 | Ga0068852_101237433 | 3300005616 | Archaea | 768 |
| 207 | Ga0068859_100015815 | 3300005617 | Bacteria | 7581 |
| 208 | Ga0068859_101724886 | 3300005617 | Bacteria | 692 |
| 209 | Ga0068864_100011033 | 3300005618 | Bacteria | 7468 |
| 210 | Ga0068864_100332577 | 3300005618 | Unclassified | 1430 |
| 211 | Ga0068864_102093684 | 3300005618 | Bacteria | 572 |
| 212 | Ga0068866_10004415 | 3300005718 | Bacteria | 5775 |
| 213 | Ga0068866_10213278 | 3300005718 | Bacteria | 1161 |
| 214 | Ga0068866_10240087 | 3300005718 | Bacteria | 1103 |
| 215 | Ga0068866_10768385 | 3300005718 | Unclassified | 667 |
| 216 | Ga0068866_10927788 | 3300005718 | Unclassified | 614 |
| 217 | Ga0068861_100011331 | 3300005719 | Bacteria | 6192 |
| 218 | Ga0068861_100577876 | 3300005719 | Bacteria | 1028 |
| 219 | Ga0068861_101750244 | 3300005719 | Unclassified | 615 |
| 220 | Ga0068851_10132174 | 3300005834 | Bacteria | 1351 |
| 221 | Ga0068851_10199361 | 3300005834 | Bacteria | 1116 |
| 222 | Ga0068870_10001003 | 3300005840 | Bacteria | 11148 |
| 223 | Ga0068870_10003881 | 3300005840 | Bacteria | 6374 |
| 224 | Ga0068870_10008337 | 3300005840 | Bacteria | 4659 |
| 225 | Ga0068870_10057630 | 3300005840 | Unclassified | 2077 |
| 226 | Ga0068870_10082898 | 3300005840 | Bacteria | 1777 |
| 227 | Ga0068863_100105864 | 3300005841 | Bacteria | 2676 |
| 228 | Ga0068858_100007230 | 3300005842 | Bacteria | 10760 |
| 229 | Ga0068860_100066714 | 3300005843 | Bacteria | 3419 |
| 230 | Ga0068862_100028166 | 3300005844 | Bacteria | 4730 |
| 231 | Ga0068862_100696459 | 3300005844 | Bacteria | 984 |
| 232 | Ga0068862_101014878 | 3300005844 | Unclassified | 821 |
| 233 | Ga0081455_10273227 | 3300005937 | Bacteria | 1225 |
| 234 | Ga0081455_10663204 | 3300005937 | Bacteria | 670 |
| 235 | Ga0081455_10815365 | 3300005937 | Unclassified | 585 |
| 236 | Ga0081455_11009112 | 3300005937 | Bacteria | 515 |
| 237 | Ga0070717_10337186 | 3300006028 | Bacteria | 1346 |
| 238 | Ga0075432_10021425 | 3300006058 | Bacteria | 2210 |
| 239 | Ga0070712_100056702 | 3300006175 | Bacteria | 2749 |
| 240 | Ga0097621_100017273 | 3300006237 | Bacteria | 5475 |
| 241 | Ga0097621_100177324 | 3300006237 | Bacteria | 1840 |
| 242 | Ga0097621_100461622 | 3300006237 | Bacteria | 1145 |
| 243 | Ga0097621_102295504 | 3300006237 | Bacteria | 516 |
| 244 | Ga0068871_100043606 | 3300006358 | Bacteria | 3603 |
| 245 | Ga0068871_100329559 | 3300006358 | Unclassified | 1346 |
| 246 | Ga0068871_101683145 | 3300006358 | Archaea | 601 |
| 247 | Ga0068871_101708911 | 3300006358 | Bacteria | 597 |
| 248 | Ga0075428_100146241 | 3300006844 | Bacteria | 2568 |
| 249 | Ga0075430_100585373 | 3300006846 | Bacteria | 921 |
| 250 | Ga0075431_100053006 | 3300006847 | Bacteria | 4182 |
| 251 | Ga0075431_100435488 | 3300006847 | Unclassified | 1309 |
| 252 | Ga0075431_100877211 | 3300006847 | Bacteria | 868 |
| 253 | Ga0075433_10034678 | 3300006852 | Bacteria | 4335 |
| 254 | Ga0075434_100439844 | 3300006871 | Bacteria | 1325 |
| 255 | Ga0075434_101413828 | 3300006871 | Unclassified | 706 |
| 256 | Ga0075429_100102391 | 3300006880 | Bacteria | 2500 |
| 257 | Ga0068865_100002899 | 3300006881 | Bacteria | 10226 |
| 258 | Ga0068865_100084563 | 3300006881 | Bacteria | 2286 |
| 259 | Ga0068865_100125464 | 3300006881 | Bacteria | 1915 |
| 260 | Ga0068865_100322996 | 3300006881 | Bacteria | 1242 |
| 261 | Ga0068865_100388447 | 3300006881 | Bacteria | 1140 |
| 262 | Ga0068865_100483227 | 3300006881 | Bacteria | 1030 |
| 263 | Ga0097620_100015816 | 3300006931 | Bacteria | 7581 |
| 264 | Ga0097620_101724940 | 3300006931 | Bacteria | 692 |
| 265 | Ga0105244_10196835 | 3300009036 | Bacteria | 951 |
| 266 | Ga0105240_10448263 | 3300009093 | Bacteria | 1445 |
| 267 | Ga0111539_10016235 | 3300009094 | Bacteria | 9236 |
| 268 | Ga0111539_10030637 | 3300009094 | Bacteria | 6539 |
| 269 | Ga0111539_10090436 | 3300009094 | Bacteria | 3597 |
| 270 | Ga0111539_10226752 | 3300009094 | Bacteria | 2176 |
| 271 | Ga0111539_10389818 | 3300009094 | Bacteria | 1622 |
| 272 | Ga0111539_10465031 | 3300009094 | Bacteria | 1473 |
| 273 | Ga0111539_10573128 | 3300009094 | Unclassified | 1315 |
| 274 | Ga0111539_11963190 | 3300009094 | Unclassified | 679 |
| 275 | Ga0105245_10050595 | 3300009098 | Bacteria | 3724 |
| 276 | Ga0105245_10294034 | 3300009098 | Unclassified | 1592 |
| 277 | Ga0105245_10330032 | 3300009098 | Bacteria | 1505 |
| 278 | Ga0105245_10453012 | 3300009098 | Bacteria | 1292 |
| 279 | Ga0105245_10466339 | 3300009098 | Bacteria | 1274 |
| 280 | Ga0105245_10601185 | 3300009098 | Bacteria | 1126 |
| 281 | Ga0105245_10818093 | 3300009098 | Bacteria | 970 |
| 282 | Ga0105245_10835307 | 3300009098 | Unclassified | 961 |
| 283 | Ga0105245_11092135 | 3300009098 | Bacteria | 844 |
| 284 | Ga0105245_11912924 | 3300009098 | Unclassified | 646 |
| 285 | Ga0105245_13150569 | 3300009098 | Bacteria | 511 |
| 286 | Ga0105247_10011070 | 3300009101 | Bacteria | 5443 |
| 287 | Ga0114129_10009207 | 3300009147 | Bacteria | 14081 |
| 288 | Ga0114129_10063203 | 3300009147 | Bacteria | 5170 |
| 289 | Ga0114129_10278651 | 3300009147 | Bacteria | 2235 |
| 290 | Ga0114129_10617029 | 3300009147 | Bacteria | 1403 |
| 291 | Ga0114129_10797797 | 3300009147 | Bacteria | 1205 |
| 292 | Ga0114129_11367646 | 3300009147 | Bacteria | 875 |
| 293 | Ga0105243_10007846 | 3300009148 | Bacteria | 8204 |
| 294 | Ga0105243_10061550 | 3300009148 | Unclassified | 3003 |
| 295 | Ga0105243_10149023 | 3300009148 | Bacteria | 2005 |
| 296 | Ga0105243_10234916 | 3300009148 | Bacteria | 1628 |
| 297 | Ga0105243_10627272 | 3300009148 | Bacteria | 1039 |
| 298 | Ga0105243_11389398 | 3300009148 | Bacteria | 722 |
| 299 | Ga0105241_10010013 | 3300009174 | Bacteria | 6960 |
| 300 | Ga0105241_10099377 | 3300009174 | Bacteria | 2311 |
| 301 | Ga0105241_10174286 | 3300009174 | Bacteria | 1779 |
| 302 | Ga0105241_10403910 | 3300009174 | Bacteria | 1199 |
| 303 | Ga0105241_11845107 | 3300009174 | Unclassified | 591 |
| 304 | Ga0105242_10048974 | 3300009176 | Bacteria | 3437 |
| 305 | Ga0105242_10218143 | 3300009176 | Bacteria | 1703 |
| 306 | Ga0105242_10226955 | 3300009176 | Bacteria | 1672 |
| 307 | Ga0105242_10342147 | 3300009176 | Unclassified | 1379 |
| 308 | Ga0105242_10435191 | 3300009176 | Bacteria | 1233 |
| 309 | Ga0105242_11836557 | 3300009176 | Unclassified | 645 |
| 310 | Ga0105242_12344823 | 3300009176 | Unclassified | 580 |
| 311 | Ga0105248_10050536 | 3300009177 | Bacteria | 4663 |
| 312 | Ga0105248_10497149 | 3300009177 | Unclassified | 1375 |
| 313 | Ga0105248_12888562 | 3300009177 | Unclassified | 548 |
| 314 | Ga0105237_10174871 | 3300009545 | Bacteria | 2147 |
| 315 | Ga0105237_10372604 | 3300009545 | Bacteria | 1432 |
| 316 | Ga0105237_12466084 | 3300009545 | Unclassified | 530 |
| 317 | Ga0105238_10007268 | 3300009551 | Bacteria | 11087 |
| 318 | Ga0105238_10048620 | 3300009551 | Bacteria | 4273 |
| 319 | Ga0105238_10213991 | 3300009551 | Bacteria | 1904 |
| 320 | Ga0105238_10345070 | 3300009551 | Bacteria | 1477 |
| 321 | Ga0105238_10953130 | 3300009551 | Unclassified | 878 |
| 322 | Ga0105238_11891090 | 3300009551 | Bacteria | 630 |
| 323 | Ga0105238_13052158 | 3300009551 | Unclassified | 502 |
| 324 | Ga0105249_10642927 | 3300009553 | Unclassified | 1118 |
| 325 | Ga0105239_10065565 | 3300010375 | Bacteria | 3988 |
| 326 | Ga0105239_10152209 | 3300010375 | Bacteria | 2582 |
| 327 | Ga0105239_10354671 | 3300010375 | Bacteria | 1656 |
| 328 | Ga0105239_11827137 | 3300010375 | Bacteria | 704 |
| 329 | Ga0105239_11909657 | 3300010375 | Bacteria | 689 |
| 330 | Ga0105239_12157021 | 3300010375 | Archaea | 648 |
| 331 | Ga0105239_13139960 | 3300010375 | Unclassified | 538 |
| 332 | Ga0105246_10103566 | 3300011119 | Bacteria | 2077 |
| 333 | Ga0105246_10189919 | 3300011119 | Bacteria | 1589 |
| 334 | Ga0105246_11426052 | 3300011119 | Unclassified | 647 |
| 335 | Ga0105246_11802636 | 3300011119 | Unclassified | 585 |
| 336 | Ga0157314_1013205 | 3300012500 | Unclassified | 753 |
| 337 | Ga0157347_1066986 | 3300012502 | Bacteria | 524 |
| 338 | Ga0157373_10046743 | 3300013100 | Bacteria | 3088 |
| 339 | Ga0157373_10125310 | 3300013100 | Bacteria | 1806 |
| 340 | Ga0157371_10008275 | 3300013102 | Bacteria | 8309 |
| 341 | Ga0157371_10147925 | 3300013102 | Bacteria | 1675 |
| 342 | Ga0157371_10183972 | 3300013102 | Bacteria | 1495 |
| 343 | Ga0157371_10431856 | 3300013102 | Bacteria | 967 |
| 344 | Ga0157370_10028771 | 3300013104 | Bacteria | 5463 |
| 345 | Ga0157370_10082477 | 3300013104 | Bacteria | 3024 |
| 346 | Ga0157370_10232346 | 3300013104 | Bacteria | 1707 |
| 347 | Ga0157369_10184273 | 3300013105 | Bacteria | 2195 |
| 348 | Ga0157369_10213454 | 3300013105 | Bacteria | 2022 |
| 349 | Ga0157369_10312884 | 3300013105 | Bacteria | 1633 |
| 350 | Ga0157374_10140233 | 3300013296 | Bacteria | 2346 |
| 351 | Ga0157374_10650362 | 3300013296 | Bacteria | 1066 |
| 352 | Ga0157374_10850665 | 3300013296 | Unclassified | 929 |
| 353 | Ga0157374_10863396 | 3300013296 | Bacteria | 922 |
| 354 | Ga0157374_11453637 | 3300013296 | Bacteria | 709 |
| 355 | Ga0157374_11621919 | 3300013296 | Bacteria | 671 |
| 356 | Ga0157374_11654437 | 3300013296 | Unclassified | 665 |
| 357 | Ga0157378_10186973 | 3300013297 | Unclassified | 1951 |
| 358 | Ga0157378_11117527 | 3300013297 | Unclassified | 825 |
| 359 | Ga0157378_12927604 | 3300013297 | Unclassified | 529 |
| 360 | Ga0163162_10524182 | 3300013306 | Bacteria | 1314 |
| 361 | Ga0157372_10024231 | 3300013307 | Bacteria | 6588 |
| 362 | Ga0157372_10063800 | 3300013307 | Bacteria | 4132 |
| 363 | Ga0157372_10066412 | 3300013307 | Bacteria | 4052 |
| 364 | Ga0157372_10133714 | 3300013307 | Bacteria | 2855 |
| 365 | Ga0157372_10395222 | 3300013307 | Bacteria | 1611 |
| 366 | Ga0157372_10833996 | 3300013307 | Bacteria | 1070 |
| 367 | Ga0157372_10915202 | 3300013307 | Bacteria | 1017 |
| 368 | Ga0157372_11010694 | 3300013307 | Unclassified | 963 |
| 369 | Ga0157375_10008715 | 3300013308 | Bacteria | 8886 |
| 370 | Ga0157375_10039371 | 3300013308 | Bacteria | 4549 |
| 371 | Ga0157375_10205090 | 3300013308 | Bacteria | 2128 |
| 372 | Ga0163163_10097475 | 3300014325 | Bacteria | 2960 |
| 373 | Ga0163163_10311006 | 3300014325 | Unclassified | 1628 |
| 374 | Ga0163163_11491121 | 3300014325 | Unclassified | 738 |
| 375 | Ga0163163_12758276 | 3300014325 | Unclassified | 548 |
| 376 | Ga0157380_10030921 | 3300014326 | Bacteria | 4106 |
| 377 | Ga0157380_10058951 | 3300014326 | Bacteria | 3062 |
| 378 | Ga0157380_10633454 | 3300014326 | Unclassified | 1064 |
| 379 | Ga0157380_11549824 | 3300014326 | Bacteria | 717 |
| 380 | Ga0157380_12905149 | 3300014326 | Bacteria | 545 |
| 381 | Ga0182008_10821719 | 3300014497 | Bacteria | 541 |
| 382 | Ga0157377_10013583 | 3300014745 | Bacteria | 4125 |
| 383 | Ga0157377_10149549 | 3300014745 | Bacteria | 1442 |
| 384 | Ga0157377_10648557 | 3300014745 | Bacteria | 760 |
| 385 | Ga0157377_11199121 | 3300014745 | Bacteria | 588 |
| 386 | Ga0157379_10036587 | 3300014968 | Bacteria | 4376 |
| 387 | Ga0157379_11330168 | 3300014968 | Bacteria | 695 |
| 388 | Ga0157376_10021308 | 3300014969 | Bacteria | 5033 |
| 389 | Ga0157376_11127277 | 3300014969 | Bacteria | 811 |
| 390 | Ga0163161_10019407 | 3300017792 | Bacteria | 4770 |
| 391 | Ga0163161_10765798 | 3300017792 | Bacteria | 809 |
