F489509

General Info

Members Datasets Scaffolds Average Seq Length
1072 688 2144 148

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10285223|Ga0157375_102852231
Length 173
Sequence LPEESGRSGGLAKAAAAREEESMLKGISPLLNADVLYALRAMGHGDDLIIADTNFPSDSIARQTRLGKLLRIDNVTAAEAAAAVLSVYPLDTFVDDAAARMEIVGKPDEIPPVQREVQAAVDAAEGKPWPMISIERYAFYERARNAYCVIQTGERRFYGCFAFRKGVVPPEAE

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
97 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
98 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
99 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
100 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
105 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
106 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
142 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
144 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
145 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
146 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
149 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
150 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
218 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
219 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
220 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
221 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
224 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
225 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
226 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
227 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
228 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
229 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
230 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
231 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
232 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
233 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
235 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
238 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
239 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
240 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
242 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
243 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
244 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
252 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
253 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
254 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
255 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
256 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
257 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
258 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
259 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
260 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
261 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
262 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
263 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
264 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
265 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
268 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
269 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
270 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
271 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
272 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
273 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
274 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
275 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
276 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
277 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
278 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
279 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
280 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
281 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
284 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
285 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
286 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
287 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
288 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
289 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
290 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
291 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
292 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
293 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
294 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
295 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
296 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
297 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
298 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
299 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
300 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
301 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
302 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
303 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
304 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
305 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
306 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
307 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
308 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
309 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
310 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
311 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
312 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
313 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
314 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
315 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
316 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
317 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
318 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
319 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
320 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
321 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
322 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
323 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
324 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
325 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
326 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
327 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
328 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
329 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
330 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
335 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
336 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
337 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
338 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
339 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
340 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
341 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