| 392 | Ga0206356_10074813 | 3300020070 | Archaea | 822 |
| 393 | Ga0206356_11026427 | 3300020070 | Bacteria | 2375 |
| 394 | Ga0206354_10520300 | 3300020081 | Bacteria | 1057 |
| 395 | Ga0206354_10868705 | 3300020081 | Bacteria | 699 |
| 396 | Ga0206353_11653627 | 3300020082 | Bacteria | 3092 |
| 397 | Ga0206353_11718206 | 3300020082 | Unclassified | 1089 |
| 398 | Ga0207656_10191397 | 3300025321 | Unclassified | 985 |
| 399 | Ga0207656_10401854 | 3300025321 | Bacteria | 689 |
| 400 | Ga0207653_10007755 | 3300025885 | Bacteria | 3348 |
| 401 | Ga0207682_10554894 | 3300025893 | Unclassified | 543 |
| 402 | Ga0207642_10023887 | 3300025899 | Bacteria | 2450 |
| 403 | Ga0207642_10350240 | 3300025899 | Bacteria | 871 |
| 404 | Ga0207642_10736763 | 3300025899 | Unclassified | 623 |
| 405 | Ga0207642_10946210 | 3300025899 | Unclassified | 553 |
| 406 | Ga0207710_10062274 | 3300025900 | Bacteria | 1695 |
| 407 | Ga0207688_10003380 | 3300025901 | Bacteria | 8707 |
| 408 | Ga0207688_10011445 | 3300025901 | Bacteria | 4831 |
| 409 | Ga0207688_10025323 | 3300025901 | Bacteria | 3257 |
| 410 | Ga0207688_11005603 | 3300025901 | Unclassified | 527 |
| 411 | Ga0207680_10673735 | 3300025903 | Bacteria | 741 |
| 412 | Ga0207647_10190983 | 3300025904 | Bacteria | 1187 |
| 413 | Ga0207645_10024812 | 3300025907 | Bacteria | 3884 |
| 414 | Ga0207645_10391930 | 3300025907 | Bacteria | 933 |
| 415 | Ga0207645_10844533 | 3300025907 | Bacteria | 622 |
| 416 | Ga0207643_10004645 | 3300025908 | Bacteria | 7377 |
| 417 | Ga0207643_10006379 | 3300025908 | Bacteria | 6317 |
| 418 | Ga0207643_10007430 | 3300025908 | Bacteria | 5878 |
| 419 | Ga0207643_10051829 | 3300025908 | Bacteria | 2330 |
| 420 | Ga0207705_10295968 | 3300025909 | Bacteria | 1240 |
| 421 | Ga0207684_10547595 | 3300025910 | Bacteria | 990 |
| 422 | Ga0207684_10974837 | 3300025910 | Bacteria | 710 |
| 423 | Ga0207684_11321966 | 3300025910 | Unclassified | 593 |
| 424 | Ga0207654_10463004 | 3300025911 | Bacteria | 891 |
| 425 | Ga0207707_10018617 | 3300025912 | Bacteria | 6054 |
| 426 | Ga0207707_10022270 | 3300025912 | Bacteria | 5540 |
| 427 | Ga0207707_10051099 | 3300025912 | Bacteria | 3600 |
| 428 | Ga0207707_10173461 | 3300025912 | Bacteria | 1884 |
| 429 | Ga0207707_10471082 | 3300025912 | Bacteria | 1073 |
| 430 | Ga0207707_10634084 | 3300025912 | Unclassified | 902 |
| 431 | Ga0207695_11213011 | 3300025913 | Bacteria | 635 |
| 432 | Ga0207695_11406487 | 3300025913 | Bacteria | 578 |
| 433 | Ga0207671_10150027 | 3300025914 | Bacteria | 1801 |
| 434 | Ga0207671_10270080 | 3300025914 | Bacteria | 1340 |
| 435 | Ga0207693_10229625 | 3300025915 | Bacteria | 1457 |
| 436 | Ga0207660_10047819 | 3300025917 | Bacteria | 3026 |
| 437 | Ga0207660_10057473 | 3300025917 | Bacteria | 2786 |
| 438 | Ga0207660_10181005 | 3300025917 | Bacteria | 1637 |
| 439 | Ga0207660_10203646 | 3300025917 | Bacteria | 1547 |
| 440 | Ga0207660_10261399 | 3300025917 | Bacteria | 1369 |
| 441 | Ga0207660_10527447 | 3300025917 | Bacteria | 959 |
| 442 | Ga0207662_10139030 | 3300025918 | Bacteria | 1537 |
| 443 | Ga0207657_10000275 | 3300025919 | Bacteria | 54762 |
| 444 | Ga0207657_10001621 | 3300025919 | Bacteria | 24215 |
| 445 | Ga0207657_10060290 | 3300025919 | Bacteria | 3257 |
| 446 | Ga0207657_10101655 | 3300025919 | Bacteria | 2385 |
| 447 | Ga0207657_10308213 | 3300025919 | Bacteria | 1253 |
| 448 | Ga0207657_10967514 | 3300025919 | Bacteria | 654 |
| 449 | Ga0207649_10085816 | 3300025920 | Bacteria | 2049 |
| 450 | Ga0207649_10144914 | 3300025920 | Bacteria | 1629 |
| 451 | Ga0207649_10160865 | 3300025920 | Bacteria | 1555 |
| 452 | Ga0207649_10980377 | 3300025920 | Bacteria | 665 |
| 453 | Ga0207649_11497305 | 3300025920 | Unclassified | 534 |
| 454 | Ga0207652_10040605 | 3300025921 | Bacteria | 3951 |
| 455 | Ga0207652_10045550 | 3300025921 | Bacteria | 3740 |
| 456 | Ga0207652_10080380 | 3300025921 | Bacteria | 2850 |
| 457 | Ga0207652_10143537 | 3300025921 | Bacteria | 2135 |
| 458 | Ga0207652_10183239 | 3300025921 | Bacteria | 1882 |
| 459 | Ga0207652_10331184 | 3300025921 | Bacteria | 1375 |
| 460 | Ga0207652_10350047 | 3300025921 | Bacteria | 1333 |
| 461 | Ga0207652_10511367 | 3300025921 | Bacteria | 1081 |
| 462 | Ga0207681_10018673 | 3300025923 | Bacteria | 4372 |
| 463 | Ga0207694_10024324 | 3300025924 | Bacteria | 4598 |
| 464 | Ga0207694_10119575 | 3300025924 | Bacteria | 2102 |
| 465 | Ga0207694_10388741 | 3300025924 | Bacteria | 1159 |
| 466 | Ga0207694_10494788 | 3300025924 | Bacteria | 1023 |
| 467 | Ga0207650_10002681 | 3300025925 | Bacteria | 12310 |
| 468 | Ga0207650_10010855 | 3300025925 | Bacteria | 6260 |
| 469 | Ga0207650_10269163 | 3300025925 | Bacteria | 1384 |
| 470 | Ga0207650_10463923 | 3300025925 | Unclassified | 1055 |
| 471 | Ga0207650_10872902 | 3300025925 | Bacteria | 763 |
| 472 | Ga0207650_10874591 | 3300025925 | Bacteria | 763 |
| 473 | Ga0207659_10016197 | 3300025926 | Bacteria | 4847 |
| 474 | Ga0207659_10026366 | 3300025926 | Bacteria | 3920 |
| 475 | Ga0207659_10436276 | 3300025926 | Bacteria | 1101 |
| 476 | Ga0207687_10006518 | 3300025927 | Bacteria | 7711 |
| 477 | Ga0207687_10207530 | 3300025927 | Bacteria | 1535 |
| 478 | Ga0207687_10402333 | 3300025927 | Bacteria | 1126 |
| 479 | Ga0207687_10825863 | 3300025927 | Unclassified | 791 |
| 480 | Ga0207700_10715222 | 3300025928 | Unclassified | 894 |
| 481 | Ga0207664_10815720 | 3300025929 | Unclassified | 839 |
| 482 | Ga0207644_10021923 | 3300025931 | Bacteria | 4357 |
| 483 | Ga0207644_10206249 | 3300025931 | Bacteria | 1552 |
| 484 | Ga0207644_10524578 | 3300025931 | Bacteria | 979 |
| 485 | Ga0207690_10016947 | 3300025932 | Bacteria | 4443 |
| 486 | Ga0207690_10037450 | 3300025932 | Bacteria | 3149 |
| 487 | Ga0207690_10119313 | 3300025932 | Bacteria | 1913 |
| 488 | Ga0207690_10289422 | 3300025932 | Bacteria | 1278 |
| 489 | Ga0207690_10415258 | 3300025932 | Bacteria | 1076 |
| 490 | Ga0207690_10432271 | 3300025932 | Bacteria | 1055 |
| 491 | Ga0207690_10559654 | 3300025932 | Bacteria | 930 |
| 492 | Ga0207690_10636635 | 3300025932 | Bacteria | 873 |
| 493 | Ga0207690_11088221 | 3300025932 | Bacteria | 666 |
| 494 | Ga0207706_10021103 | 3300025933 | Bacteria | 5850 |
| 495 | Ga0207706_10072559 | 3300025933 | Bacteria | 3027 |
| 496 | Ga0207706_10598156 | 3300025933 | Bacteria | 947 |
| 497 | Ga0207706_10769325 | 3300025933 | Unclassified | 820 |
| 498 | Ga0207706_11000976 | 3300025933 | Unclassified | 702 |
| 499 | Ga0207686_10080616 | 3300025934 | Bacteria | 2122 |
| 500 | Ga0207686_10289793 | 3300025934 | Bacteria | 1212 |
| 501 | Ga0207686_10597087 | 3300025934 | Bacteria | 868 |
| 502 | Ga0207686_11040945 | 3300025934 | Unclassified | 665 |
| 503 | Ga0207709_10024013 | 3300025935 | Bacteria | 3477 |
| 504 | Ga0207709_10106035 | 3300025935 | Unclassified | 1869 |
| 505 | Ga0207709_10347824 | 3300025935 | Bacteria | 1118 |
| 506 | Ga0207709_10579563 | 3300025935 | Bacteria | 886 |
| 507 | Ga0207709_11862627 | 3300025935 | Unclassified | 501 |
| 508 | Ga0207670_10009107 | 3300025936 | Bacteria | 5642 |
| 509 | Ga0207670_10137607 | 3300025936 | Bacteria | 1797 |
| 510 | Ga0207669_10013786 | 3300025937 | Bacteria | 4030 |
| 511 | Ga0207669_10064407 | 3300025937 | Bacteria | 2268 |
| 512 | Ga0207669_10126815 | 3300025937 | Unclassified | 1745 |
| 513 | Ga0207669_10235747 | 3300025937 | Bacteria | 1353 |
| 514 | Ga0207669_10449630 | 3300025937 | Bacteria | 1021 |
| 515 | Ga0207669_10607739 | 3300025937 | Unclassified | 889 |
| 516 | Ga0207704_10068882 | 3300025938 | Bacteria | 2233 |
| 517 | Ga0207704_10129335 | 3300025938 | Unclassified | 1745 |
| 518 | Ga0207704_10140875 | 3300025938 | Unclassified | 1687 |
| 519 | Ga0207704_11916031 | 3300025938 | Unclassified | 510 |
| 520 | Ga0207691_10007140 | 3300025940 | Bacteria | 10779 |
| 521 | Ga0207691_10019534 | 3300025940 | Bacteria | 6411 |
| 522 | Ga0207691_10023030 | 3300025940 | Bacteria | 5867 |
| 523 | Ga0207691_10303925 | 3300025940 | Bacteria | 1370 |
| 524 | Ga0207711_10162710 | 3300025941 | Bacteria | 2021 |
| 525 | Ga0207711_10373772 | 3300025941 | Bacteria | 1322 |
| 526 | Ga0207689_10134248 | 3300025942 | Bacteria | 2038 |
| 527 | Ga0207689_10173199 | 3300025942 | Bacteria | 1779 |
| 528 | Ga0207689_10224667 | 3300025942 | Bacteria | 1552 |
| 529 | Ga0207689_11746224 | 3300025942 | Unclassified | 515 |
| 530 | Ga0207661_10075898 | 3300025944 | Unclassified | 2759 |
| 531 | Ga0207661_10109403 | 3300025944 | Bacteria | 2335 |
| 532 | Ga0207661_10115852 | 3300025944 | Bacteria | 2274 |
| 533 | Ga0207661_10218836 | 3300025944 | Bacteria | 1682 |
| 534 | Ga0207661_10410832 | 3300025944 | Bacteria | 1228 |
| 535 | Ga0207661_10844511 | 3300025944 | Unclassified | 843 |
| 536 | Ga0207661_11104460 | 3300025944 | Bacteria | 730 |
| 537 | Ga0207661_11430705 | 3300025944 | Bacteria | 634 |
| 538 | Ga0207679_10173594 | 3300025945 | Bacteria | 1777 |
| 539 | Ga0207679_10291775 | 3300025945 | Bacteria | 1402 |
| 540 | Ga0207679_10431081 | 3300025945 | Bacteria | 1165 |
| 541 | Ga0207679_10472424 | 3300025945 | Unclassified | 1115 |
| 542 | Ga0207679_10867004 | 3300025945 | Unclassified | 825 |
| 543 | Ga0207667_10213750 | 3300025949 | Bacteria | 1976 |
| 544 | Ga0207667_10250275 | 3300025949 | Bacteria | 1812 |
| 545 | Ga0207667_10597373 | 3300025949 | Bacteria | 1113 |
| 546 | Ga0207651_10043346 | 3300025960 | Bacteria | 3002 |
| 547 | Ga0207651_10625429 | 3300025960 | Unclassified | 943 |
| 548 | Ga0207651_11261851 | 3300025960 | Unclassified | 664 |
| 549 | Ga0207651_11342628 | 3300025960 | Unclassified | 643 |
| 550 | Ga0207651_11431660 | 3300025960 | Unclassified | 622 |
| 551 | Ga0207712_11590884 | 3300025961 | Unclassified | 586 |
| 552 | Ga0207668_10031906 | 3300025972 | Bacteria | 3475 |
| 553 | Ga0207668_10097404 | 3300025972 | Bacteria | 2177 |
| 554 | Ga0207640_10365254 | 3300025981 | Bacteria | 1164 |
| 555 | Ga0207640_10622732 | 3300025981 | Bacteria | 916 |
| 556 | Ga0207640_10818700 | 3300025981 | Unclassified | 808 |
| 557 | Ga0207640_11341945 | 3300025981 | Bacteria | 639 |
| 558 | Ga0207658_11332785 | 3300025986 | Bacteria | 656 |
| 559 | Ga0207677_10052484 | 3300026023 | Bacteria | 2770 |
| 560 | Ga0207677_10057290 | 3300026023 | Bacteria | 2675 |
| 561 | Ga0207677_10797824 | 3300026023 | Unclassified | 845 |
| 562 | Ga0207677_11022161 | 3300026023 | Bacteria | 750 |
| 563 | Ga0207677_11552835 | 3300026023 | Bacteria | 612 |
| 564 | Ga0207703_10063357 | 3300026035 | Bacteria | 3031 |
| 565 | Ga0207703_11638631 | 3300026035 | Bacteria | 619 |
| 566 | Ga0207639_10099245 | 3300026041 | Bacteria | 2349 |
| 567 | Ga0207639_10194878 | 3300026041 | Bacteria | 1733 |
| 568 | Ga0207639_10225313 | 3300026041 | Bacteria | 1622 |
| 569 | Ga0207639_10275307 | 3300026041 | Bacteria | 1478 |
| 570 | Ga0207639_10384497 | 3300026041 | Bacteria | 1261 |
| 571 | Ga0207678_10272869 | 3300026067 | Bacteria | 1450 |
| 572 | Ga0207678_11138254 | 3300026067 | Bacteria | 691 |
| 573 | Ga0207708_10100160 | 3300026075 | Bacteria | 2242 |
| 574 | Ga0207708_10638319 | 3300026075 | Bacteria | 905 |
| 575 | Ga0207708_11074376 | 3300026075 | Bacteria | 701 |
| 576 | Ga0207702_10258744 | 3300026078 | Bacteria | 1638 |
| 577 | Ga0207702_10387636 | 3300026078 | Bacteria | 1345 |
| 578 | Ga0207702_10873762 | 3300026078 | Bacteria | 890 |
| 579 | Ga0207702_11145106 | 3300026078 | Bacteria | 772 |
| 580 | Ga0207702_12253410 | 3300026078 | Unclassified | 533 |
| 581 | Ga0207641_10040480 | 3300026088 | Bacteria | 3903 |
| 582 | Ga0207648_10009519 | 3300026089 | Bacteria | 9297 |
| 583 | Ga0207648_10343550 | 3300026089 | Bacteria | 1344 |
| 584 | Ga0207648_10419461 | 3300026089 | Bacteria | 1215 |
| 585 | Ga0207648_10565715 | 3300026089 | Unclassified | 1045 |
| 586 | Ga0207648_10802945 | 3300026089 | Bacteria | 876 |
| 587 | Ga0207648_11504329 | 3300026089 | Archaea | 633 |
| 588 | Ga0207676_10007259 | 3300026095 | Bacteria | 7850 |
| 589 | Ga0207676_10030356 | 3300026095 | Bacteria | 4057 |
| 590 | Ga0207674_10019671 | 3300026116 | Bacteria | 7311 |
| 591 | Ga0207674_10056109 | 3300026116 | Bacteria | 4001 |
| 592 | Ga0207674_10085799 | 3300026116 | Bacteria | 3143 |
| 593 | Ga0207674_10119249 | 3300026116 | Bacteria | 2608 |
| 594 | Ga0207674_10548499 | 3300026116 | Unclassified | 1117 |
| 595 | Ga0207674_10950108 | 3300026116 | Bacteria | 828 |
| 596 | Ga0207674_11270458 | 3300026116 | Bacteria | 706 |
| 597 | Ga0207674_11300532 | 3300026116 | Bacteria | 697 |
| 598 | Ga0207675_100021620 | 3300026118 | Bacteria | 5991 |
| 599 | Ga0207675_100556557 | 3300026118 | Unclassified | 1146 |
| 600 | Ga0207675_100569224 | 3300026118 | Bacteria | 1134 |
| 601 | Ga0207675_100618666 | 3300026118 | Unclassified | 1087 |
| 602 | Ga0207675_100770412 | 3300026118 | Unclassified | 974 |
| 603 | Ga0207683_10011999 | 3300026121 | Bacteria | 7397 |
| 604 | Ga0207683_10031149 | 3300026121 | Bacteria | 4628 |
| 605 | Ga0207683_10240423 | 3300026121 | Bacteria | 1651 |
| 606 | Ga0207683_10484213 | 3300026121 | Bacteria | 1142 |
| 607 | Ga0207683_10560909 | 3300026121 | Bacteria | 1056 |
| 608 | Ga0207683_10846077 | 3300026121 | Bacteria | 849 |
| 609 | Ga0207698_10201288 | 3300026142 | Bacteria | 1783 |
| 610 | Ga0207698_10210947 | 3300026142 | Bacteria | 1747 |
| 611 | Ga0207698_10370653 | 3300026142 | Bacteria | 1359 |
| 612 | Ga0207698_10561567 | 3300026142 | Bacteria | 1120 |
| 613 | Ga0207698_12402593 | 3300026142 | Unclassified | 538 |
| 614 | Ga0207428_10040060 | 3300027907 | Bacteria | 3803 |
| 615 | Ga0207428_10115678 | 3300027907 | Bacteria | 2060 |
| 616 | Ga0207428_10391949 | 3300027907 | Bacteria | 1018 |
| 617 | Ga0268266_10118932 | 3300028379 | Bacteria | 2349 |
| 618 | Ga0268266_10181142 | 3300028379 | Bacteria | 1918 |
| 619 | Ga0268265_10082405 | 3300028380 | Bacteria | 2544 |
| 620 | Ga0268264_10015948 | 3300028381 | Bacteria | 6155 |
| 621 | Ga0268264_12457686 | 3300028381 | Unclassified | 527 |
| 622 | Ga0307408_100447464 | 3300031548 | Bacteria | 1120 |
| 623 | Ga0307405_10727433 | 3300031731 | Bacteria | 825 |
| 624 | Ga0307410_10409048 | 3300031852 | Bacteria | 1098 |
| 625 | Ga0307406_10207248 | 3300031901 | Bacteria | 1448 |
| 626 | Ga0307407_10190304 | 3300031903 | Bacteria | 1367 |
| 627 | Ga0307412_11021556 | 3300031911 | Bacteria | 732 |
| 628 | Ga0307409_100005094 | 3300031995 | Bacteria | 7497 |
| 629 | Ga0307409_100134133 | 3300031995 | Bacteria | 2121 |
| 630 | Ga0307409_100396615 | 3300031995 | Unclassified | 1317 |
| 631 | Ga0307416_100212267 | 3300032002 | Bacteria | 1848 |
| 632 | Ga0307416_100249906 | 3300032002 | Bacteria | 1725 |
| 633 | Ga0307416_100312190 | 3300032002 | Bacteria | 1569 |
| 634 | Ga0307416_101405142 | 3300032002 | Unclassified | 804 |
| 635 | Ga0307416_101604404 | 3300032002 | Unclassified | 756 |
| 636 | Ga0307416_102350675 | 3300032002 | Bacteria | 633 |
| 637 | Ga0307411_12018462 | 3300032005 | Bacteria | 539 |
| 638 | Ga0307415_100367195 | 3300032126 | Bacteria | 1217 |
| 639 | Ga0373930_0019466 | 3300034816 | Unclassified | 1314 |
| 640 | Ga0373958_0021602 | 3300034819 | Unclassified | 1196 |
| 641 | Ga0373928_0286815 | 3300035084 | Unclassified | 501 |
| 642 | Ga0373949_0058652 | 3300035090 | Unclassified | 986 |
| 643 | Ga0373952_0020770 | 3300035092 | Unclassified | 1379 |
| 644 | Ga0373932_0064108 | 3300035112 | Unclassified | 1124 |
| 645 | Ga0373939_0012144 | 3300035114 | Bacteria | 2190 |
| 646 | Ga0373960_0004403 | 3300035121 | Bacteria | 3223 |
| 647 | Ga0373942_0019234 | 3300035207 | Unclassified | 1703 |
| 648 | Ga0373961_0075387 | 3300035241 | Bacteria | 1051 |
| 649 | Ga0373962_0044781 | 3300035242 | Unclassified | 1258 |
| 650 | Ga0373931_0046024 | 3300035691 | Bacteria | 2305 |
| 651 | Ga0395899_0339329 | 3300037312 | Bacteria | 1008 |
| 652 | Ga0395899_0497353 | 3300037312 | Bacteria | 791 |
| 653 | Ga0395900_0124006 | 3300037418 | Bacteria | 2650 |
| 654 | Ga0395900_1059201 | 3300037418 | Bacteria | 729 |
| 655 | Ga0395900_1183543 | 3300037418 | Unclassified | 680 |
| 656 | Ga0395898_0634061 | 3300037466 | Bacteria | 1011 |
| 657 | Ga0395905_0254193 | 3300037471 | Bacteria | 1641 |
| 658 | Ga0395901_0031897 | 3300038443 | Bacteria | 5433 |
| 659 | Ga0395901_0053859 | 3300038443 | Bacteria | 4181 |
| 660 | Ga0395901_0766262 | 3300038443 | Unclassified | 957 |
| 661 | Ga0439438_123980 | 3300041405 | Unclassified | 621 |
| 662 | Ga0439439_0014769 | 3300041406 | Bacteria | 1903 |
| 663 | Ga0439461_0020875 | 3300041410 | Bacteria | 1301 |
| 664 | Ga0451807_0973115 | 3300041486 | Unclassified | 1094 |
| 665 | Ga0451849_0781224 | 3300041505 | Unclassified | 599 |
| 666 | Ga0451853_2221785 | 3300041512 | Unclassified | 530 |
| 667 | Ga0439431_0048789 | 3300041997 | Unclassified | 1094 |
| 668 | Ga0439431_0139511 | 3300041997 | Unclassified | 684 |
| 669 | Ga0439433_0021549 | 3300041999 | Bacteria | 1442 |
| 670 | Ga0439445_0096585 | 3300042004 | Bacteria | 836 |
| 671 | Ga0439449_0098692 | 3300042007 | Unclassified | 1079 |
| 672 | Ga0439450_059821 | 3300042008 | Archaea | 919 |
| 673 | Ga0439454_092704 | 3300042011 | Unclassified | 560 |
| 674 | Ga0439455_0175258 | 3300042012 | Bacteria | 617 |
| 675 | Ga0439462_0004588 | 3300042015 | Bacteria | 3381 |
| 676 | Ga0439463_078155 | 3300042016 | Unclassified | 850 |
| 677 | Ga0450920_053379 | 3300042122 | Bacteria | 812 |
| 678 | Ga0450898_154336 | 3300042134 | Bacteria | 504 |
| 679 | Ga0450906_035143 | 3300042145 | Bacteria | 885 |
| 680 | Ga0450907_003036 | 3300042146 | Bacteria | 3055 |
| 681 | Ga0439446_0041446 | 3300042156 | Bacteria | 1357 |
| 682 | Ga0439435_0043386 | 3300042436 | Unclassified | 1265 |
| 683 | Ga0439435_0370315 | 3300042436 | Bacteria | 500 |
| 684 | Ga0450916_090013 | 3300042530 | Unclassified | 533 |
| 685 | Ga0450918_067960 | 3300042531 | Bacteria | 666 |
| 686 | Ga0450918_117423 | 3300042531 | Bacteria | 530 |
| 687 | Ga0439440_0166296 | 3300042993 | Bacteria | 639 |
| 688 | Ga0466963_0007102 | 3300044694 | Bacteria | 6671 |
| 689 | Ga0466964_0045668 | 3300044706 | Bacteria | 1783 |
| 690 | Ga0466967_0030922 | 3300045976 | Bacteria | 4499 |
| 691 | Ga0466967_0054799 | 3300045976 | Bacteria | 3511 |
| 692 | Ga0466967_0185904 | 3300045976 | Bacteria | 1962 |
| 693 | Ga0466967_0366793 | 3300045976 | Bacteria | 1396 |
| 694 | Ga0466967_1723754 | 3300045976 | Unclassified | 624 |
| 695 | Ga0495584_0188589 | 3300046491 | Bacteria | 1048 |
| 696 | Ga0495584_0713865 | 3300046491 | Bacteria | 511 |
| 697 | Ga0495656_0376622 | 3300046615 | Bacteria | 739 |
| 698 | Ga0495659_0462418 | 3300046664 | Viruses | 553 |
| 699 | Ga0495588_0333495 | 3300046674 | Bacteria | 798 |
| 700 | Ga0495649_0299434 | 3300046694 | Unclassified | 819 |
| 701 | Ga0495581_0341787 | 3300047315 | Bacteria | 874 |
| 702 | Ga0496100_0045745 | 3300048903 | Bacteria | 2810 |
| 703 | Ga0496100_0423550 | 3300048903 | Unclassified | 1017 |
| 704 | Ga0496100_0656406 | 3300048903 | Bacteria | 817 |
| 705 | Ga0496100_1531304 | 3300048903 | Unclassified | 527 |
| 706 | Ga0496101_0025365 | 3300048904 | Bacteria | 4113 |
| 707 | Ga0496101_0038271 | 3300048904 | Bacteria | 3406 |
| 708 | Ga0496101_1461375 | 3300048904 | Unclassified | 533 |
| 709 | Ga0496101_1590123 | 3300048904 | Bacteria | 508 |
| 710 | Ga0496102_0019916 | 3300048905 | Bacteria | 5917 |
| 711 | Ga0496102_0141661 | 3300048905 | Bacteria | 2255 |
| 712 | Ga0496102_0165526 | 3300048905 | Unclassified | 2081 |
| 713 | Ga0496102_0552542 | 3300048905 | Unclassified | 1074 |
| 714 | Ga0496102_1585797 | 3300048905 | Bacteria | 573 |
| 715 | Ga0496103_0047469 | 3300048906 | Bacteria | 2654 |
| 716 | Ga0496103_0054239 | 3300048906 | Bacteria | 2485 |
| 717 | Ga0496103_0343613 | 3300048906 | Bacteria | 960 |
| 718 | Ga0496104_0135316 | 3300048907 | Bacteria | 2367 |
| 719 | Ga0496105_0035991 | 3300048908 | Bacteria | 4076 |
| 720 | Ga0496105_0048768 | 3300048908 | Bacteria | 3495 |
| 721 | Ga0496105_0563176 | 3300048908 | Bacteria | 888 |
| 722 | Ga0496106_0017853 | 3300048909 | Bacteria | 5246 |
| 723 | Ga0496106_0031742 | 3300048909 | Bacteria | 3936 |
| 724 | Ga0496106_0713033 | 3300048909 | Bacteria | 799 |
| 725 | Ga0496106_1194923 | 3300048909 | Unclassified | 593 |
| 726 | Ga0496106_1434130 | 3300048909 | Bacteria | 533 |
| 727 | Ga0496107_0021077 | 3300048910 | Bacteria | 4605 |
| 728 | Ga0496107_0083658 | 3300048910 | Bacteria | 2327 |
| 729 | Ga0496107_0286157 | 3300048910 | Unclassified | 1227 |
| 730 | Ga0496108_0035867 | 3300048911 | Bacteria | 4124 |
| 731 | Ga0496108_0051537 | 3300048911 | Bacteria | 3448 |
| 732 | Ga0496108_0286817 | 3300048911 | Unclassified | 1433 |
| 733 | Ga0496109_0034539 | 3300048912 | Bacteria | 4556 |
| 734 | Ga0496109_0084951 | 3300048912 | Unclassified | 2921 |
| 735 | Ga0496109_0331691 | 3300048912 | Bacteria | 1436 |
| 736 | Ga0496110_0045052 | 3300048913 | Bacteria | 3853 |
| 737 | Ga0496110_0070098 | 3300048913 | Bacteria | 3105 |
| 738 | Ga0496110_0464844 | 3300048913 | Bacteria | 1153 |
| 739 | Ga0496110_0868620 | 3300048913 | Bacteria | 807 |
| 740 | Ga0496111_0008744 | 3300048914 | Bacteria | 6721 |
| 741 | Ga0496111_0017607 | 3300048914 | Bacteria | 4940 |
| 742 | Ga0496111_0023055 | 3300048914 | Bacteria | 4366 |
| 743 | Ga0496111_0296524 | 3300048914 | Bacteria | 1199 |
| 744 | Ga0496111_1268839 | 3300048914 | Bacteria | 520 |
| 745 | Ga0496112_0535290 | 3300048915 | Bacteria | 1106 |
| 746 | Ga0496113_0018473 | 3300048916 | Bacteria | 4857 |
| 747 | Ga0496113_0143759 | 3300048916 | Bacteria | 1878 |
| 748 | Ga0496114_0006536 | 3300048917 | Bacteria | 9186 |
| 749 | Ga0496114_0021606 | 3300048917 | Bacteria | 5237 |
| 750 | Ga0496114_0048296 | 3300048917 | Unclassified | 3540 |
| 751 | Ga0496114_0183742 | 3300048917 | Unclassified | 1827 |
| 752 | Ga0496114_0295273 | 3300048917 | Bacteria | 1430 |
| 753 | Ga0496115_0010987 | 3300048918 | Bacteria | 6778 |
| 754 | Ga0496115_0803849 | 3300048918 | Bacteria | 732 |
| 755 | Ga0501031_0000628 | 3300049568 | Bacteria | 20865 |
| 756 | Ga0501031_0008032 | 3300049568 | Bacteria | 6870 |
| 757 | Ga0501031_0025953 | 3300049568 | Bacteria | 3822 |
| 758 | Ga0501031_0030183 | 3300049568 | Bacteria | 3535 |
| 759 | Ga0501031_0240615 | 3300049568 | Bacteria | 1177 |
| 760 | Ga0501032_0021813 | 3300049569 | Bacteria | 4448 |
| 761 | Ga0501032_0027034 | 3300049569 | Bacteria | 3944 |
| 762 | Ga0501032_0048974 | 3300049569 | Bacteria | 2852 |
| 763 | Ga0501032_0052793 | 3300049569 | Bacteria | 2739 |
| 764 | Ga0501033_0010372 | 3300049570 | Bacteria | 7147 |
| 765 | Ga0501033_0039778 | 3300049570 | Bacteria | 3512 |
| 766 | Ga0501033_0084755 | 3300049570 | Bacteria | 2322 |