342 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
343 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
344 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
345 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
346 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
360 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
361 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
362 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
363 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
364 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
365 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
366 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
367 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
368 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
371 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
372 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
373 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
374 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
375 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
376 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
377 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
378 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
379 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
380 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
381 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
382 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
383 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
384 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
385 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
386 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
387 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
388 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
389 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
390 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
391 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
392 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
393 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
394 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
395 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
396 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
397 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
398 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
399 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
400 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
401 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
402 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
403 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
404 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
405 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
406 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
407 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
408 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
409 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
410 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
411 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
412 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
413 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
414 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
415 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
416 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
417 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
418 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
419 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
420 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
421 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
422 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
423 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
424 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
425 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
426 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
427 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
428 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
429 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
430 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
431 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
432 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
433 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
434 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
435 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
436 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
437 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
438 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
439 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
440 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
441 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
442 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
443 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
444 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
445 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
446 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
447 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
448 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
449 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
450 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
451 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
452 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
453 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
454 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
455 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
456 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
457 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
458 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
459 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
460 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
461 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
462 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
463 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
464 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
465 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
466 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
467 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
468 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
469 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
470 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
471 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
472 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
473 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
474 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
475 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
476 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
477 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
478 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
479 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
480 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
481 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
482 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
483 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
484 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
485 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
486 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
487 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
488 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
489 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
490 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
491 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
492 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
493 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
494 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
495 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
496 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
497 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
498 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
499 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
500 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
501 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
502 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
503 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
504 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
505 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
506 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
507 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
508 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
509 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
510 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
511 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
512 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
513 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
514 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
515 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
516 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
517 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
518 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
519 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
520 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
521 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
522 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
523 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
524 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
525 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
526 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
527 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
528 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
529 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
530 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
531 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
532 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
533 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
534 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
535 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
536 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
537 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
538 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
539 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
540 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
541 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
542 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
543 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
544 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
545 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
546 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
547 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
548 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
549 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
550 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
551 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
552 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
553 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
554 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
555 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
556 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
557 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
558 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
559 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
560 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
561 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
562 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
563 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
564 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
565 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
566 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
567 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
568 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
569 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
570 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
571 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
572 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
573 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
574 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
575 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
576 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
577 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
578 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
579 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
580 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
581 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
582 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
583 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
584 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
585 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
586 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
587 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
588 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
589 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
590 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
591 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
592 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
593 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
594 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
595 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
596 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
597 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
598 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
599 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
600 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
601 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
602 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