| 767 | Ga0501033_0171652 | 3300049570 | Bacteria | 1557 |
| 768 | Ga0501033_0552822 | 3300049570 | Bacteria | 793 |
| 769 | Ga0501033_0954342 | 3300049570 | Unclassified | 575 |
| 770 | Ga0501034_0136518 | 3300049571 | Bacteria | 2434 |
| 771 | Ga0501034_0714999 | 3300049571 | Unclassified | 899 |
| 772 | Ga0501036_0000812 | 3300049572 | Bacteria | 23195 |
| 773 | Ga0501036_0008588 | 3300049572 | Bacteria | 8379 |
| 774 | Ga0501036_0013667 | 3300049572 | Bacteria | 6749 |
| 775 | Ga0501036_0039539 | 3300049572 | Bacteria | 3991 |
| 776 | Ga0501036_0044446 | 3300049572 | Bacteria | 3762 |
| 777 | Ga0501036_0201410 | 3300049572 | Bacteria | 1674 |
| 778 | Ga0501036_0492246 | 3300049572 | Unclassified | 1020 |
| 779 | Ga0501036_0495590 | 3300049572 | Bacteria | 1017 |
| 780 | Ga0501036_0575256 | 3300049572 | Bacteria | 935 |
| 781 | Ga0501036_0848264 | 3300049572 | Bacteria | 751 |
| 782 | Ga0501036_1194512 | 3300049572 | Bacteria | 620 |
| 783 | Ga0501037_0011722 | 3300049573 | Bacteria | 6454 |
| 784 | Ga0501037_0015086 | 3300049573 | Bacteria | 5683 |
| 785 | Ga0501037_0077612 | 3300049573 | Bacteria | 2410 |
| 786 | Ga0501037_0651317 | 3300049573 | Bacteria | 704 |
| 787 | Ga0501037_1010942 | 3300049573 | Bacteria | 541 |
| 788 | Ga0501037_1100390 | 3300049573 | Unclassified | 515 |
| 789 | Ga0501038_0068752 | 3300049574 | Bacteria | 3011 |
| 790 | Ga0501038_0092417 | 3300049574 | Bacteria | 2533 |
| 791 | Ga0501038_0119581 | 3300049574 | Bacteria | 2174 |
| 792 | Ga0501038_0147318 | 3300049574 | Bacteria | 1921 |
| 793 | Ga0501038_0161531 | 3300049574 | Bacteria | 1820 |
| 794 | Ga0501038_0170301 | 3300049574 | Bacteria | 1763 |
| 795 | Ga0501038_0203195 | 3300049574 | Bacteria | 1589 |
| 796 | Ga0501038_0510165 | 3300049574 | Unclassified | 919 |
| 797 | Ga0501038_0567234 | 3300049574 | Bacteria | 862 |
| 798 | Ga0501038_1303786 | 3300049574 | Bacteria | 524 |
| 799 | Ga0501039_0001256 | 3300049575 | Bacteria | 18532 |
| 800 | Ga0501039_0027322 | 3300049575 | Bacteria | 4388 |
| 801 | Ga0501039_0091909 | 3300049575 | Bacteria | 2365 |
| 802 | Ga0501039_0105273 | 3300049575 | Bacteria | 2203 |
| 803 | Ga0501039_0148989 | 3300049575 | Bacteria | 1838 |
| 804 | Ga0501039_0154996 | 3300049575 | Bacteria | 1799 |
| 805 | Ga0501039_0241933 | 3300049575 | Unclassified | 1419 |
| 806 | Ga0501039_0356272 | 3300049575 | Unclassified | 1149 |
| 807 | Ga0501039_0620700 | 3300049575 | Bacteria | 847 |
| 808 | Ga0501039_0623227 | 3300049575 | Bacteria | 845 |
| 809 | Ga0501040_0004583 | 3300049576 | Bacteria | 8966 |
| 810 | Ga0501040_0026470 | 3300049576 | Bacteria | 3901 |
| 811 | Ga0501040_0087471 | 3300049576 | Bacteria | 2163 |
| 812 | Ga0501040_0100315 | 3300049576 | Bacteria | 2018 |
| 813 | Ga0501040_0197930 | 3300049576 | Bacteria | 1426 |
| 814 | Ga0501040_0631582 | 3300049576 | Bacteria | 774 |
| 815 | Ga0501040_0960209 | 3300049576 | Unclassified | 619 |
| 816 | Ga0501040_1138592 | 3300049576 | Bacteria | 566 |
| 817 | Ga0501041_0003684 | 3300049577 | Bacteria | 8808 |
| 818 | Ga0501041_0014075 | 3300049577 | Bacteria | 4747 |
| 819 | Ga0501041_0026519 | 3300049577 | Bacteria | 3486 |
| 820 | Ga0501041_0065808 | 3300049577 | Bacteria | 2220 |
| 821 | Ga0501041_0087671 | 3300049577 | Bacteria | 1921 |
| 822 | Ga0501041_0103034 | 3300049577 | Bacteria | 1767 |
| 823 | Ga0501041_0118325 | 3300049577 | Unclassified | 1646 |
| 824 | Ga0501041_0350942 | 3300049577 | Bacteria | 932 |
| 825 | Ga0501041_0598818 | 3300049577 | Bacteria | 703 |
| 826 | Ga0501042_0000147 | 3300049578 | Bacteria | 31455 |
| 827 | Ga0501042_0013484 | 3300049578 | Bacteria | 5564 |
| 828 | Ga0501042_0025146 | 3300049578 | Bacteria | 4181 |
| 829 | Ga0501042_0027502 | 3300049578 | Bacteria | 3999 |
| 830 | Ga0501042_0113230 | 3300049578 | Bacteria | 1953 |
| 831 | Ga0501042_0170045 | 3300049578 | Bacteria | 1572 |
| 832 | Ga0501042_0230264 | 3300049578 | Unclassified | 1337 |
| 833 | Ga0501042_0245216 | 3300049578 | Bacteria | 1293 |
| 834 | Ga0501042_0332816 | 3300049578 | Bacteria | 1097 |
| 835 | Ga0501042_1165933 | 3300049578 | Unclassified | 562 |
| 836 | Ga0501043_0026625 | 3300049579 | Bacteria | 4537 |
| 837 | Ga0501043_0081779 | 3300049579 | Bacteria | 2538 |
| 838 | Ga0501043_0334079 | 3300049579 | Unclassified | 1154 |
| 839 | Ga0501043_0541915 | 3300049579 | Bacteria | 865 |
| 840 | Ga0501043_0738763 | 3300049579 | Bacteria | 716 |
| 841 | Ga0501043_1121696 | 3300049579 | Bacteria | 555 |
| 842 | Ga0501046_0009845 | 3300049580 | Bacteria | 8237 |
| 843 | Ga0501046_0066165 | 3300049580 | Bacteria | 2817 |
| 844 | Ga0501046_0075095 | 3300049580 | Bacteria | 2621 |
| 845 | Ga0501046_0246854 | 3300049580 | Bacteria | 1315 |
| 846 | Ga0501046_0295736 | 3300049580 | Unclassified | 1183 |
| 847 | Ga0501046_0559655 | 3300049580 | Bacteria | 814 |
| 848 | Ga0501047_0082855 | 3300049581 | Bacteria | 3083 |
| 849 | Ga0501047_0549053 | 3300049581 | Bacteria | 980 |
| 850 | Ga0501048_0001203 | 3300049582 | Bacteria | 19590 |
| 851 | Ga0501048_0012158 | 3300049582 | Bacteria | 6413 |
| 852 | Ga0501048_0024597 | 3300049582 | Bacteria | 4395 |
| 853 | Ga0501048_0062628 | 3300049582 | Bacteria | 2632 |
| 854 | Ga0501048_0077336 | 3300049582 | Bacteria | 2348 |
| 855 | Ga0501048_0177750 | 3300049582 | Bacteria | 1508 |
| 856 | Ga0501048_0441683 | 3300049582 | Bacteria | 931 |
| 857 | Ga0501048_0443392 | 3300049582 | Bacteria | 929 |
| 858 | Ga0501048_0785450 | 3300049582 | Bacteria | 684 |
| 859 | Ga0501048_1298107 | 3300049582 | Bacteria | 523 |
| 860 | Ga0501067_0017123 | 3300049583 | Bacteria | 4004 |
| 861 | Ga0501067_0039274 | 3300049583 | Bacteria | 2628 |
| 862 | Ga0501067_0089183 | 3300049583 | Bacteria | 1711 |
| 863 | Ga0501067_0228883 | 3300049583 | Unclassified | 1035 |
| 864 | Ga0501067_0236018 | 3300049583 | Bacteria | 1018 |
| 865 | Ga0501067_0250672 | 3300049583 | Bacteria | 985 |
| 866 | Ga0501067_0553387 | 3300049583 | Bacteria | 644 |
| 867 | Ga0501068_0022664 | 3300049584 | Bacteria | 3674 |
| 868 | Ga0501068_0030547 | 3300049584 | Bacteria | 3196 |
| 869 | Ga0501068_0042836 | 3300049584 | Bacteria | 2722 |
| 870 | Ga0501068_0071606 | 3300049584 | Bacteria | 2116 |
| 871 | Ga0501068_0172061 | 3300049584 | Bacteria | 1367 |
| 872 | Ga0501068_0371684 | 3300049584 | Unclassified | 920 |
| 873 | Ga0501069_0001115 | 3300049585 | Bacteria | 12962 |
| 874 | Ga0501069_0005154 | 3300049585 | Bacteria | 6785 |
| 875 | Ga0501069_0011374 | 3300049585 | Bacteria | 4719 |
| 876 | Ga0501069_0024604 | 3300049585 | Bacteria | 3285 |
| 877 | Ga0501069_0604849 | 3300049585 | Bacteria | 658 |
| 878 | Ga0501069_0760067 | 3300049585 | Archaea | 586 |
| 879 | Ga0501070_0084634 | 3300049586 | Bacteria | 2625 |
| 880 | Ga0501070_0185255 | 3300049586 | Bacteria | 1712 |
| 881 | Ga0501070_0222062 | 3300049586 | Bacteria | 1549 |
| 882 | Ga0501070_0250639 | 3300049586 | Bacteria | 1448 |
| 883 | Ga0501070_0464901 | 3300049586 | Bacteria | 1019 |
| 884 | Ga0501071_0000047 | 3300049587 | Bacteria | 42225 |
| 885 | Ga0501071_0003972 | 3300049587 | Bacteria | 9330 |
| 886 | Ga0501071_0048083 | 3300049587 | Bacteria | 3066 |
| 887 | Ga0501071_0072205 | 3300049587 | Bacteria | 2517 |
| 888 | Ga0501071_0127993 | 3300049587 | Unclassified | 1886 |
| 889 | Ga0501071_0207478 | 3300049587 | Bacteria | 1473 |
| 890 | Ga0501071_0288035 | 3300049587 | Bacteria | 1243 |
| 891 | Ga0501071_0301963 | 3300049587 | Bacteria | 1214 |
| 892 | Ga0501071_0347443 | 3300049587 | Bacteria | 1128 |
| 893 | Ga0501071_0367933 | 3300049587 | Bacteria | 1095 |
| 894 | Ga0501071_0470457 | 3300049587 | Bacteria | 963 |
| 895 | Ga0501071_1100414 | 3300049587 | Bacteria | 614 |
| 896 | Ga0501071_1134200 | 3300049587 | Bacteria | 604 |
| 897 | Ga0501072_0005337 | 3300049588 | Bacteria | 9780 |
| 898 | Ga0501072_0007176 | 3300049588 | Bacteria | 8452 |
| 899 | Ga0501072_0036448 | 3300049588 | Bacteria | 3856 |
| 900 | Ga0501072_0116877 | 3300049588 | Bacteria | 2124 |
| 901 | Ga0501072_0129168 | 3300049588 | Bacteria | 2014 |
| 902 | Ga0501072_0159229 | 3300049588 | Bacteria | 1801 |
| 903 | Ga0501072_0161806 | 3300049588 | Unclassified | 1785 |
| 904 | Ga0501072_0203746 | 3300049588 | Bacteria | 1577 |
| 905 | Ga0501072_0244759 | 3300049588 | Bacteria | 1428 |
| 906 | Ga0501072_0250670 | 3300049588 | Bacteria | 1410 |
| 907 | Ga0501072_0337719 | 3300049588 | Bacteria | 1197 |
| 908 | Ga0501072_1170422 | 3300049588 | Bacteria | 598 |
| 909 | Ga0501073_0015162 | 3300049589 | Bacteria | 5591 |
| 910 | Ga0501073_0046061 | 3300049589 | Bacteria | 3069 |
| 911 | Ga0501073_0098653 | 3300049589 | Bacteria | 2028 |
| 912 | Ga0501073_0246005 | 3300049589 | Unclassified | 1235 |
| 913 | Ga0501073_0266021 | 3300049589 | Bacteria | 1183 |
| 914 | Ga0501073_0445776 | 3300049589 | Bacteria | 895 |
| 915 | Ga0501073_0491230 | 3300049589 | Bacteria | 849 |
| 916 | Ga0501074_0002330 | 3300049590 | Bacteria | 13214 |
| 917 | Ga0501074_0088901 | 3300049590 | Bacteria | 2212 |
| 918 | Ga0501074_0111833 | 3300049590 | Bacteria | 1954 |
| 919 | Ga0501074_0242244 | 3300049590 | Unclassified | 1282 |
| 920 | Ga0501074_0269553 | 3300049590 | Bacteria | 1210 |
| 921 | Ga0501074_0330249 | 3300049590 | Bacteria | 1082 |
| 922 | Ga0501074_0352501 | 3300049590 | Unclassified | 1044 |
| 923 | Ga0501074_0482649 | 3300049590 | Unclassified | 878 |
| 924 | Ga0501074_0587897 | 3300049590 | Bacteria | 787 |
| 925 | Ga0501074_1090968 | 3300049590 | Bacteria | 561 |
| 926 | Ga0501075_0000079 | 3300049591 | Bacteria | 43500 |
| 927 | Ga0501075_0022784 | 3300049591 | Bacteria | 4579 |
| 928 | Ga0501075_0039892 | 3300049591 | Bacteria | 3515 |
| 929 | Ga0501075_0051207 | 3300049591 | Bacteria | 3104 |
| 930 | Ga0501075_0061201 | 3300049591 | Bacteria | 2836 |
| 931 | Ga0501075_0201223 | 3300049591 | Unclassified | 1519 |
| 932 | Ga0501075_0220812 | 3300049591 | Bacteria | 1446 |
| 933 | Ga0501075_0310962 | 3300049591 | Unclassified | 1201 |
| 934 | Ga0501075_0316855 | 3300049591 | Bacteria | 1189 |
| 935 | Ga0501075_0347914 | 3300049591 | Unclassified | 1129 |
| 936 | Ga0501075_0445439 | 3300049591 | Unclassified | 987 |
| 937 | Ga0501075_0544007 | 3300049591 | Bacteria | 886 |
| 938 | Ga0501075_1430735 | 3300049591 | Bacteria | 523 |
| 939 | Ga0501076_0020207 | 3300049592 | Bacteria | 5096 |
| 940 | Ga0501076_0025447 | 3300049592 | Bacteria | 4579 |
| 941 | Ga0501076_0045344 | 3300049592 | Bacteria | 3471 |
| 942 | Ga0501076_0048998 | 3300049592 | Bacteria | 3339 |
| 943 | Ga0501076_0056095 | 3300049592 | Bacteria | 3125 |
| 944 | Ga0501076_0071070 | 3300049592 | Bacteria | 2784 |
| 945 | Ga0501076_0084118 | 3300049592 | Bacteria | 2555 |
| 946 | Ga0501076_0089383 | 3300049592 | Bacteria | 2476 |
| 947 | Ga0501076_0136617 | 3300049592 | Bacteria | 1990 |
| 948 | Ga0501076_0272929 | 3300049592 | Bacteria | 1385 |
| 949 | Ga0501076_0528236 | 3300049592 | Unclassified | 973 |
| 950 | Ga0501076_0575936 | 3300049592 | Unclassified | 928 |
| 951 | Ga0501076_0692582 | 3300049592 | Bacteria | 841 |
| 952 | Ga0501076_0928123 | 3300049592 | Bacteria | 717 |
| 953 | Ga0501076_1814360 | 3300049592 | Bacteria | 500 |
| 954 | Ga0501077_0002534 | 3300049593 | Bacteria | 10948 |
| 955 | Ga0501077_0004906 | 3300049593 | Bacteria | 8121 |
| 956 | Ga0501077_0007994 | 3300049593 | Bacteria | 6536 |
| 957 | Ga0501077_0037902 | 3300049593 | Bacteria | 3069 |
| 958 | Ga0501077_0040757 | 3300049593 | Bacteria | 2957 |
| 959 | Ga0501077_0526013 | 3300049593 | Unclassified | 759 |
| 960 | Ga0501077_0642820 | 3300049593 | Bacteria | 682 |
| 961 | Ga0501077_0912883 | 3300049593 | Unclassified | 565 |
| 962 | Ga0501079_0012883 | 3300049741 | Bacteria | 6382 |
| 963 | Ga0501079_0043429 | 3300049741 | Bacteria | 3469 |
| 964 | Ga0501079_0081732 | 3300049741 | Bacteria | 2498 |
| 965 | Ga0501079_0170385 | 3300049741 | Bacteria | 1697 |
| 966 | Ga0501079_0192003 | 3300049741 | Bacteria | 1594 |
| 967 | Ga0501079_0229768 | 3300049741 | Bacteria | 1449 |
| 968 | Ga0501079_0273037 | 3300049741 | Bacteria | 1322 |
| 969 | Ga0501079_0341710 | 3300049741 | Bacteria | 1173 |
| 970 | Ga0501079_1175411 | 3300049741 | Bacteria | 604 |
| 971 | Ga0501080_0008633 | 3300049742 | Bacteria | 9246 |
| 972 | Ga0501080_0053015 | 3300049742 | Bacteria | 3776 |
| 973 | Ga0501080_0069831 | 3300049742 | Bacteria | 3267 |
| 974 | Ga0501080_0099897 | 3300049742 | Bacteria | 2692 |
| 975 | Ga0501080_0125366 | 3300049742 | Bacteria | 2379 |
| 976 | Ga0501080_0196662 | 3300049742 | Unclassified | 1852 |
| 977 | Ga0501080_1160780 | 3300049742 | Bacteria | 665 |
| 978 | Ga0501080_1803952 | 3300049742 | Unclassified | 514 |
| 979 | Ga0501081_0001935 | 3300049743 | Bacteria | 12869 |
| 980 | Ga0501081_0002356 | 3300049743 | Bacteria | 11895 |
| 981 | Ga0501081_0059171 | 3300049743 | Bacteria | 2652 |
| 982 | Ga0501081_0079155 | 3300049743 | Bacteria | 2298 |
| 983 | Ga0501081_0080075 | 3300049743 | Bacteria | 2285 |
| 984 | Ga0501081_0121895 | 3300049743 | Bacteria | 1858 |
| 985 | Ga0501081_0182676 | 3300049743 | Bacteria | 1517 |
| 986 | Ga0501081_0235816 | 3300049743 | Bacteria | 1333 |
| 987 | Ga0501081_0421206 | 3300049743 | Bacteria | 990 |
| 988 | Ga0501081_1267623 | 3300049743 | Archaea | 559 |
| 989 | Ga0501083_0010147 | 3300049744 | Bacteria | 6636 |
| 990 | Ga0501083_0164307 | 3300049744 | Unclassified | 1451 |
| 991 | Ga0501083_0325700 | 3300049744 | Unclassified | 999 |
| 992 | Ga0501083_0476694 | 3300049744 | Bacteria | 812 |
| 993 | Ga0501035_0117664 | 3300049822 | Bacteria | 2325 |
| 994 | Ga0501035_0128176 | 3300049822 | Bacteria | 2214 |
| 995 | Ga0501035_0129006 | 3300049822 | Bacteria | 2205 |
| 996 | Ga0501035_0169383 | 3300049822 | Bacteria | 1887 |
| 997 | Ga0501035_0571699 | 3300049822 | Unclassified | 924 |
| 998 | Ga0501035_0995086 | 3300049822 | Bacteria | 660 |
| 999 | Ga0501035_1516330 | 3300049822 | Unclassified | 511 |
| 1000 | Ga0501044_0097347 | 3300049823 | Bacteria | 2964 |
| 1001 | Ga0501044_0107146 | 3300049823 | Bacteria | 2806 |
| 1002 | Ga0501044_0239384 | 3300049823 | Bacteria | 1759 |
| 1003 | Ga0501044_0588359 | 3300049823 | Bacteria | 1007 |
| 1004 | Ga0501044_0945492 | 3300049823 | Unclassified | 735 |
| 1005 | Ga0501045_0000967 | 3300049824 | Bacteria | 18795 |
| 1006 | Ga0501045_0007845 | 3300049824 | Bacteria | 7427 |
| 1007 | Ga0501045_0028388 | 3300049824 | Bacteria | 4036 |
| 1008 | Ga0501045_0165382 | 3300049824 | Bacteria | 1647 |
| 1009 | Ga0501045_0189574 | 3300049824 | Bacteria | 1532 |
| 1010 | Ga0501045_0246561 | 3300049824 | Bacteria | 1330 |
| 1011 | Ga0501045_0333605 | 3300049824 | Bacteria | 1128 |
| 1012 | Ga0501045_0466980 | 3300049824 | Bacteria | 938 |
| 1013 | Ga0501045_0502991 | 3300049824 | Unclassified | 900 |
| 1014 | Ga0501045_0658173 | 3300049824 | Bacteria | 774 |
| 1015 | Ga0501045_1152955 | 3300049824 | Bacteria | 566 |
| 1016 | Ga0501045_1203158 | 3300049824 | Unclassified | 553 |
| 1017 | nmdc:mga05p37_1163417_c1 | 3300050507 | Bacteria | 801 |
| 1018 | nmdc:mga05p37_12914_c1 | 3300050507 | Bacteria | 9989 |
| 1019 | nmdc:mga05p37_189715_c1 | 3300050507 | Bacteria | 2496 |
| 1020 | nmdc:mga05p37_440517_c1 | 3300050507 | Bacteria | 1511 |
| 1021 | nmdc:mga05p37_570696_c1 | 3300050507 | Bacteria | 1283 |
| 1022 | nmdc:mga09592_105428_c1 | 3300050508 | Bacteria | 2417 |
| 1023 | nmdc:mga09592_376187_c1 | 3300050508 | Bacteria | 1228 |
| 1024 | nmdc:mga06r32_583803_c1 | 3300050510 | Bacteria | 1089 |
| 1025 | nmdc:mga08y16_1074261_c1 | 3300050511 | Unclassified | 781 |
| 1026 | nmdc:mga08y16_1077376_c1 | 3300050511 | Bacteria | 780 |
| 1027 | nmdc:mga08y16_201766_c1 | 3300050511 | Bacteria | 2061 |
| 1028 | nmdc:mga08y16_24599_c1 | 3300050511 | Bacteria | 6355 |
| 1029 | nmdc:mga08y16_256872_c2 | 3300050511 | Bacteria | 926 |
| 1030 | nmdc:mga0n895_336279_c1 | 3300050512 | Unclassified | 1530 |
| 1031 | nmdc:mga0rr50_273559_c1 | 3300050513 | Unclassified | 1408 |
| 1032 | nmdc:mga0a205_109261_c1 | 3300050515 | Bacteria | 2352 |
| 1033 | nmdc:mga0a205_1576986_c1 | 3300050515 | Bacteria | 505 |
| 1034 | nmdc:mga0a205_254669_c1 | 3300050515 | Bacteria | 1634 |
| 1035 | nmdc:mga0a205_347292_c1 | 3300050515 | Bacteria | 1351 |
| 1036 | Ga0495655_0150465 | 3300053083 | Bacteria | 731 |
| 1037 | Ga0501084_0000362 | 3300054114 | Bacteria | 34708 |
| 1038 | Ga0501084_0006930 | 3300054114 | Bacteria | 9332 |
| 1039 | Ga0501084_0013345 | 3300054114 | Bacteria | 6797 |
| 1040 | Ga0501084_0021022 | 3300054114 | Bacteria | 5444 |
| 1041 | Ga0501084_0087248 | 3300054114 | Bacteria | 2620 |
| 1042 | Ga0501084_0102635 | 3300054114 | Bacteria | 2402 |
| 1043 | Ga0501084_0139307 | 3300054114 | Bacteria | 2042 |
| 1044 | Ga0501084_0152503 | 3300054114 | Bacteria | 1948 |
| 1045 | Ga0501084_0192067 | 3300054114 | Unclassified | 1723 |
| 1046 | Ga0501084_0537710 | 3300054114 | Unclassified | 987 |
| 1047 | Ga0590071_005283 | 3300059421 | Bacteria | 3113 |
| 1048 | Ga0590074_032162 | 3300059423 | Bacteria | 929 |
| 1049 | Ga0590075_019485 | 3300059424 | Bacteria | 1684 |
| 1050 | Ga0590075_022336 | 3300059424 | Bacteria | 1583 |
| 1051 | Ga0590075_033820 | 3300059424 | Bacteria | 1299 |
| 1052 | Ga0590077_036449 | 3300059426 | Bacteria | 1085 |
| 1053 | Ga0501082_0002526 | 3300060353 | Bacteria | 16018 |
| 1054 | Ga0501082_0009168 | 3300060353 | Bacteria | 8534 |
| 1055 | Ga0501082_0057418 | 3300060353 | Bacteria | 3353 |
| 1056 | Ga0501082_0075329 | 3300060353 | Bacteria | 2907 |
| 1057 | Ga0501082_0160276 | 3300060353 | Bacteria | 1955 |
| 1058 | Ga0501082_0240216 | 3300060353 | Bacteria | 1576 |
| 1059 | Ga0501082_1044956 | 3300060353 | Bacteria | 714 |
| 1060 | Ga0501082_1285355 | 3300060353 | Bacteria | 639 |
| 1061 | Ga0530510_0006973 | 3300061734 | Bacteria | 7877 |
| 1062 | Ga0530510_0015968 | 3300061734 | Bacteria | 5307 |
| 1063 | Ga0530510_0048100 | 3300061734 | Bacteria | 3082 |
| 1064 | Ga0530510_0087285 | 3300061734 | Bacteria | 2273 |
| 1065 | Ga0530510_0101484 | 3300061734 | Bacteria | 2104 |
| 1066 | Ga0530510_0152139 | 3300061734 | Bacteria | 1709 |
| 1067 | Ga0530510_0198061 | 3300061734 | Bacteria | 1491 |
| 1068 | Ga0530510_0229339 | 3300061734 | Bacteria | 1381 |
| 1069 | Ga0530510_0245693 | 3300061734 | Bacteria | 1333 |
| 1070 | Ga0530510_0254947 | 3300061734 | Bacteria | 1307 |
| 1071 | Ga0530510_0290464 | 3300061734 | Bacteria | 1222 |
| 1072 | Ga0530510_0810715 | 3300061734 | Bacteria | 714 |
| 1073 | Ga0530510_0854505 | 3300061734 | Bacteria | 695 |
| 1074 | Ga0530510_0922827 | 3300061734 | Bacteria | 667 |
| 1075 | Ga0501067_0030375 | |||
| 1076 | Ga0070658_10086833 | |||
| 1077 | Ga0070658_10533517 | |||
| 1078 | Ga0070658_10802688 | |||
| 1079 | Ga0070658_10914885 | |||
| 1080 | Ga0070676_10792585 | |||
| 1081 | Ga0070683_100049689 | |||
| 1082 | Ga0070683_100117354 | |||
| 1083 | Ga0070683_100299275 | |||
| 1084 | Ga0070683_101062570 | |||
| 1085 | Ga0070683_102122879 | |||
| 1086 | Ga0070670_100121050 | |||
| 1087 | Ga0070670_100257384 | |||
| 1088 | Ga0070670_100805547 | |||
| 1089 | Ga0070677_10722496 | |||
| 1090 | Ga0068869_100149486 | |||
| 1091 | Ga0068869_100815153 | |||
| 1092 | Ga0068869_101261467 | |||
| 1093 | Ga0070666_10157180 | |||
| 1094 | Ga0070680_100018540 | |||
| 1095 | Ga0070680_100072322 | |||
| 1096 | Ga0070680_101051017 | |||
| 1097 | Ga0070682_100029320 | |||
| 1098 | Ga0070682_100111676 | |||
| 1099 | Ga0070682_100200674 | |||
| 1100 | Ga0070682_100265707 | |||
| 1101 | Ga0070682_100300470 | |||
| 1102 | Ga0070682_100635289 | |||
| 1103 | Ga0068868_100074981 | |||
| 1104 | Ga0068868_100132822 | |||
| 1105 | Ga0068868_100134574 | |||
| 1106 | Ga0068868_100361093 | |||
| 1107 | Ga0070660_100000633 | |||
| 1108 | Ga0070660_100021968 | |||
| 1109 | Ga0070660_100154204 | |||
| 1110 | Ga0070660_100188360 | |||
| 1111 | Ga0070660_100476574 | |||
| 1112 | Ga0070660_101310834 | |||
| 1113 | Ga0070689_100027744 | |||
| 1114 | Ga0070689_100055360 | |||
| 1115 | Ga0070691_10190904 | |||
| 1116 | Ga0070691_10677819 | |||
| 1117 | Ga0070687_100133781 | |||
| 1118 | Ga0070661_100016213 | |||
| 1119 | Ga0070661_100039051 | |||
| 1120 | Ga0070661_100584573 | |||
| 1121 | Ga0070661_100663101 | |||
| 1122 | Ga0070661_100791387 | |||
| 1123 | Ga0070661_101163214 | |||
| 1124 | Ga0070692_10002758 | |||
| 1125 | Ga0070692_10235194 | |||
| 1126 | Ga0070692_10393801 | |||
| 1127 | Ga0070668_100081789 | |||
| 1128 | Ga0070668_101378021 | |||
| 1129 | Ga0070669_100272160 | |||
| 1130 | Ga0070669_100793312 | |||
| 1131 | Ga0070675_100009177 | |||
| 1132 | Ga0070675_100039981 | |||
| 1133 | Ga0070675_100503610 | |||
| 1134 | Ga0070675_100711602 | |||
| 1135 | Ga0070675_101954622 | |||
| 1136 | Ga0070671_100095733 | |||
| 1137 | Ga0070671_100125150 | |||
| 1138 | Ga0070671_100794346 | |||
| 1139 | Ga0070671_101260512 | |||
| 1140 | Ga0070671_101270308 | |||
| 1141 | Ga0070674_100007213 | |||
| 1142 | Ga0070674_100163114 | |||
| 1143 | Ga0070674_100495528 | |||
| 1144 | Ga0070673_100019858 | |||
| 1145 | Ga0070673_100036452 | |||
| 1146 | Ga0070673_100804132 | |||
| 1147 | Ga0070673_101249799 | |||
| 1148 | Ga0070673_101596514 | |||
| 1149 | Ga0070673_102046133 | |||
| 1150 | Ga0070688_100002575 | |||
| 1151 | Ga0070688_100006031 | |||
| 1152 | Ga0070688_100617943 | |||
| 1153 | Ga0070659_100004465 | |||
| 1154 | Ga0070659_100018645 | |||
| 1155 | Ga0070659_100033431 | |||
| 1156 | Ga0070659_100494019 | |||
| 1157 | Ga0070659_100564431 | |||
| 1158 | Ga0070659_100638604 | |||
| 1159 | Ga0070659_100787089 | |||
| 1160 | Ga0070659_100930586 | |||
| 1161 | Ga0070659_100950557 | |||
| 1162 | Ga0070667_100088116 | |||
| 1163 | Ga0070667_100683427 | |||
| 1164 | Ga0070667_100735942 | |||
| 1165 | Ga0070703_10021633 | |||
| 1166 | Ga0070703_10312121 | |||
| 1167 | Ga0070709_11360427 | |||
| 1168 | Ga0070714_100909282 | |||
| 1169 | Ga0070714_101228910 | |||
| 1170 | Ga0070710_10289824 | |||
| 1171 | Ga0070701_10015521 | |||
| 1172 | Ga0070701_10601297 | |||
| 1173 | Ga0070711_100936001 | |||
| 1174 | Ga0070705_100293521 | |||
| 1175 | Ga0070705_100939885 | |||
| 1176 | Ga0070700_100041073 | |||
| 1177 | Ga0070700_101762555 | |||
| 1178 | Ga0070694_100564523 | |||
| 1179 | Ga0070694_100655177 | |||
| 1180 | Ga0070708_100562014 | |||
| 1181 | Ga0070663_100362622 | |||
| 1182 | Ga0070678_100080679 | |||
| 1183 | Ga0070678_100467415 | |||
| 1184 | Ga0070678_100476634 | |||
| 1185 | Ga0070678_100486812 | |||
| 1186 | Ga0070678_100636077 | |||
| 1187 | Ga0070678_101405572 | |||
| 1188 | Ga0070662_100026426 | |||
| 1189 | Ga0070662_100187537 | |||
| 1190 | Ga0070662_100311662 | |||
| 1191 | Ga0070662_100474000 | |||
| 1192 | Ga0070662_100834373 | |||