603 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
604 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
605 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
606 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
607 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
608 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
609 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
610 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
611 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
612 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
613 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
614 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
615 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
616 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
617 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
618 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
619 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
620 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
621 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
622 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
623 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
624 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
625 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
626 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
627 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
628 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
629 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
630 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
631 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
632 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
633 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
634 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
635 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
636 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
637 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
638 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
639 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
640 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
641 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
642 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
643 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
644 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
645 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
646 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
647 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
648 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
649 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
650 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
651 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
652 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
653 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
654 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
655 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
656 3004167301 Mesorhizobium loti 582 Isolate Unclassified
657 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
658 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
659 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
660 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
661 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
662 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
663 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
664 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
665 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
666 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
667 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
668 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
669 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
670 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
671 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
672 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
673 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
674 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
675 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
676 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
677 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
678 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
679 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
680 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
681 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
682 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
683 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
684 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
685 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
686 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
687 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
688 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.6
Metatranscriptomes 0
Isolates 26.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.61
Nodule 22.01
Rhizoplane 3.17
Rhizosphere 57
Stem 0
Stem Tuber 0
Unclassified 1.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10285223 3300013308 Bacteria 1814
2 JGI24737J22298_10086342 3300001990 Bacteria 932
3 JGI25155J39150_1000012 3300002704 Bacteria 199435
4 JGI25156J39149_1000049 3300002705 Bacteria 91988
5 JGI25162J39368_1000409 3300002737 Bacteria 35106
6 JGI25154J39366_1000033 3300002738 Bacteria 184379
7 JGI25157J39369_1000055 3300002741 Bacteria 107875
8 JGI25157J39369_1005196 3300002741 Bacteria 2167
9 JGI25406J46586_10033808 3300003203 Bacteria 1884
10 JGI25165J46597_1000451 3300003214 Bacteria 41309
11 JGI25165J46597_1000751 3300003214 Bacteria 24993
12 JGI25165J46597_1002590 3300003214 Bacteria 5525
13 JGI25165J46597_1003128 3300003214 Bacteria 4418
14 rootH1_10058850 3300003316 Bacteria 3030
15 rootL2_10050130 3300003322 Bacteria 2870
16 rootH1_10117942 3300003323 Bacteria 2456
17 JGI25160J50197_1000006 3300003354 Bacteria 316247
18 JGI25161J50226_1000004 3300003374 Bacteria 316212
19 Ga0055529_1002835 3300003763 Bacteria 3129
20 Ga0055531_10032276 3300003794 Bacteria 1714
21 Ga0058692_1006656 3300003856 Bacteria 3144
22 Ga0055543_1000002 3300004625 Bacteria 390020
23 Ga0065165_1000217 3300005262 Bacteria 100170
24 Ga0070676_10108950 3300005328 Bacteria 1722
25 Ga0070676_10560885 3300005328 Bacteria 819
26 Ga0070683_100004415 3300005329 Bacteria 11589
27 Ga0070683_100115544 3300005329 Bacteria 2533
28 Ga0070690_100001109 3300005330 Bacteria 13857
29 Ga0070690_100997503 3300005330 Unclassified 659
30 Ga0070670_100068469 3300005331 Bacteria 3047
31 Ga0070670_101935719 3300005331 Bacteria 543
32 Ga0068869_100118429 3300005334 Bacteria 2022
33 Ga0068869_100476543 3300005334 Bacteria 1038
34 Ga0070666_10040691 3300005335 Bacteria 3102
35 Ga0070682_100663079 3300005337 Bacteria 832
36 Ga0070682_101440986 3300005337 Bacteria 590
37 Ga0068868_100014124 3300005338 Bacteria 5879
38 Ga0070660_100195945 3300005339 Bacteria 1637
39 Ga0070660_100201365 3300005339 Bacteria 1615