| 1193 | Ga0070662_101035804 | |||
| 1194 | Ga0070681_10013679 | |||
| 1195 | Ga0070681_10051781 | |||
| 1196 | Ga0070681_10052927 | |||
| 1197 | Ga0070681_10070972 | |||
| 1198 | Ga0070681_10790965 | |||
| 1199 | Ga0068867_100036199 | |||
| 1200 | Ga0068867_100801772 | |||
| 1201 | Ga0068867_101115103 | |||
| 1202 | Ga0070685_10007211 | |||
| 1203 | Ga0070685_10025361 | |||
| 1204 | Ga0070685_10384070 | |||
| 1205 | Ga0070706_100988656 | |||
| 1206 | Ga0070698_100043820 | |||
| 1207 | Ga0070698_101843244 | |||
| 1208 | Ga0070698_102200931 | |||
| 1209 | Ga0070699_100067520 | |||
| 1210 | Ga0070679_100006282 | |||
| 1211 | Ga0070679_100052895 | |||
| 1212 | Ga0070679_100562728 | |||
| 1213 | Ga0070679_100821108 | |||
| 1214 | Ga0070679_101058722 | |||
| 1215 | Ga0070679_101829318 | |||
| 1216 | Ga0070684_100008111 | |||
| 1217 | Ga0070684_100045881 | |||
| 1218 | Ga0070684_100072681 | |||
| 1219 | Ga0070684_100133362 | |||
| 1220 | Ga0070684_100708317 | |||
| 1221 | Ga0070684_101315577 | |||
| 1222 | Ga0070684_101471202 | |||
| 1223 | Ga0070684_101646980 | |||
| 1224 | Ga0068853_100011217 | |||
| 1225 | Ga0068853_100051377 | |||
| 1226 | Ga0068853_100190379 | |||
| 1227 | Ga0068853_100297165 | |||
| 1228 | Ga0068853_102493552 | |||
| 1229 | Ga0070672_100034033 | |||
| 1230 | Ga0070672_100132649 | |||
| 1231 | Ga0070686_100010484 | |||
| 1232 | Ga0070686_100046839 | |||
| 1233 | Ga0070696_100172967 | |||
| 1234 | Ga0070696_100193062 | |||
| 1235 | Ga0070696_100459180 | |||
| 1236 | Ga0070693_100685860 | |||
| 1237 | Ga0070665_100006229 | |||
| 1238 | Ga0070665_100025531 | |||
| 1239 | Ga0070665_100114296 | |||
| 1240 | Ga0070665_100523298 | |||
| 1241 | Ga0070704_100040027 | |||
| 1242 | Ga0070704_100530726 | |||
| 1243 | Ga0070704_101661162 | |||
| 1244 | Ga0070704_101838651 | |||
| 1245 | Ga0068855_100023380 | |||
| 1246 | Ga0068855_100104589 | |||
| 1247 | Ga0068855_100192032 | |||
| 1248 | Ga0068855_100442433 | |||
| 1249 | Ga0068855_100474251 | |||
| 1250 | Ga0068855_101946587 | |||
| 1251 | Ga0070664_100010134 | |||
| 1252 | Ga0070664_100017988 | |||
| 1253 | Ga0070664_100086943 | |||
| 1254 | Ga0070664_100332796 | |||
| 1255 | Ga0070664_100407164 | |||
| 1256 | Ga0068857_100033549 | |||
| 1257 | Ga0068857_100041363 | |||
| 1258 | Ga0068857_100211359 | |||
| 1259 | Ga0068857_100248312 | |||
| 1260 | Ga0068857_100806508 | |||
| 1261 | Ga0068857_101046682 | |||
| 1262 | Ga0068857_101660612 | |||
| 1263 | Ga0068857_101877655 | |||
| 1264 | Ga0068854_100002029 | |||
| 1265 | Ga0068854_100503885 | |||
| 1266 | Ga0068854_100654255 | |||
| 1267 | Ga0068854_101018438 | |||
| 1268 | Ga0068854_101515435 | |||
| 1269 | Ga0068854_101549583 | |||
| 1270 | Ga0068856_100430163 | |||
| 1271 | Ga0068856_100487967 | |||
| 1272 | Ga0068856_100621762 | |||
| 1273 | Ga0068856_100851577 | |||
| 1274 | Ga0070702_100111644 | |||
| 1275 | Ga0070702_100153874 | |||
| 1276 | Ga0068852_100048123 | |||
| 1277 | Ga0068852_100156046 | |||
| 1278 | Ga0068852_100170286 | |||
| 1279 | Ga0068852_100348754 | |||
| 1280 | Ga0068852_101237433 | |||
| 1281 | Ga0068859_100015815 | |||
| 1282 | Ga0068859_101724886 | |||
| 1283 | Ga0068864_100011033 | |||
| 1284 | Ga0068864_100332577 | |||
| 1285 | Ga0068864_102093684 | |||
| 1286 | Ga0068866_10004415 | |||
| 1287 | Ga0068866_10213278 | |||
| 1288 | Ga0068866_10240087 | |||
| 1289 | Ga0068866_10768385 | |||
| 1290 | Ga0068866_10927788 | |||
| 1291 | Ga0068861_100011331 | |||
| 1292 | Ga0068861_100577876 | |||
| 1293 | Ga0068861_101750244 | |||
| 1294 | Ga0068851_10132174 | |||
| 1295 | Ga0068851_10199361 | |||
| 1296 | Ga0068870_10001003 | |||
| 1297 | Ga0068870_10003881 | |||
| 1298 | Ga0068870_10008337 | |||
| 1299 | Ga0068870_10057630 | |||
| 1300 | Ga0068870_10082898 | |||
| 1301 | Ga0068863_100105864 | |||
| 1302 | Ga0068858_100007230 | |||
| 1303 | Ga0068860_100066714 | |||
| 1304 | Ga0068862_100028166 | |||
| 1305 | Ga0068862_100696459 | |||
| 1306 | Ga0068862_101014878 | |||
| 1307 | Ga0081455_10273227 | |||
| 1308 | Ga0081455_10663204 | |||
| 1309 | Ga0081455_10815365 | |||
| 1310 | Ga0081455_11009112 | |||
| 1311 | Ga0070717_10337186 | |||
| 1312 | Ga0075432_10021425 | |||
| 1313 | Ga0070712_100056702 | |||
| 1314 | Ga0097621_100017273 | |||
| 1315 | Ga0097621_100177324 | |||
| 1316 | Ga0097621_100461622 | |||
| 1317 | Ga0097621_102295504 | |||
| 1318 | Ga0068871_100043606 | |||
| 1319 | Ga0068871_100329559 | |||
| 1320 | Ga0068871_101683145 | |||
| 1321 | Ga0068871_101708911 | |||
| 1322 | Ga0075428_100146241 | |||
| 1323 | Ga0075430_100585373 | |||
| 1324 | Ga0075431_100053006 | |||
| 1325 | Ga0075431_100435488 | |||
| 1326 | Ga0075431_100877211 | |||
| 1327 | Ga0075433_10034678 | |||
| 1328 | Ga0075434_100439844 | |||
| 1329 | Ga0075434_101413828 | |||
| 1330 | Ga0075429_100102391 | |||
| 1331 | Ga0068865_100002899 | |||
| 1332 | Ga0068865_100084563 | |||
| 1333 | Ga0068865_100125464 | |||
| 1334 | Ga0068865_100322996 | |||
| 1335 | Ga0068865_100388447 | |||
| 1336 | Ga0068865_100483227 | |||
| 1337 | Ga0097620_100015816 | |||
| 1338 | Ga0097620_101724940 | |||
| 1339 | Ga0105244_10196835 | |||
| 1340 | Ga0105240_10448263 | |||
| 1341 | Ga0111539_10016235 | |||
| 1342 | Ga0111539_10030637 | |||
| 1343 | Ga0111539_10090436 | |||
| 1344 | Ga0111539_10226752 | |||
| 1345 | Ga0111539_10389818 | |||
| 1346 | Ga0111539_10465031 | |||
| 1347 | Ga0111539_10573128 | |||
| 1348 | Ga0111539_11963190 | |||
| 1349 | Ga0105245_10050595 | |||
| 1350 | Ga0105245_10294034 | |||
| 1351 | Ga0105245_10330032 | |||
| 1352 | Ga0105245_10453012 | |||
| 1353 | Ga0105245_10466339 | |||
| 1354 | Ga0105245_10601185 | |||
| 1355 | Ga0105245_10818093 | |||
| 1356 | Ga0105245_10835307 | |||
| 1357 | Ga0105245_11092135 | |||
| 1358 | Ga0105245_11912924 | |||
| 1359 | Ga0105245_13150569 | |||
| 1360 | Ga0105247_10011070 | |||
| 1361 | Ga0114129_10009207 | |||
| 1362 | Ga0114129_10063203 | |||
| 1363 | Ga0114129_10278651 | |||
| 1364 | Ga0114129_10617029 | |||
| 1365 | Ga0114129_10797797 | |||
| 1366 | Ga0114129_11367646 | |||
| 1367 | Ga0105243_10007846 | |||
| 1368 | Ga0105243_10061550 | |||
| 1369 | Ga0105243_10149023 | |||
| 1370 | Ga0105243_10234916 | |||
| 1371 | Ga0105243_10627272 | |||
| 1372 | Ga0105243_11389398 | |||
| 1373 | Ga0105241_10010013 | |||
| 1374 | Ga0105241_10099377 | |||
| 1375 | Ga0105241_10174286 | |||
| 1376 | Ga0105241_10403910 | |||
| 1377 | Ga0105241_11845107 | |||
| 1378 | Ga0105242_10048974 | |||
| 1379 | Ga0105242_10218143 | |||
| 1380 | Ga0105242_10226955 | |||
| 1381 | Ga0105242_10342147 | |||
| 1382 | Ga0105242_10435191 | |||
| 1383 | Ga0105242_11836557 | |||
| 1384 | Ga0105242_12344823 | |||
| 1385 | Ga0105248_10050536 | |||
| 1386 | Ga0105248_10497149 | |||
| 1387 | Ga0105248_12888562 | |||
| 1388 | Ga0105237_10174871 | |||
| 1389 | Ga0105237_10372604 | |||
| 1390 | Ga0105237_12466084 | |||
| 1391 | Ga0105238_10007268 | |||
| 1392 | Ga0105238_10048620 | |||
| 1393 | Ga0105238_10213991 | |||
| 1394 | Ga0105238_10345070 | |||
| 1395 | Ga0105238_10953130 | |||
| 1396 | Ga0105238_11891090 | |||
| 1397 | Ga0105238_13052158 | |||
| 1398 | Ga0105249_10642927 | |||
| 1399 | Ga0105239_10065565 | |||
| 1400 | Ga0105239_10152209 | |||
| 1401 | Ga0105239_10354671 | |||
| 1402 | Ga0105239_11827137 | |||
| 1403 | Ga0105239_11909657 | |||
| 1404 | Ga0105239_12157021 | |||
| 1405 | Ga0105239_13139960 | |||
| 1406 | Ga0105246_10103566 | |||
| 1407 | Ga0105246_10189919 | |||
| 1408 | Ga0105246_11426052 | |||
| 1409 | Ga0105246_11802636 | |||
| 1410 | Ga0157314_1013205 | |||
| 1411 | Ga0157347_1066986 | |||
| 1412 | Ga0157373_10046743 | |||
| 1413 | Ga0157373_10125310 | |||
| 1414 | Ga0157371_10008275 | |||
| 1415 | Ga0157371_10147925 | |||
| 1416 | Ga0157371_10183972 | |||
| 1417 | Ga0157371_10431856 | |||
| 1418 | Ga0157370_10028771 | |||
| 1419 | Ga0157370_10082477 | |||
| 1420 | Ga0157370_10232346 | |||
| 1421 | Ga0157369_10184273 | |||
| 1422 | Ga0157369_10213454 | |||
| 1423 | Ga0157369_10312884 | |||
| 1424 | Ga0157374_10140233 | |||
| 1425 | Ga0157374_10650362 | |||
| 1426 | Ga0157374_10850665 | |||
| 1427 | Ga0157374_10863396 | |||
| 1428 | Ga0157374_11453637 | |||
| 1429 | Ga0157374_11621919 | |||
| 1430 | Ga0157374_11654437 | |||
| 1431 | Ga0157378_10186973 | |||
| 1432 | Ga0157378_11117527 | |||
| 1433 | Ga0157378_12927604 | |||
| 1434 | Ga0163162_10524182 | |||
| 1435 | Ga0157372_10024231 | |||
| 1436 | Ga0157372_10063800 | |||
| 1437 | Ga0157372_10066412 | |||
| 1438 | Ga0157372_10133714 | |||
| 1439 | Ga0157372_10395222 | |||
| 1440 | Ga0157372_10833996 | |||
| 1441 | Ga0157372_10915202 | |||
| 1442 | Ga0157372_11010694 | |||
| 1443 | Ga0157375_10008715 | |||
| 1444 | Ga0157375_10039371 | |||
| 1445 | Ga0157375_10205090 | |||
| 1446 | Ga0163163_10097475 | |||
| 1447 | Ga0163163_10311006 | |||
| 1448 | Ga0163163_11491121 | |||
| 1449 | Ga0163163_12758276 | |||
| 1450 | Ga0157380_10030921 | |||
| 1451 | Ga0157380_10058951 | |||
| 1452 | Ga0157380_10633454 | |||
| 1453 | Ga0157380_11549824 | |||
| 1454 | Ga0157380_12905149 | |||
| 1455 | Ga0182008_10821719 | |||
| 1456 | Ga0157377_10013583 | |||
| 1457 | Ga0157377_10149549 | |||
| 1458 | Ga0157377_10648557 | |||
| 1459 | Ga0157377_11199121 | |||
| 1460 | Ga0157379_10036587 | |||
| 1461 | Ga0157379_11330168 | |||
| 1462 | Ga0157376_10021308 | |||
| 1463 | Ga0157376_11127277 | |||
| 1464 | Ga0163161_10019407 | |||
| 1465 | Ga0163161_10765798 | |||
| 1466 | Ga0206356_10074813 | |||
| 1467 | Ga0206356_11026427 | |||
| 1468 | Ga0206354_10520300 | |||
| 1469 | Ga0206354_10868705 | |||
| 1470 | Ga0206353_11653627 | |||
| 1471 | Ga0206353_11718206 | |||
| 1472 | Ga0207656_10191397 | |||
| 1473 | Ga0207656_10401854 | |||
| 1474 | Ga0207653_10007755 | |||
| 1475 | Ga0207682_10554894 | |||
| 1476 | Ga0207642_10023887 | |||
| 1477 | Ga0207642_10350240 | |||
| 1478 | Ga0207642_10736763 | |||
| 1479 | Ga0207642_10946210 | |||
| 1480 | Ga0207710_10062274 | |||
| 1481 | Ga0207688_10003380 | |||
| 1482 | Ga0207688_10011445 | |||
| 1483 | Ga0207688_10025323 | |||
| 1484 | Ga0207688_11005603 | |||
| 1485 | Ga0207680_10673735 | |||
| 1486 | Ga0207647_10190983 | |||
| 1487 | Ga0207645_10024812 | |||
| 1488 | Ga0207645_10391930 | |||
| 1489 | Ga0207645_10844533 | |||
| 1490 | Ga0207643_10004645 | |||
| 1491 | Ga0207643_10006379 | |||
| 1492 | Ga0207643_10007430 | |||
| 1493 | Ga0207643_10051829 | |||
| 1494 | Ga0207705_10295968 | |||
| 1495 | Ga0207684_10547595 | |||
| 1496 | Ga0207684_10974837 | |||
| 1497 | Ga0207684_11321966 | |||
| 1498 | Ga0207654_10463004 | |||
| 1499 | Ga0207707_10018617 | |||
| 1500 | Ga0207707_10022270 | |||
| 1501 | Ga0207707_10051099 | |||
| 1502 | Ga0207707_10173461 | |||
| 1503 | Ga0207707_10471082 | |||
| 1504 | Ga0207707_10634084 | |||
| 1505 | Ga0207695_11213011 | |||
| 1506 | Ga0207695_11406487 | |||
| 1507 | Ga0207671_10150027 | |||
| 1508 | Ga0207671_10270080 | |||
| 1509 | Ga0207693_10229625 | |||
| 1510 | Ga0207660_10047819 | |||
| 1511 | Ga0207660_10057473 | |||
| 1512 | Ga0207660_10181005 | |||
| 1513 | Ga0207660_10203646 | |||
| 1514 | Ga0207660_10261399 | |||
| 1515 | Ga0207660_10527447 | |||
| 1516 | Ga0207662_10139030 | |||
| 1517 | Ga0207657_10000275 | |||
| 1518 | Ga0207657_10001621 | |||
| 1519 | Ga0207657_10060290 | |||
| 1520 | Ga0207657_10101655 | |||