40 Ga0070689_100016865 3300005340 Bacteria 5353
41 Ga0070689_100431153 3300005340 Bacteria 1119
42 Ga0070689_102110629 3300005340 Bacteria 516
43 Ga0070687_100358863 3300005343 Bacteria 943
44 Ga0070661_100435917 3300005344 Bacteria 1041
45 Ga0070661_100728618 3300005344 Bacteria 809
46 Ga0070692_10040382 3300005345 Bacteria 2386
47 Ga0070692_10041040 3300005345 Bacteria 2369
48 Ga0070668_100015632 3300005347 Bacteria 5673
49 Ga0070668_100722745 3300005347 Bacteria 880
50 Ga0070675_100147408 3300005354 Bacteria 2016
51 Ga0070675_100222426 3300005354 Bacteria 1644
52 Ga0070671_100023742 3300005355 Bacteria 5019
53 Ga0070674_100848085 3300005356 Bacteria 792
54 Ga0070673_100159902 3300005364 Bacteria 1915
55 Ga0070688_100005647 3300005365 Bacteria 6602
56 Ga0070659_100018986 3300005366 Bacteria 5199
57 Ga0070659_100154474 3300005366 Bacteria 1873
58 Ga0070667_100111726 3300005367 Bacteria 2370
59 Ga0070667_100210007 3300005367 Bacteria 1730
60 Ga0070703_10045652 3300005406 Bacteria 1382
61 Ga0070709_10148714 3300005434 Bacteria 1616
62 Ga0070709_10678779 3300005434 Bacteria 800
63 Ga0070714_100146762 3300005435 Bacteria 2123
64 Ga0070714_100480131 3300005435 Bacteria 1183
65 Ga0070713_100066016 3300005436 Bacteria 3042
66 Ga0070710_10143648 3300005437 Bacteria 1466
67 Ga0070701_10305264 3300005438 Bacteria 980
68 Ga0070711_100220000 3300005439 Bacteria 1475
69 Ga0070711_100695741 3300005439 Bacteria 856
70 Ga0070694_100164050 3300005444 Bacteria 1633
71 Ga0070708_100013164 3300005445 Bacteria 6767
72 Ga0070663_100014018 3300005455 Bacteria 5133
73 Ga0070663_100126962 3300005455 Bacteria 1933
74 Ga0070678_100030078 3300005456 Bacteria 3728
75 Ga0070678_100168676 3300005456 Bacteria 1780
76 Ga0070662_100040770 3300005457 Bacteria 3308
77 Ga0070662_100151828 3300005457 Bacteria 1804
78 Ga0070662_101346805 3300005457 Bacteria 615
79 Ga0070681_10815339 3300005458 Bacteria 850
80 Ga0068867_100097316 3300005459 Bacteria 2242
81 Ga0070685_10013532 3300005466 Bacteria 4304
82 Ga0070706_100008686 3300005467 Bacteria 9468
83 Ga0070706_100087810 3300005467 Bacteria 2883
84 Ga0070706_100339940 3300005467 Bacteria 1399
85 Ga0070706_100511836 3300005467 Bacteria 1116
86 Ga0070698_100219263 3300005471 Bacteria 1836
87 Ga0070699_100302304 3300005518 Bacteria 1435
88 Ga0070699_100475769 3300005518 Bacteria 1133
89 Ga0070679_100121532 3300005530 Bacteria 2596
90 Ga0070679_100404757 3300005530 Bacteria 1310
91 Ga0070684_100026463 3300005535 Bacteria 4888
92 Ga0070684_100078473 3300005535 Bacteria 2917
93 Ga0070684_100932386 3300005535 Bacteria 814
94 Ga0070697_100058870 3300005536 Bacteria 3127
95 Ga0070697_101067127 3300005536 Bacteria 719
96 Ga0068853_100041286 3300005539 Bacteria 3939
97 Ga0068853_100048352 3300005539 Bacteria 3653
98 Ga0070672_100506080 3300005543 Bacteria 1045
99 Ga0070672_101293921 3300005543 Unclassified 651
100 Ga0070695_100510040 3300005545 Bacteria 931
101 Ga0070696_100057561 3300005546 Bacteria 2713
102 Ga0070696_100401647 3300005546 Bacteria 1072
103 Ga0070693_100001562 3300005547 Bacteria 10346
104 Ga0070693_100360508 3300005547 Bacteria 997
105 Ga0070693_100412388 3300005547 Bacteria 939
106 Ga0070693_100546376 3300005547 Bacteria 828
107 Ga0070665_100019496 3300005548 Bacteria 6809
108 Ga0070665_100038818 3300005548 Bacteria 4787
109 Ga0070665_100077971 3300005548 Bacteria 3320
110 Ga0070665_100191236 3300005548 Bacteria 2047
111 Ga0070665_101130126 3300005548 Bacteria 795
112 Ga0070704_101105291 3300005549 Unclassified 720
113 Ga0068855_100020260 3300005563 Bacteria 7982
114 Ga0068855_101089338 3300005563 Bacteria 836
115 Ga0070664_100145227 3300005564 Bacteria 2092
116 Ga0070664_100495691 3300005564 Bacteria 1125
117 Ga0068857_100378897 3300005577 Bacteria 1313
118 Ga0068854_100033267 3300005578 Bacteria 3594
119 Ga0068854_100179420 3300005578 Bacteria 1653
120 Ga0068854_100372752 3300005578 Bacteria 1174
121 Ga0068854_100539130 3300005578 Bacteria 988
122 Ga0068854_100570293 3300005578 Bacteria 962
123 Ga0068856_100017550 3300005614 Bacteria 6935
124 Ga0068856_100048373 3300005614 Bacteria 4190
125 Ga0068856_100174500 3300005614 Bacteria 2162
126 Ga0068856_100425180 3300005614 Bacteria 1348
127 Ga0068856_100793777 3300005614 Bacteria 966
128 Ga0070702_100133744 3300005615 Bacteria 1570
129 Ga0068852_100444254 3300005616 Bacteria 1283
130 Ga0068852_100596356 3300005616 Bacteria 1109
131 Ga0068852_100811565 3300005616 Bacteria 950
132 Ga0068859_100017209 3300005617 Bacteria 7259
133 Ga0068859_100042947 3300005617 Bacteria 4542
134 Ga0068864_100016950 3300005618 Bacteria 6069
135 Ga0068866_10003917 3300005718 Bacteria 6109
136 Ga0068861_100038431 3300005719 Bacteria 3564
137 Ga0068861_100300440 3300005719 Bacteria 1390
138 Ga0068851_10462369 3300005834 Bacteria 755
139 Ga0068870_10003953 3300005840 Bacteria 6331
140 Ga0068870_10164082 3300005840 Bacteria 1320
141 Ga0068863_100003402 3300005841 Bacteria 15696
142 Ga0068863_100051797 3300005841 Bacteria 3890
143 Ga0068858_100011123 3300005842 Bacteria 8507
144 Ga0068860_100020171 3300005843 Bacteria 6460
145 Ga0068860_100054850 3300005843 Bacteria 3788
146 Ga0068860_100083677 3300005843 Bacteria 3035
147 Ga0068862_100004166 3300005844 Bacteria 12246
148 Ga0068862_100040969 3300005844 Bacteria 3939
149 Ga0081455_10001675 3300005937 Bacteria 26869
150 Ga0081455_10173948 3300005937 Bacteria 1637
151 Ga0081455_10470213 3300005937 Bacteria 853
152 Ga0081540_1040542 3300005983 Bacteria 2426
153 Ga0081540_1057821 3300005983 Bacteria 1873
154 Ga0081539_10000618 3300005985 Bacteria 71969
155 Ga0070717_10907771 3300006028 Bacteria 802
156 Ga0075365_10015498 3300006038 Bacteria 4613
157 Ga0075365_10072207 3300006038 Bacteria 2324
158 Ga0075365_10197970 3300006038 Bacteria 1407
159 Ga0075365_10272444 3300006038 Bacteria 1191
160 Ga0075365_10307663 3300006038 Bacteria 1116
161 Ga0075365_10491806 3300006038 Bacteria 867
162 Ga0075365_10494289 3300006038 Bacteria 864
163 Ga0075368_10011941 3300006042 Bacteria 3168
164 Ga0075368_10081928 3300006042 Bacteria 1314
165 Ga0075363_100002924 3300006048 Bacteria 7119
166 Ga0075363_100132179 3300006048 Bacteria 1400
167 Ga0075363_100298334 3300006048 Bacteria 935
168 Ga0075363_100702781 3300006048 Bacteria 611
169 Ga0075364_10062267 3300006051 Bacteria 2448
170 Ga0075364_10203047 3300006051 Bacteria 1344
171 Ga0070715_10288158 3300006163 Unclassified 873
172 Ga0070716_100090595 3300006173 Bacteria 1850
173 Ga0070716_101092972 3300006173 Bacteria 635
174 Ga0070712_100064468 3300006175 Bacteria 2598
175 Ga0070712_100123228 3300006175 Bacteria 1954
176 Ga0075362_10061619 3300006177 Bacteria 1698
177 Ga0075362_10092666 3300006177 Bacteria 1404
178 Ga0075367_10036831 3300006178 Bacteria 2839
179 Ga0075367_10497286 3300006178 Bacteria 773
180 Ga0075369_10008375 3300006186 Bacteria 3975
181 Ga0075369_10033384 3300006186 Bacteria 2181
182 Ga0075369_10052739 3300006186 Bacteria 1763
183 Ga0075366_10255203 3300006195 Bacteria 1070
184 Ga0075366_10260231 3300006195 Bacteria 1059
185 Ga0097621_100038513 3300006237 Bacteria 3837
186 Ga0097621_100093240 3300006237 Bacteria 2523
187 Ga0097621_101692877 3300006237 Bacteria 602
188 Ga0075370_10059181 3300006353 Bacteria 2180
189 Ga0075370_10216447 3300006353 Bacteria 1131
190 Ga0068871_100028765 3300006358 Bacteria 4360
191 Ga0068871_100193854 3300006358 Bacteria 1751
192 Ga0068871_101367831 3300006358 Bacteria 667
193 Ga0075428_101110063 3300006844 Bacteria 835
194 Ga0075428_101256105 3300006844 Bacteria 780
195 Ga0075428_101407786 3300006844 Bacteria 732
196 Ga0075433_10123825 3300006852 Bacteria 2297
197 Ga0075434_100086846 3300006871 Bacteria 3128
198 Ga0075434_100243109 3300006871 Bacteria 1820
199 Ga0075434_100383731 3300006871 Bacteria 1426
200 Ga0075434_101542761 3300006871 Unclassified 673
201 Ga0068865_100442734 3300006881 Bacteria 1073
202 Ga0068865_101644105 3300006881 Bacteria 578
203 Ga0075436_100051706 3300006914 Bacteria 2835
204 Ga0097620_100017209 3300006931 Bacteria 7259
205 Ga0097620_100042945 3300006931 Bacteria 4542
206 Ga0075435_100034557 3300007076 Bacteria 4007
207 Ga0075435_100063062 3300007076 Bacteria 3010
208 Ga0105251_10195264 3300009011 Bacteria 912
209 Ga0105240_10000019 3300009093 Bacteria 406211
210 Ga0105240_10457028 3300009093 Bacteria 1428
211 Ga0111539_10573542 3300009094 Bacteria 1314
212 Ga0111539_10973472 3300009094 Bacteria 986
213 Ga0105245_10008787 3300009098 Bacteria 8811
214 Ga0105245_10012249 3300009098 Bacteria 7462
215 Ga0105245_10704444 3300009098 Bacteria 1043
216 Ga0105247_10256876 3300009101 Bacteria 1197
217 Ga0105247_10546399 3300009101 Bacteria 851
218 Ga0114129_10039195 3300009147 Bacteria 6680
219 Ga0114129_10370718 3300009147 Bacteria 1892
220 Ga0114129_10563610 3300009147 Bacteria 1480
221 Ga0105243_10190745 3300009148 Bacteria 1790
222 Ga0105241_10002809 3300009174 Bacteria 13028
223 Ga0105241_10077444 3300009174 Bacteria 2596
224 Ga0105241_10347763 3300009174 Bacteria 1286
225 Ga0105241_10490484 3300009174 Bacteria 1094
226 Ga0105242_10035997 3300009176 Bacteria 3969
227 Ga0105242_10041919 3300009176 Bacteria 3694
228 Ga0105248_10006767 3300009177 Bacteria 12571
229 Ga0105248_10229862 3300009177 Bacteria 2088
230 Ga0105248_11734653 3300009177 Bacteria 708
231 Ga0105237_10002910 3300009545 Bacteria 20751
232 Ga0105237_10012671 3300009545 Bacteria 8876
233 Ga0105237_10077167 3300009545 Bacteria 3322
234 Ga0105237_10382410 3300009545 Bacteria 1413
235 Ga0105237_10435300 3300009545 Bacteria 1317
236 Ga0105237_10466562 3300009545 Bacteria 1269
237 Ga0105237_11493899 3300009545 Unclassified 682
238 Ga0105238_10060166 3300009551 Bacteria 3804
239 Ga0105238_10273171 3300009551 Bacteria 1671
240 Ga0105238_11010446 3300009551 Bacteria 853
241 Ga0105249_10230499 3300009553 Bacteria 1826
242 Ga0105249_11103659 3300009553 Bacteria 863
243 Ga0105249_12154987 3300009553 Bacteria 630
244 Ga0105239_10128194 3300010375 Bacteria 2821
245 Ga0105239_10134799 3300010375 Bacteria 2749
246 Ga0105239_10239237 3300010375 Bacteria 2038
247 Ga0105239_10351218 3300010375 Bacteria 1665
248 Ga0105239_10633232 3300010375 Bacteria 1221
249 Ga0105239_10685589 3300010375 Bacteria 1171
250 Ga0105239_10731283 3300010375 Bacteria 1132
251 Ga0105246_10002739 3300011119 Bacteria 10665
252 Ga0105246_10353557 3300011119 Bacteria 1205
253 Ga0157373_10192573 3300013100 Bacteria 1437
254 Ga0157370_10005600 3300013104 Bacteria 14063
255 Ga0157370_10292468 3300013104 Bacteria 1504
256 Ga0157370_10337594 3300013104 Bacteria 1389
257 Ga0157370_10694780 3300013104 Bacteria 929
258 Ga0157369_10076560 3300013105 Bacteria 3586
259 Ga0157369_10495572 3300013105 Bacteria 1264
260 Ga0157369_10854730 3300013105 Bacteria 934
261 Ga0157374_10003517 3300013296 Bacteria 13173
262 Ga0157374_11717190 3300013296 Bacteria 653
263 Ga0157378_10063609 3300013297 Bacteria 3297
264 Ga0157378_12092061 3300013297 Bacteria 617
265 Ga0163162_10025504 3300013306 Bacteria 5842
266 Ga0163162_10059392 3300013306 Bacteria 3856
267 Ga0163162_10204780 3300013306 Bacteria 2102
268 Ga0163162_10485167 3300013306 Bacteria 1367
269 Ga0157372_10609250 3300013307 Bacteria 1273
270 Ga0157375_10314707 3300013308 Bacteria 1730
271 Ga0163163_10001121 3300014325 Bacteria 22761
272 Ga0163163_10026152 3300014325 Bacteria 5574
273 Ga0157380_10874693 3300014326 Bacteria 922
274 Ga0157380_12638696 3300014326 Bacteria 569
275 Ga0182008_10035672 3300014497 Bacteria 2489
276 Ga0182008_10560614 3300014497 Bacteria 636
277 Ga0157377_10009889 3300014745 Bacteria 4700
278 Ga0157377_10092924 3300014745 Bacteria 1784
279 Ga0157379_10167803 3300014968 Bacteria 1982
280 Ga0157379_10272786 3300014968 Bacteria 1538
281 Ga0157376_10011305 3300014969 Bacteria 6573
282 Ga0157376_10194108 3300014969 Bacteria 1864
283 Ga0182007_10001799 3300015262 Bacteria 11183
284 Ga0163161_10056365 3300017792 Bacteria 2854
285 Ga0209435_100005 3300025206 Bacteria 573745
286 Ga0207427_102108 3300025231 Bacteria 5813
287 Ga0209437_100078 3300025233 Bacteria 278088
288 Ga0209437_100174 3300025233 Bacteria 138811
289 Ga0209646_1000011 3300025246 Bacteria 573745
290 Ga0209646_1023495 3300025246 Bacteria 874
291 Ga0209026_1000002 3300025250 Bacteria 1136158
292 Ga0209026_1000008 3300025250 Bacteria 573745
293 Ga0209677_100155 3300025253 Bacteria 62873
294 Ga0209148_1000038 3300025254 Bacteria 493744
295 Ga0209148_1016798 3300025254 Bacteria 1253
296 Ga0209759_1000004 3300025256 Bacteria 573745
297 Ga0209759_1000062 3300025256 Bacteria 197996
298 Ga0209233_1000163 3300025261 Bacteria 152912
299 Ga0209233_1000295 3300025261 Bacteria 62548
300 Ga0209233_1000406 3300025261 Bacteria 34375
301 Ga0209233_1000459 3300025261 Bacteria 26552
302 Ga0209233_1021668 3300025261 Bacteria 1659
303 Ga0209455_1000068 3300025272 Bacteria 310024
304 Ga0209130_1000032 3300025284 Bacteria 316240
305 Ga0209050_1003331 3300025298 Bacteria 11982
306 Ga0207426_1000077 3300025302 Bacteria 316246
307 Ga0209051_1038770 3300025303 Bacteria 1730
308 Ga0209257_1000391 3300025304 Bacteria 87258
309 Ga0207656_10225020 3300025321 Bacteria 913
310 Ga0207692_10039561 3300025898 Bacteria 2321
311 Ga0207692_10090768 3300025898 Bacteria 1656
312 Ga0207710_10077360 3300025900 Bacteria 1537
313 Ga0207680_10015128 3300025903 Bacteria 4019
314 Ga0207685_10059770 3300025905 Bacteria 1505
315 Ga0207699_10040648 3300025906 Bacteria 2680
316 Ga0207699_10327775 3300025906 Bacteria 1076
317 Ga0207645_10025760 3300025907 Bacteria 3805
318 Ga0207643_10023502 3300025908 Bacteria 3399
319 Ga0207643_10124895 3300025908 Bacteria 1527
320 Ga0207684_10038843 3300025910 Bacteria 4039
321 Ga0207684_10084523 3300025910 Bacteria 2703
322 Ga0207684_11277072 3300025910 Bacteria 605
323 Ga0207654_10014926 3300025911 Bacteria 4021
324 Ga0207654_10159569 3300025911 Bacteria 1456
325 Ga0207654_10335573 3300025911 Bacteria 1037
326 Ga0207654_11374694 3300025911 Bacteria 515
327 Ga0207707_10056150 3300025912 Bacteria 3425
328 Ga0207707_10472017 3300025912 Bacteria 1072
329 Ga0207695_10000049 3300025913 Bacteria 406233
330 Ga0207695_10175437 3300025913 Bacteria 2066
331 Ga0207695_11099778 3300025913 Bacteria 675
332 Ga0207671_10000107 3300025914 Bacteria 128950
333 Ga0207671_10049865 3300025914 Bacteria 3100
334 Ga0207671_10060840 3300025914 Bacteria 2802