| 1521 | Ga0207657_10308213 | |||
| 1522 | Ga0207657_10967514 | |||
| 1523 | Ga0207649_10085816 | |||
| 1524 | Ga0207649_10144914 | |||
| 1525 | Ga0207649_10160865 | |||
| 1526 | Ga0207649_10980377 | |||
| 1527 | Ga0207649_11497305 | |||
| 1528 | Ga0207652_10040605 | |||
| 1529 | Ga0207652_10045550 | |||
| 1530 | Ga0207652_10080380 | |||
| 1531 | Ga0207652_10143537 | |||
| 1532 | Ga0207652_10183239 | |||
| 1533 | Ga0207652_10331184 | |||
| 1534 | Ga0207652_10350047 | |||
| 1535 | Ga0207652_10511367 | |||
| 1536 | Ga0207681_10018673 | |||
| 1537 | Ga0207694_10024324 | |||
| 1538 | Ga0207694_10119575 | |||
| 1539 | Ga0207694_10388741 | |||
| 1540 | Ga0207694_10494788 | |||
| 1541 | Ga0207650_10002681 | |||
| 1542 | Ga0207650_10010855 | |||
| 1543 | Ga0207650_10269163 | |||
| 1544 | Ga0207650_10463923 | |||
| 1545 | Ga0207650_10872902 | |||
| 1546 | Ga0207650_10874591 | |||
| 1547 | Ga0207659_10016197 | |||
| 1548 | Ga0207659_10026366 | |||
| 1549 | Ga0207659_10436276 | |||
| 1550 | Ga0207687_10006518 | |||
| 1551 | Ga0207687_10207530 | |||
| 1552 | Ga0207687_10402333 | |||
| 1553 | Ga0207687_10825863 | |||
| 1554 | Ga0207700_10715222 | |||
| 1555 | Ga0207664_10815720 | |||
| 1556 | Ga0207644_10021923 | |||
| 1557 | Ga0207644_10206249 | |||
| 1558 | Ga0207644_10524578 | |||
| 1559 | Ga0207690_10016947 | |||
| 1560 | Ga0207690_10037450 | |||
| 1561 | Ga0207690_10119313 | |||
| 1562 | Ga0207690_10289422 | |||
| 1563 | Ga0207690_10415258 | |||
| 1564 | Ga0207690_10432271 | |||
| 1565 | Ga0207690_10559654 | |||
| 1566 | Ga0207690_10636635 | |||
| 1567 | Ga0207690_11088221 | |||
| 1568 | Ga0207706_10021103 | |||
| 1569 | Ga0207706_10072559 | |||
| 1570 | Ga0207706_10598156 | |||
| 1571 | Ga0207706_10769325 | |||
| 1572 | Ga0207706_11000976 | |||
| 1573 | Ga0207686_10080616 | |||
| 1574 | Ga0207686_10289793 | |||
| 1575 | Ga0207686_10597087 | |||
| 1576 | Ga0207686_11040945 | |||
| 1577 | Ga0207709_10024013 | |||
| 1578 | Ga0207709_10106035 | |||
| 1579 | Ga0207709_10347824 | |||
| 1580 | Ga0207709_10579563 | |||
| 1581 | Ga0207709_11862627 | |||
| 1582 | Ga0207670_10009107 | |||
| 1583 | Ga0207670_10137607 | |||
| 1584 | Ga0207669_10013786 | |||
| 1585 | Ga0207669_10064407 | |||
| 1586 | Ga0207669_10126815 | |||
| 1587 | Ga0207669_10235747 | |||
| 1588 | Ga0207669_10449630 | |||
| 1589 | Ga0207669_10607739 | |||
| 1590 | Ga0207704_10068882 | |||
| 1591 | Ga0207704_10129335 | |||
| 1592 | Ga0207704_10140875 | |||
| 1593 | Ga0207704_11916031 | |||
| 1594 | Ga0207691_10007140 | |||
| 1595 | Ga0207691_10019534 | |||
| 1596 | Ga0207691_10023030 | |||
| 1597 | Ga0207691_10303925 | |||
| 1598 | Ga0207711_10162710 | |||
| 1599 | Ga0207711_10373772 | |||
| 1600 | Ga0207689_10134248 | |||
| 1601 | Ga0207689_10173199 | |||
| 1602 | Ga0207689_10224667 | |||
| 1603 | Ga0207689_11746224 | |||
| 1604 | Ga0207661_10075898 | |||
| 1605 | Ga0207661_10109403 | |||
| 1606 | Ga0207661_10115852 | |||
| 1607 | Ga0207661_10218836 | |||
| 1608 | Ga0207661_10410832 | |||
| 1609 | Ga0207661_10844511 | |||
| 1610 | Ga0207661_11104460 | |||
| 1611 | Ga0207661_11430705 | |||
| 1612 | Ga0207679_10173594 | |||
| 1613 | Ga0207679_10291775 | |||
| 1614 | Ga0207679_10431081 | |||
| 1615 | Ga0207679_10472424 | |||
| 1616 | Ga0207679_10867004 | |||
| 1617 | Ga0207667_10213750 | |||
| 1618 | Ga0207667_10250275 | |||
| 1619 | Ga0207667_10597373 | |||
| 1620 | Ga0207651_10043346 | |||
| 1621 | Ga0207651_10625429 | |||
| 1622 | Ga0207651_11261851 | |||
| 1623 | Ga0207651_11342628 | |||
| 1624 | Ga0207651_11431660 | |||
| 1625 | Ga0207712_11590884 | |||
| 1626 | Ga0207668_10031906 | |||
| 1627 | Ga0207668_10097404 | |||
| 1628 | Ga0207640_10365254 | |||
| 1629 | Ga0207640_10622732 | |||
| 1630 | Ga0207640_10818700 | |||
| 1631 | Ga0207640_11341945 | |||
| 1632 | Ga0207658_11332785 | |||
| 1633 | Ga0207677_10052484 | |||
| 1634 | Ga0207677_10057290 | |||
| 1635 | Ga0207677_10797824 | |||
| 1636 | Ga0207677_11022161 | |||
| 1637 | Ga0207677_11552835 | |||
| 1638 | Ga0207703_10063357 | |||
| 1639 | Ga0207703_11638631 | |||
| 1640 | Ga0207639_10099245 | |||
| 1641 | Ga0207639_10194878 | |||
| 1642 | Ga0207639_10225313 | |||
| 1643 | Ga0207639_10275307 | |||
| 1644 | Ga0207639_10384497 | |||
| 1645 | Ga0207678_10272869 | |||
| 1646 | Ga0207678_11138254 | |||
| 1647 | Ga0207708_10100160 | |||
| 1648 | Ga0207708_10638319 | |||
| 1649 | Ga0207708_11074376 | |||
| 1650 | Ga0207702_10258744 | |||
| 1651 | Ga0207702_10387636 | |||
| 1652 | Ga0207702_10873762 | |||
| 1653 | Ga0207702_11145106 | |||
| 1654 | Ga0207702_12253410 | |||
| 1655 | Ga0207641_10040480 | |||
| 1656 | Ga0207648_10009519 | |||
| 1657 | Ga0207648_10343550 | |||
| 1658 | Ga0207648_10419461 | |||
| 1659 | Ga0207648_10565715 | |||
| 1660 | Ga0207648_10802945 | |||
| 1661 | Ga0207648_11504329 | |||
| 1662 | Ga0207676_10007259 | |||
| 1663 | Ga0207676_10030356 | |||
| 1664 | Ga0207674_10019671 | |||
| 1665 | Ga0207674_10056109 | |||
| 1666 | Ga0207674_10085799 | |||
| 1667 | Ga0207674_10119249 | |||
| 1668 | Ga0207674_10548499 | |||
| 1669 | Ga0207674_10950108 | |||
| 1670 | Ga0207674_11270458 | |||
| 1671 | Ga0207674_11300532 | |||
| 1672 | Ga0207675_100021620 | |||
| 1673 | Ga0207675_100556557 | |||
| 1674 | Ga0207675_100569224 | |||
| 1675 | Ga0207675_100618666 | |||
| 1676 | Ga0207675_100770412 | |||
| 1677 | Ga0207683_10011999 | |||
| 1678 | Ga0207683_10031149 | |||
| 1679 | Ga0207683_10240423 | |||
| 1680 | Ga0207683_10484213 | |||
| 1681 | Ga0207683_10560909 | |||
| 1682 | Ga0207683_10846077 | |||
| 1683 | Ga0207698_10201288 | |||
| 1684 | Ga0207698_10210947 | |||
| 1685 | Ga0207698_10370653 | |||
| 1686 | Ga0207698_10561567 | |||
| 1687 | Ga0207698_12402593 | |||
| 1688 | Ga0207428_10040060 | |||
| 1689 | Ga0207428_10115678 | |||
| 1690 | Ga0207428_10391949 | |||
| 1691 | Ga0268266_10118932 | |||
| 1692 | Ga0268266_10181142 | |||
| 1693 | Ga0268265_10082405 | |||
| 1694 | Ga0268264_10015948 | |||
| 1695 | Ga0268264_12457686 | |||
| 1696 | Ga0307408_100447464 | |||
| 1697 | Ga0307405_10727433 | |||
| 1698 | Ga0307410_10409048 | |||
| 1699 | Ga0307406_10207248 | |||
| 1700 | Ga0307407_10190304 | |||
| 1701 | Ga0307412_11021556 | |||
| 1702 | Ga0307409_100005094 | |||
| 1703 | Ga0307409_100134133 | |||
| 1704 | Ga0307409_100396615 | |||
| 1705 | Ga0307416_100212267 | |||
| 1706 | Ga0307416_100249906 | |||
| 1707 | Ga0307416_100312190 | |||
| 1708 | Ga0307416_101405142 | |||
| 1709 | Ga0307416_101604404 | |||
| 1710 | Ga0307416_102350675 | |||
| 1711 | Ga0307411_12018462 | |||
| 1712 | Ga0307415_100367195 | |||
| 1713 | Ga0373930_0019466 | |||
| 1714 | Ga0373958_0021602 | |||
| 1715 | Ga0373928_0286815 | |||
| 1716 | Ga0373949_0058652 | |||
| 1717 | Ga0373952_0020770 | |||
| 1718 | Ga0373932_0064108 | |||
| 1719 | Ga0373939_0012144 | |||
| 1720 | Ga0373960_0004403 | |||
| 1721 | Ga0373942_0019234 | |||
| 1722 | Ga0373961_0075387 | |||
| 1723 | Ga0373962_0044781 | |||
| 1724 | Ga0373931_0046024 | |||
| 1725 | Ga0395899_0339329 | |||
| 1726 | Ga0395899_0497353 | |||
| 1727 | Ga0395900_0124006 | |||
| 1728 | Ga0395900_1059201 | |||
| 1729 | Ga0395900_1183543 | |||
| 1730 | Ga0395898_0634061 | |||
| 1731 | Ga0395905_0254193 | |||
| 1732 | Ga0395901_0031897 | |||
| 1733 | Ga0395901_0053859 | |||
| 1734 | Ga0395901_0766262 | |||
| 1735 | Ga0439438_123980 | |||
| 1736 | Ga0439439_0014769 | |||
| 1737 | Ga0439461_0020875 | |||
| 1738 | Ga0451807_0973115 | |||
| 1739 | Ga0451849_0781224 | |||
| 1740 | Ga0451853_2221785 | |||
| 1741 | Ga0439431_0048789 | |||
| 1742 | Ga0439431_0139511 | |||
| 1743 | Ga0439433_0021549 | |||
| 1744 | Ga0439445_0096585 | |||
| 1745 | Ga0439449_0098692 | |||
| 1746 | Ga0439450_059821 | |||
| 1747 | Ga0439454_092704 | |||
| 1748 | Ga0439455_0175258 | |||
| 1749 | Ga0439462_0004588 | |||
| 1750 | Ga0439463_078155 | |||
| 1751 | Ga0450920_053379 | |||
| 1752 | Ga0450898_154336 | |||
| 1753 | Ga0450906_035143 | |||
| 1754 | Ga0450907_003036 | |||
| 1755 | Ga0439446_0041446 | |||
| 1756 | Ga0439435_0043386 | |||
| 1757 | Ga0439435_0370315 | |||
| 1758 | Ga0450916_090013 | |||
| 1759 | Ga0450918_067960 | |||
| 1760 | Ga0450918_117423 | |||
| 1761 | Ga0439440_0166296 | |||
| 1762 | Ga0466963_0007102 | |||
| 1763 | Ga0466964_0045668 | |||
| 1764 | Ga0466967_0030922 | |||
| 1765 | Ga0466967_0054799 | |||
| 1766 | Ga0466967_0185904 | |||
| 1767 | Ga0466967_0366793 | |||
| 1768 | Ga0466967_1723754 | |||
| 1769 | Ga0495584_0188589 | |||
| 1770 | Ga0495584_0713865 | |||
| 1771 | Ga0495656_0376622 | |||
| 1772 | Ga0495659_0462418 | |||
| 1773 | Ga0495588_0333495 | |||
| 1774 | Ga0495649_0299434 | |||
| 1775 | Ga0495581_0341787 | |||
| 1776 | Ga0496100_0045745 | |||
| 1777 | Ga0496100_0423550 | |||
| 1778 | Ga0496100_0656406 | |||
| 1779 | Ga0496100_1531304 | |||
| 1780 | Ga0496101_0025365 | |||
| 1781 | Ga0496101_0038271 | |||
| 1782 | Ga0496101_1461375 | |||
| 1783 | Ga0496101_1590123 | |||
| 1784 | Ga0496102_0019916 | |||
| 1785 | Ga0496102_0141661 | |||
| 1786 | Ga0496102_0165526 | |||
| 1787 | Ga0496102_0552542 | |||
| 1788 | Ga0496102_1585797 | |||
| 1789 | Ga0496103_0047469 | |||
| 1790 | Ga0496103_0054239 | |||
| 1791 | Ga0496103_0343613 | |||
| 1792 | Ga0496104_0135316 | |||
| 1793 | Ga0496105_0035991 | |||
| 1794 | Ga0496105_0048768 | |||
| 1795 | Ga0496105_0563176 | |||
| 1796 | Ga0496106_0017853 | |||
| 1797 | Ga0496106_0031742 | |||
| 1798 | Ga0496106_0713033 | |||
| 1799 | Ga0496106_1194923 | |||
| 1800 | Ga0496106_1434130 | |||
| 1801 | Ga0496107_0021077 | |||
| 1802 | Ga0496107_0083658 | |||
| 1803 | Ga0496107_0286157 | |||
| 1804 | Ga0496108_0035867 | |||
| 1805 | Ga0496108_0051537 | |||
| 1806 | Ga0496108_0286817 | |||
| 1807 | Ga0496109_0034539 | |||
| 1808 | Ga0496109_0084951 | |||
| 1809 | Ga0496109_0331691 | |||
| 1810 | Ga0496110_0045052 | |||
| 1811 | Ga0496110_0070098 | |||
| 1812 | Ga0496110_0464844 | |||
| 1813 | Ga0496110_0868620 | |||
| 1814 | Ga0496111_0008744 | |||
| 1815 | Ga0496111_0017607 | |||
| 1816 | Ga0496111_0023055 | |||
| 1817 | Ga0496111_0296524 | |||
| 1818 | Ga0496111_1268839 | |||
| 1819 | Ga0496112_0535290 | |||
| 1820 | Ga0496113_0018473 | |||
| 1821 | Ga0496113_0143759 | |||
| 1822 | Ga0496114_0006536 | |||
| 1823 | Ga0496114_0021606 | |||
| 1824 | Ga0496114_0048296 | |||
| 1825 | Ga0496114_0183742 | |||
| 1826 | Ga0496114_0295273 | |||
| 1827 | Ga0496115_0010987 | |||
| 1828 | Ga0496115_0803849 | |||
| 1829 | Ga0501031_0000628 | |||
| 1830 | Ga0501031_0008032 | |||
| 1831 | Ga0501031_0025953 | |||
| 1832 | Ga0501031_0030183 | |||
| 1833 | Ga0501031_0240615 | |||
| 1834 | Ga0501032_0021813 | |||
| 1835 | Ga0501032_0027034 | |||
| 1836 | Ga0501032_0048974 | |||
| 1837 | Ga0501032_0052793 | |||
| 1838 | Ga0501033_0010372 | |||
| 1839 | Ga0501033_0039778 | |||
| 1840 | Ga0501033_0084755 | |||
| 1841 | Ga0501033_0171652 | |||
| 1842 | Ga0501033_0552822 | |||
| 1843 | Ga0501033_0954342 | |||
| 1844 | Ga0501034_0136518 | |||
| 1845 | Ga0501034_0714999 | |||
| 1846 | Ga0501036_0000812 | |||
| 1847 | Ga0501036_0008588 | |||
| 1848 | Ga0501036_0013667 | |||
| 1849 | Ga0501036_0039539 | |||
| 1850 | Ga0501036_0044446 | |||
| 1851 | Ga0501036_0201410 | |||
| 1852 | Ga0501036_0492246 | |||
| 1853 | Ga0501036_0495590 | |||
| 1854 | Ga0501036_0575256 | |||
| 1855 | Ga0501036_0848264 | |||
| 1856 | Ga0501036_1194512 | |||
| 1857 | Ga0501037_0011722 | |||
| 1858 | Ga0501037_0015086 | |||
| 1859 | Ga0501037_0077612 | |||
| 1860 | Ga0501037_0651317 | |||
| 1861 | Ga0501037_1010942 | |||
| 1862 | Ga0501037_1100390 | |||
| 1863 | Ga0501038_0068752 | |||
| 1864 | Ga0501038_0092417 | |||
| 1865 | Ga0501038_0119581 | |||
| 1866 | Ga0501038_0147318 | |||
| 1867 | Ga0501038_0161531 | |||
| 1868 | Ga0501038_0170301 | |||
| 1869 | Ga0501038_0203195 | |||
| 1870 | Ga0501038_0510165 | |||
| 1871 | Ga0501038_0567234 | |||
| 1872 | Ga0501038_1303786 | |||
| 1873 | Ga0501039_0001256 | |||
| 1874 | Ga0501039_0027322 | |||
| 1875 | Ga0501039_0091909 | |||
| 1876 | Ga0501039_0105273 | |||
| 1877 | Ga0501039_0148989 | |||
| 1878 | Ga0501039_0154996 | |||
| 1879 | Ga0501039_0241933 | |||
| 1880 | Ga0501039_0356272 | |||
| 1881 | Ga0501039_0620700 | |||
| 1882 | Ga0501039_0623227 | |||
| 1883 | Ga0501040_0004583 | |||
| 1884 | Ga0501040_0026470 | |||
| 1885 | Ga0501040_0087471 | |||
| 1886 | Ga0501040_0100315 | |||
| 1887 | Ga0501040_0197930 | |||
| 1888 | Ga0501040_0631582 | |||
| 1889 | Ga0501040_0960209 | |||
| 1890 | Ga0501040_1138592 | |||
| 1891 | Ga0501041_0003684 | |||
| 1892 | Ga0501041_0014075 | |||
| 1893 | Ga0501041_0026519 | |||
| 1894 | Ga0501041_0065808 | |||
| 1895 | Ga0501041_0087671 | |||
| 1896 | Ga0501041_0103034 | |||
| 1897 | Ga0501041_0118325 | |||
| 1898 | Ga0501041_0350942 | |||
| 1899 | Ga0501041_0598818 | |||
| 1900 | Ga0501042_0000147 | |||
| 1901 | Ga0501042_0013484 | |||
| 1902 | Ga0501042_0025146 | |||
| 1903 | Ga0501042_0027502 | |||
| 1904 | Ga0501042_0113230 | |||
| 1905 | Ga0501042_0170045 | |||
| 1906 | Ga0501042_0230264 | |||
| 1907 | Ga0501042_0245216 | |||
| 1908 | Ga0501042_0332816 | |||
| 1909 | Ga0501042_1165933 | |||
| 1910 | Ga0501043_0026625 | |||
| 1911 | Ga0501043_0081779 | |||
| 1912 | Ga0501043_0334079 | |||
| 1913 | Ga0501043_0541915 | |||
| 1914 | Ga0501043_0738763 | |||
| 1915 | Ga0501043_1121696 | |||
| 1916 | Ga0501046_0009845 | |||
| 1917 | Ga0501046_0066165 | |||
| 1918 | Ga0501046_0075095 | |||
| 1919 | Ga0501046_0246854 | |||
| 1920 | Ga0501046_0295736 | |||
| 1921 | Ga0501046_0559655 | |||
| 1922 | Ga0501047_0082855 | |||
| 1923 | Ga0501047_0549053 | |||
| 1924 | Ga0501048_0001203 | |||
| 1925 | Ga0501048_0012158 | |||
| 1926 | Ga0501048_0024597 | |||
| 1927 | Ga0501048_0062628 | |||
| 1928 | Ga0501048_0077336 | |||
| 1929 | Ga0501048_0177750 | |||
| 1930 | Ga0501048_0441683 | |||
| 1931 | Ga0501048_0443392 | |||
| 1932 | Ga0501048_0785450 | |||
| 1933 | Ga0501048_1298107 | |||
| 1934 | Ga0501067_0017123 | |||
| 1935 | Ga0501067_0039274 | |||
| 1936 | Ga0501067_0089183 | |||
| 1937 | Ga0501067_0228883 | |||
| 1938 | Ga0501067_0236018 | |||
| 1939 | Ga0501067_0250672 | |||
| 1940 | Ga0501067_0553387 | |||
| 1941 | Ga0501068_0022664 | |||
| 1942 | Ga0501068_0030547 | |||
| 1943 | Ga0501068_0042836 | |||
| 1944 | Ga0501068_0071606 | |||
| 1945 | Ga0501068_0172061 | |||
| 1946 | Ga0501068_0371684 | |||
| 1947 | Ga0501069_0001115 | |||
| 1948 | Ga0501069_0005154 | |||
| 1949 | Ga0501069_0011374 | |||
| 1950 | Ga0501069_0024604 | |||
| 1951 | Ga0501069_0604849 | |||
| 1952 | Ga0501069_0760067 | |||
| 1953 | Ga0501070_0084634 | |||
| 1954 | Ga0501070_0185255 | |||
| 1955 | Ga0501070_0222062 | |||
| 1956 | Ga0501070_0250639 | |||
| 1957 | Ga0501070_0464901 | |||
| 1958 | Ga0501071_0000047 | |||
| 1959 | Ga0501071_0003972 | |||
| 1960 | Ga0501071_0048083 | |||
| 1961 | Ga0501071_0072205 | |||
| 1962 | Ga0501071_0127993 | |||
| 1963 | Ga0501071_0207478 | |||
| 1964 | Ga0501071_0288035 | |||
| 1965 | Ga0501071_0301963 | |||
| 1966 | Ga0501071_0347443 | |||
| 1967 | Ga0501071_0367933 | |||
| 1968 | Ga0501071_0470457 | |||
| 1969 | Ga0501071_1100414 | |||
| 1970 | Ga0501071_1134200 | |||
| 1971 | Ga0501072_0005337 | |||
| 1972 | Ga0501072_0007176 | |||
| 1973 | Ga0501072_0036448 | |||
| 1974 | Ga0501072_0116877 | |||
| 1975 | Ga0501072_0129168 | |||
| 1976 | Ga0501072_0159229 | |||
| 1977 | Ga0501072_0161806 | |||
| 1978 | Ga0501072_0203746 | |||
| 1979 | Ga0501072_0244759 | |||
| 1980 | Ga0501072_0250670 | |||
| 1981 | Ga0501072_0337719 | |||
| 1982 | Ga0501072_1170422 | |||
| 1983 | Ga0501073_0015162 | |||
| 1984 | Ga0501073_0046061 | |||
| 1985 | Ga0501073_0098653 | |||
| 1986 | Ga0501073_0246005 | |||
| 1987 | Ga0501073_0266021 | |||
| 1988 | Ga0501073_0445776 | |||
| 1989 | Ga0501073_0491230 | |||
| 1990 | Ga0501074_0002330 | |||
| 1991 | Ga0501074_0088901 | |||
| 1992 | Ga0501074_0111833 | |||
| 1993 | Ga0501074_0242244 | |||
| 1994 | Ga0501074_0269553 | |||
| 1995 | Ga0501074_0330249 | |||
| 1996 | Ga0501074_0352501 | |||
| 1997 | Ga0501074_0482649 | |||
| 1998 | Ga0501074_0587897 | |||
| 1999 | Ga0501074_1090968 | |||
| 2000 | Ga0501075_0000079 | |||
| 2001 | Ga0501075_0022784 | |||
| 2002 | Ga0501075_0039892 | |||
| 2003 | Ga0501075_0051207 | |||
| 2004 | Ga0501075_0061201 | |||
| 2005 | Ga0501075_0201223 | |||
| 2006 | Ga0501075_0220812 | |||
| 2007 | Ga0501075_0310962 | |||
| 2008 | Ga0501075_0316855 | |||
| 2009 | Ga0501075_0347914 | |||
| 2010 | Ga0501075_0445439 | |||
| 2011 | Ga0501075_0544007 | |||
| 2012 | Ga0501075_1430735 | |||
| 2013 | Ga0501076_0020207 | |||
| 2014 | Ga0501076_0025447 | |||
| 2015 | Ga0501076_0045344 | |||
| 2016 | Ga0501076_0048998 | |||
| 2017 | Ga0501076_0056095 | |||
| 2018 | Ga0501076_0071070 | |||
| 2019 | Ga0501076_0084118 | |||
| 2020 | Ga0501076_0089383 | |||
| 2021 | Ga0501076_0136617 | |||
| 2022 | Ga0501076_0272929 | |||
| 2023 | Ga0501076_0528236 | |||
| 2024 | Ga0501076_0575936 | |||
| 2025 | Ga0501076_0692582 | |||
| 2026 | Ga0501076_0928123 | |||
| 2027 | Ga0501076_1814360 | |||
| 2028 | Ga0501077_0002534 | |||
| 2029 | Ga0501077_0004906 | |||
| 2030 | Ga0501077_0007994 | |||
| 2031 | Ga0501077_0037902 | |||
| 2032 | Ga0501077_0040757 | |||
| 2033 | Ga0501077_0526013 | |||
| 2034 | Ga0501077_0642820 | |||
| 2035 | Ga0501077_0912883 | |||
| 2036 | Ga0501079_0012883 | |||
| 2037 | Ga0501079_0043429 | |||
| 2038 | Ga0501079_0081732 | |||
| 2039 | Ga0501079_0170385 | |||
| 2040 | Ga0501079_0192003 | |||
| 2041 | Ga0501079_0229768 | |||
| 2042 | Ga0501079_0273037 | |||
| 2043 | Ga0501079_0341710 | |||
| 2044 | Ga0501079_1175411 | |||
| 2045 | Ga0501080_0008633 | |||
| 2046 | Ga0501080_0053015 | |||
| 2047 | Ga0501080_0069831 | |||
| 2048 | Ga0501080_0099897 | |||
| 2049 | Ga0501080_0125366 | |||
| 2050 | Ga0501080_0196662 | |||
| 2051 | Ga0501080_1160780 | |||
| 2052 | Ga0501080_1803952 | |||
| 2053 | Ga0501081_0001935 | |||
| 2054 | Ga0501081_0002356 | |||
| 2055 | Ga0501081_0059171 | |||
| 2056 | Ga0501081_0079155 | |||
| 2057 | Ga0501081_0080075 | |||
| 2058 | Ga0501081_0121895 | |||
| 2059 | Ga0501081_0182676 | |||
| 2060 | Ga0501081_0235816 | |||
| 2061 | Ga0501081_0421206 | |||
| 2062 | Ga0501081_1267623 | |||
| 2063 | Ga0501083_0010147 | |||
| 2064 | Ga0501083_0164307 | |||
| 2065 | Ga0501083_0325700 | |||
| 2066 | Ga0501083_0476694 | |||
| 2067 | Ga0501035_0117664 | |||
| 2068 | Ga0501035_0128176 | |||
| 2069 | Ga0501035_0129006 | |||
| 2070 | Ga0501035_0169383 | |||
| 2071 | Ga0501035_0571699 | |||
| 2072 | Ga0501035_0995086 | |||
| 2073 | Ga0501035_1516330 | |||
| 2074 | Ga0501044_0097347 | |||
| 2075 | Ga0501044_0107146 | |||
| 2076 | Ga0501044_0239384 | |||
| 2077 | Ga0501044_0588359 | |||
| 2078 | Ga0501044_0945492 | |||
| 2079 | Ga0501045_0000967 | |||
| 2080 | Ga0501045_0007845 | |||
| 2081 | Ga0501045_0028388 | |||
| 2082 | Ga0501045_0165382 | |||
| 2083 | Ga0501045_0189574 | |||
| 2084 | Ga0501045_0246561 | |||
| 2085 | Ga0501045_0333605 | |||
| 2086 | Ga0501045_0466980 | |||
| 2087 | Ga0501045_0502991 | |||
| 2088 | Ga0501045_0658173 | |||
| 2089 | Ga0501045_1152955 | |||
| 2090 | Ga0501045_1203158 | |||
| 2091 | nmdc:mga05p37_1163417_c1 | |||
| 2092 | nmdc:mga05p37_12914_c1 | |||
| 2093 | nmdc:mga05p37_189715_c1 | |||
| 2094 | nmdc:mga05p37_440517_c1 | |||
| 2095 | nmdc:mga05p37_570696_c1 | |||
| 2096 | nmdc:mga09592_105428_c1 | |||
| 2097 | nmdc:mga09592_376187_c1 | |||
| 2098 | nmdc:mga06r32_583803_c1 | |||
| 2099 | nmdc:mga08y16_1074261_c1 | |||
| 2100 | nmdc:mga08y16_1077376_c1 | |||
| 2101 | nmdc:mga08y16_201766_c1 | |||
| 2102 | nmdc:mga08y16_24599_c1 | |||
| 2103 | nmdc:mga08y16_256872_c2 | |||
| 2104 | nmdc:mga0n895_336279_c1 | |||
| 2105 | nmdc:mga0rr50_273559_c1 | |||
| 2106 | nmdc:mga0a205_109261_c1 | |||
| 2107 | nmdc:mga0a205_1576986_c1 | |||
| 2108 | nmdc:mga0a205_254669_c1 | |||
| 2109 | nmdc:mga0a205_347292_c1 | |||
| 2110 | Ga0495655_0150465 | |||
| 2111 | Ga0501084_0000362 | |||
| 2112 | Ga0501084_0006930 | |||
| 2113 | Ga0501084_0013345 | |||
| 2114 | Ga0501084_0021022 | |||
| 2115 | Ga0501084_0087248 | |||
| 2116 | Ga0501084_0102635 | |||
| 2117 | Ga0501084_0139307 | |||
| 2118 | Ga0501084_0152503 | |||
| 2119 | Ga0501084_0192067 | |||
| 2120 | Ga0501084_0537710 | |||
| 2121 | Ga0590071_005283 | |||
| 2122 | Ga0590074_032162 | |||
| 2123 | Ga0590075_019485 | |||
| 2124 | Ga0590075_022336 | |||
| 2125 | Ga0590075_033820 | |||
| 2126 | Ga0590077_036449 | |||
| 2127 | Ga0501082_0002526 | |||
| 2128 | Ga0501082_0009168 | |||
| 2129 | Ga0501082_0057418 | |||
| 2130 | Ga0501082_0075329 | |||
| 2131 | Ga0501082_0160276 | |||
| 2132 | Ga0501082_0240216 | |||
| 2133 | Ga0501082_1044956 | |||
| 2134 | Ga0501082_1285355 | |||
| 2135 | Ga0530510_0006973 | |||
| 2136 | Ga0530510_0015968 | |||
| 2137 | Ga0530510_0048100 | |||
| 2138 | Ga0530510_0087285 | |||
| 2139 | Ga0530510_0101484 | |||
| 2140 | Ga0530510_0152139 | |||
| 2141 | Ga0530510_0198061 | |||
| 2142 | Ga0530510_0229339 | |||
| 2143 | Ga0530510_0245693 | |||
| 2144 | Ga0530510_0254947 | |||
| 2145 | Ga0530510_0290464 | |||
| 2146 | Ga0530510_0810715 | |||
| 2147 | Ga0530510_0854505 | |||
| 2148 | Ga0530510_0922827 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1utg-assembly1.cif.gz_A | refinement of the c2221 crystal form of oxidized uteroglobin at 1.34 angstroms resolution | 0.6926 | 19 | 65 |
| 4arq-assembly1.cif.gz_A | structure of the pesticin s89c, s285c double mutant | 0.5929 | 5 | 69 |
| 8da8-assembly1.cif.gz_A | coevolved affibody-z domain pair ll2.c1 | 0.5871 | 2 | 61 |
| 4epf-assembly1.cif.gz_A | the crystal structure of pesticin from yersinia pestis | 0.5838 | 5 | 69 |
| 4aqn-assembly1.cif.gz_A | crystal structure of pesticin from y. pestis | 0.5815 | 5 | 69 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2utgB00 | Mainly Alpha;Orthogonal Bundle;Uteroglobin;Secretoglobin | 0.6977 | 22 | 65 | 1.10.210.10 |
| 1utgA00 | Mainly Alpha;Orthogonal Bundle;Uteroglobin;Secretoglobin | 0.6926 | 19 | 65 | 1.10.210.10 |
| af_I1J4E0_27_128_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.6913 | 23 | 67 | 1.25.40.10 |
| af_Q9UG01_590_768_1.25.40.470 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; | 0.6864 | 19 | 63 | 1.25.40.470 |
| 4epfB02 | Mainly Alpha;Orthogonal Bundle;Lysozyme; | 0.6587 | 5 | 66 | 1.10.530.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y5XYS5-F1-model_v4 | Uncharacterized protein | 1.001 | 3 | 66 |
|
| AF-A0A7W0PX69-F1-model_v4 | Uncharacterized protein | 0.9964 | 1 | 70 |
|
| AF-A0A7Y5XYS5-F1-model_v4 | Uncharacterized protein | 0.9566 | 3 | 66 |
|
| AF-A0A538L6X6-F1-model_v4 | Uncharacterized protein | 0.9507 | 4 | 70 |
|
| AF-A0A7V9CUV4-F1-model_v4 | Uncharacterized protein | 0.9052 | 19 | 66 |
|