335 Ga0207671_10388757 3300025914 Bacteria 1109
336 Ga0207693_10000558 3300025915 Bacteria 33668
337 Ga0207693_10051017 3300025915 Bacteria 3248
338 Ga0207663_10168312 3300025916 Bacteria 1554
339 Ga0207660_10442138 3300025917 Bacteria 1051
340 Ga0207657_10014392 3300025919 Bacteria 7724
341 Ga0207657_10113296 3300025919 Bacteria 2238
342 Ga0207657_10177322 3300025919 Bacteria 1724
343 Ga0207649_10606028 3300025920 Bacteria 843
344 Ga0207649_10812270 3300025920 Bacteria 730
345 Ga0207652_10132651 3300025921 Bacteria 2223
346 Ga0207646_10001541 3300025922 Bacteria 28217
347 Ga0207694_10035236 3300025924 Bacteria 3839
348 Ga0207694_10446700 3300025924 Bacteria 1079
349 Ga0207650_10000477 3300025925 Bacteria 33477
350 Ga0207650_10083345 3300025925 Bacteria 2428
351 Ga0207650_10435903 3300025925 Bacteria 1089
352 Ga0207659_10213861 3300025926 Bacteria 1547
353 Ga0207659_10230444 3300025926 Bacteria 1494
354 Ga0207687_10001595 3300025927 Bacteria 15608
355 Ga0207687_10025741 3300025927 Bacteria 3938
356 Ga0207700_10001422 3300025928 Bacteria 13581
357 Ga0207700_10305806 3300025928 Bacteria 1374
358 Ga0207664_10000296 3300025929 Bacteria 37143
359 Ga0207664_10466015 3300025929 Bacteria 1129
360 Ga0207644_10002914 3300025931 Bacteria 11024
361 Ga0207644_10118116 3300025931 Bacteria 2015
362 Ga0207706_10027114 3300025933 Bacteria 5124
363 Ga0207706_10089484 3300025933 Bacteria 2706
364 Ga0207686_10006016 3300025934 Bacteria 6513
365 Ga0207686_10334137 3300025934 Bacteria 1136
366 Ga0207709_10227160 3300025935 Bacteria 1350
367 Ga0207670_10031179 3300025936 Bacteria 3412
368 Ga0207670_10283678 3300025936 Bacteria 1292
369 Ga0207704_10072663 3300025938 Bacteria 2187
370 Ga0207665_10106835 3300025939 Bacteria 1962
371 Ga0207665_10132494 3300025939 Bacteria 1771
372 Ga0207665_11106381 3300025939 Unclassified 632
373 Ga0207691_10297604 3300025940 Bacteria 1387
374 Ga0207711_10004034 3300025941 Bacteria 12602
375 Ga0207711_10054658 3300025941 Bacteria 3427
376 Ga0207711_10448455 3300025941 Bacteria 1201
377 Ga0207689_10031989 3300025942 Bacteria 4376
378 Ga0207689_10660630 3300025942 Bacteria 881
379 Ga0207661_10473456 3300025944 Bacteria 1143
380 Ga0207679_10037522 3300025945 Bacteria 3445
381 Ga0207679_10316884 3300025945 Bacteria 1349
382 Ga0207667_10079509 3300025949 Bacteria 3398
383 Ga0207667_10080403 3300025949 Bacteria 3377
384 Ga0207667_10606848 3300025949 Bacteria 1103
385 Ga0207651_10370449 3300025960 Bacteria 1211
386 Ga0207712_10433228 3300025961 Bacteria 1112
387 Ga0207668_10003707 3300025972 Bacteria 8992
388 Ga0207668_10027672 3300025972 Bacteria 3696
389 Ga0207668_11430096 3300025972 Bacteria 623
390 Ga0207640_10008587 3300025981 Bacteria 5675
391 Ga0207640_10012091 3300025981 Bacteria 4907
392 Ga0207640_10059253 3300025981 Bacteria 2526
393 Ga0207640_10072069 3300025981 Bacteria 2329
394 Ga0207640_10344320 3300025981 Bacteria 1195
395 Ga0207640_10987061 3300025981 Bacteria 740
396 Ga0207658_10052756 3300025986 Bacteria 3002
397 Ga0207658_10094354 3300025986 Bacteria 2328
398 Ga0207658_10914940 3300025986 Bacteria 799
399 Ga0207677_10000248 3300026023 Bacteria 41571
400 Ga0207677_10381933 3300026023 Bacteria 1189
401 Ga0207703_10001121 3300026035 Bacteria 25303
402 Ga0207703_10079383 3300026035 Bacteria 2730
403 Ga0207639_10811518 3300026041 Bacteria 872
404 Ga0207678_10002052 3300026067 Bacteria 18265
405 Ga0207678_10042892 3300026067 Bacteria 3916
406 Ga0207678_10389641 3300026067 Bacteria 1205
407 Ga0207678_10466427 3300026067 Bacteria 1099
408 Ga0207678_10638271 3300026067 Bacteria 935
409 Ga0207678_10761691 3300026067 Bacteria 854
410 Ga0207702_10015468 3300026078 Bacteria 6319
411 Ga0207702_10072567 3300026078 Bacteria 2967
412 Ga0207702_10313993 3300026078 Bacteria 1491
413 Ga0207702_10517488 3300026078 Bacteria 1165
414 Ga0207641_10021168 3300026088 Bacteria 5346
415 Ga0207641_10186488 3300026088 Bacteria 1903
416 Ga0207641_11265584 3300026088 Bacteria 738
417 Ga0207648_10056634 3300026089 Bacteria 3420
418 Ga0207648_10102140 3300026089 Bacteria 2513
419 Ga0207676_10000469 3300026095 Bacteria 33863
420 Ga0207676_10009086 3300026095 Bacteria 7077
421 Ga0207674_10024745 3300026116 Bacteria 6408
422 Ga0207674_10080475 3300026116 Bacteria 3261
423 Ga0207674_10599445 3300026116 Bacteria 1064
424 Ga0207675_100056894 3300026118 Bacteria 3648
425 Ga0207675_100283481 3300026118 Bacteria 1610
426 Ga0207675_100550380 3300026118 Bacteria 1153
427 Ga0207683_10000360 3300026121 Bacteria 41821
428 Ga0207683_10019671 3300026121 Bacteria 5769
429 Ga0207683_10572015 3300026121 Bacteria 1045
430 Ga0207683_10600782 3300026121 Bacteria 1018
431 Ga0207698_10370471 3300026142 Bacteria 1359
432 Ga0209371_1002352 3300027312 Bacteria 10747
433 Ga0209813_10052941 3300027866 Bacteria 1274
434 Ga0209813_10095870 3300027866 Bacteria 1003
435 Ga0268266_10025564 3300028379 Bacteria 5022
436 Ga0268266_10028161 3300028379 Bacteria 4777
437 Ga0268266_10049048 3300028379 Bacteria 3619
438 Ga0268266_10124597 3300028379 Bacteria 2297
439 Ga0268266_10404969 3300028379 Bacteria 1290
440 Ga0268266_11396610 3300028379 Bacteria 676
441 Ga0268265_10003500 3300028380 Bacteria 11237
442 Ga0268265_10049071 3300028380 Bacteria 3173
443 Ga0268264_10056516 3300028381 Bacteria 3281
444 Ga0268264_10971504 3300028381 Bacteria 855
445 Ga0265318_10018055 3300028577 Bacteria 2885
446 Ga0268256_1001392 3300030500 Bacteria 14681
447 Ga0265320_10268405 3300031240 Bacteria 756
448 Ga0265340_10022597 3300031247 Bacteria 3215
449 Ga0265339_10024295 3300031249 Bacteria 3494
450 Ga0265316_10412068 3300031344 Bacteria 972
451 Ga0265314_10012601 3300031711 Bacteria 6885
452 Ga0265342_10088083 3300031712 Bacteria 1783
453 Ga0307516_10725376 3300031730 Bacteria 652
454 Ga0307409_101612142 3300031995 Bacteria 677
455 Ga0307411_10369021 3300032005 Bacteria 1177
456 Ga0307415_101332403 3300032126 Bacteria 681
457 Ga0307415_101674920 3300032126 Bacteria 613
458 Ga0307510_10290443 3300033180 Bacteria 1101
459 Ga0373926_0121389 3300035083 Bacteria 985
460 Ga0373934_0013305 3300035086 Bacteria 3109
461 Ga0373944_0060322 3300035089 Unclassified 1216
462 Ga0373923_0043909 3300035111 Bacteria 1851
463 Ga0373936_0154063 3300035113 Bacteria 998
464 Ga0373957_0155392 3300035120 Bacteria 940
465 Ga0373943_0012736 3300035170 Bacteria 3792
466 Ga0373943_0437342 3300035170 Bacteria 759
467 Ga0373955_0137627 3300035172 Bacteria 1429
468 Ga0316574_0175533 3300035398 Unclassified 1379
469 Ga0316574_0195944 3300035398 Bacteria 1299
470 Ga0373931_0847727 3300035691 Unclassified 612
471 Ga0373935_0072789 3300035692 Bacteria 2219
472 Ga0373935_1470185 3300035692 Bacteria 510
473 Ga0373927_0077959 3300035695 Bacteria 2146
474 Ga0373927_0286186 3300035695 Bacteria 1084
475 Ga0373933_0393421 3300035724 Bacteria 903
476 Ga0373947_0018394 3300035725 Bacteria 4021
477 Ga0373947_0079611 3300035725 Bacteria 2025
478 Ga0373947_0440315 3300035725 Bacteria 882
479 Ga0373937_0032518 3300036401 Bacteria 4731
480 Ga0373937_0376865 3300036401 Bacteria 1345
481 Ga0373925_0039450 3300037068 Bacteria 3493
482 Ga0373925_0173837 3300037068 Bacteria 1701
483 Ga0373925_0491564 3300037068 Bacteria 1007
484 Ga0395899_0080802 3300037312 Bacteria 2366
485 Ga0395900_0077724 3300037418 Bacteria 3410
486 Ga0395900_0439240 3300037418 Bacteria 1263
487 Ga0395900_0450508 3300037418 Bacteria 1243
488 Ga0395900_0494426 3300037418 Bacteria 1174
489 Ga0395898_0325883 3300037466 Bacteria 1465
490 Ga0395898_0415077 3300037466 Bacteria 1283
491 Ga0395905_0002511 3300037471 Bacteria 20273
492 Ga0395905_0081298 3300037471 Bacteria 3037
493 Ga0395905_0550179 3300037471 Bacteria 1055
494 Ga0395901_0224404 3300038443 Bacteria 1963
495 Ga0395901_0237617 3300038443 Bacteria 1901
496 Ga0400483_050340 3300039062 Bacteria 2511
497 Ga0439465_0111548 3300041413 Bacteria 952
498 Ga0439465_0275238 3300041413 Bacteria 626
499 Ga0451791_1047365 3300041451 Bacteria 985
500 Ga0451791_1794651 3300041451 Bacteria 842
501 Ga0451851_1330176 3300041507 Unclassified 872
502 Ga0451853_0507671 3300041512 Unclassified 694
503 Ga0439458_0043656 3300042157 Bacteria 1094
504 Ga0466965_0115597 3300044683 Bacteria 1382
505 Ga0466963_0146131 3300044694 Bacteria 1640
506 Ga0453684_1268054 3300044712 Bacteria 770
507 Ga0466970_0055250 3300044765 Bacteria 2120
508 Ga0466957_0086720 3300044842 Bacteria 1956
509 Ga0466958_0171889 3300045836 Bacteria 1372
510 Ga0466967_0027095 3300045976 Bacteria 4762
511 Ga0466967_0191984 3300045976 Bacteria 1931
512 Ga0495617_136699 3300046452 Bacteria 784
513 Ga0495603_0118140 3300046455 Bacteria 1546
514 Ga0495603_0310118 3300046455 Bacteria 906
515 Ga0495629_0082150 3300046459 Bacteria 2249
516 Ga0495629_0679695 3300046459 Bacteria 684
517 Ga0495629_0761145 3300046459 Unclassified 640
518 Ga0495638_0076719 3300046460 Bacteria 2036
519 Ga0495638_0149918 3300046460 Bacteria 1353
520 Ga0495651_0107051 3300046462 Bacteria 2072
521 Ga0495650_0068952 3300046471 Bacteria 1393
522 Ga0495580_0062266 3300046472 Bacteria 2618
523 Ga0495580_0150420 3300046472 Bacteria 1613
524 Ga0495580_0306180 3300046472 Bacteria 1081
525 Ga0495582_0176866 3300046473 Bacteria 1215
526 Ga0495639_0005383 3300046475 Bacteria 5510
527 Ga0495662_0053229 3300046476 Bacteria 1954
528 Ga0495662_0428280 3300046476 Bacteria 649
529 Ga0495664_0130979 3300046477 Bacteria 1518
530 Ga0495664_0536136 3300046477 Bacteria 698
531 Ga0495584_0169388 3300046491 Bacteria 1110
532 Ga0495583_0104359 3300046506 Bacteria 1207
533 Ga0495606_0017761 3300046507 Bacteria 5363
534 Ga0495610_0221909 3300046512 Bacteria 763
535 Ga0495618_0391022 3300046514 Bacteria 852
536 Ga0495620_0094341 3300046515 Bacteria 1198
537 Ga0495628_0269666 3300046516 Bacteria 1266
538 Ga0495628_0868432 3300046516 Bacteria 628
539 Ga0495630_0060699 3300046517 Bacteria 2839
540 Ga0495632_0201304 3300046519 Bacteria 907
541 Ga0495637_0080732 3300046520 Bacteria 1297
542 Ga0495643_0136318 3300046522 Bacteria 1227
543 Ga0495643_0146309 3300046522 Bacteria 1174
544 Ga0495642_0341521 3300046528 Bacteria 658
545 Ga0495665_0508357 3300046531 Bacteria 607
546 Ga0495586_0256205 3300046535 Bacteria 999
547 Ga0495587_0257617 3300046536 Bacteria 980
548 Ga0495621_0105483 3300046539 Bacteria 1076
549 Ga0495597_0335892 3300046542 Bacteria 582
550 Ga0495645_0055113 3300046543 Bacteria 2887
551 Ga0495622_0078029 3300046557 Bacteria 1525
552 Ga0495633_0266016 3300046558 Bacteria 781
553 Ga0495668_0037916 3300046616 Bacteria 2695
554 Ga0495634_0073434 3300046642 Bacteria 2249
555 Ga0495611_0410626 3300046648 Bacteria 618
556 Ga0495625_0101034 3300046660 Bacteria 1981
557 Ga0495625_0260538 3300046660 Bacteria 1122
558 Ga0495635_0011655 3300046663 Bacteria 6161
559 Ga0495659_0098466 3300046664 Bacteria 1130
560 Ga0495588_0178063 3300046674 Bacteria 1124
561 Ga0495588_0241563 3300046674 Bacteria 953
562 Ga0495599_0472315 3300046678 Bacteria 741
563 Ga0495623_0216090 3300046679 Bacteria 1095
564 Ga0495647_0062032 3300046681 Bacteria 1477
565 Ga0495658_0062452 3300046683 Bacteria 2141
566 Ga0495658_0447513 3300046683 Bacteria 825
567 Ga0495613_0083242 3300046689 Bacteria 2323
568 Ga0495624_0606900 3300046690 Bacteria 652
569 Ga0495671_0291230 3300046692 Bacteria 786
570 Ga0495600_0723251 3300046809 Bacteria 597
571 Ga0495660_0295024 3300046810 Bacteria 737
572 Ga0495581_0005328 3300047315 Bacteria 7438
573 Ga0495604_0102281 3300047317 Bacteria 2103
574 Ga0495674_0710209 3300047319 Bacteria 788
575 Ga0495680_0136468 3300047322 Bacteria 1798
576 Ga0495675_0316367 3300047444 Bacteria 924
577 Ga0495673_0061590 3300047469 Bacteria 1606
578 Ga0495684_0002800 3300047471 Bacteria 13756
579 Ga0495686_0001344 3300047472 Bacteria 27524
580 Ga0495686_0004281 3300047472 Bacteria 11826
581 Ga0495686_0225129 3300047472 Bacteria 1065
582 Ga0495686_0324620 3300047472 Bacteria 843
583 Ga0495593_0035980 3300047673 Bacteria 2686
584 Ga0495602_0185756 3300048088 Bacteria 1599
585 Ga0495614_0202786 3300048089 Unclassified 898
586 Ga0495626_0068239 3300048091 Bacteria 1604
587 Ga0496100_0107400 3300048903 Bacteria 1933
588 Ga0496100_0697534 3300048903 Bacteria 792
589 Ga0496101_0458849 3300048904 Bacteria 1005
590 Ga0496101_0723962 3300048904 Bacteria 785
591 Ga0496102_0058945 3300048905 Bacteria 3509
592 Ga0496102_0119772 3300048905 Bacteria 2458
593 Ga0496102_0170368 3300048905 Bacteria 2050
594 Ga0496102_0442994 3300048905 Bacteria 1219
595 Ga0496102_0882466 3300048905 Bacteria 816
596 Ga0496102_1541362 3300048905 Unclassified 583
597 Ga0496103_0008600 3300048906 Bacteria 6062
598 Ga0496103_0451191 3300048906 Bacteria 825
599 Ga0496103_0561861 3300048906 Bacteria 728
600 Ga0496103_0752537 3300048906 Bacteria 616
601 Ga0496104_0112574 3300048907 Bacteria 2610
602 Ga0496104_0310483 3300048907 Bacteria 1490
603 Ga0496104_0430370 3300048907 Bacteria 1232
604 Ga0496106_0393733 3300048909 Bacteria 1113
605 Ga0496108_0092581 3300048911 Bacteria 2571
606 Ga0496109_0020806 3300048912 Bacteria 5796
607 Ga0496109_0028690 3300048912 Bacteria 4981
608 Ga0496109_0066496 3300048912 Bacteria 3301
609 Ga0496112_0100291 3300048915 Bacteria 2865
610 Ga0496112_0448721 3300048915 Bacteria 1227
611 Ga0496112_0753786 3300048915 Unclassified 900
612 Ga0496113_0482462 3300048916 Bacteria 996
613 Ga0496113_0528886 3300048916 Bacteria 946
614 Ga0496114_0932126 3300048917 Unclassified 750
615 Ga0496116_0241673 3300048919 Bacteria 906
616 Ga0496117_0012597 3300048920 Bacteria 7438
617 Ga0496117_0192772 3300048920 Bacteria 1159
618 Ga0496117_0196028 3300048920 Bacteria 1145
619 Ga0496117_0285939 3300048920 Bacteria 880
620 Ga0496118_0014194 3300048921 Bacteria 7470
621 Ga0496118_0137693 3300048921 Bacteria 1554
622 Ga0496118_0198803 3300048921 Bacteria 1190
623 Ga0496118_0401192 3300048921 Bacteria 712
624 Ga0496119_0028340 3300048922 Bacteria 3823
625 Ga0496119_0066026 3300048922 Bacteria 2140
626 Ga0496119_0104079 3300048922 Bacteria 1588
627 Ga0496119_0173112 3300048922 Bacteria 1138
628 Ga0496120_0012029 3300048923 Bacteria 5912
629 Ga0496120_0048852 3300048923 Bacteria 2432
630 Ga0496120_0051814 3300048923 Bacteria 2342
631 Ga0496121_0018609 3300048924 Bacteria 6993
632 Ga0496121_0022113 3300048924 Bacteria 6188
633 Ga0496121_0100452 3300048924 Bacteria 2233
634 Ga0496121_0101189 3300048924 Bacteria 2223
635 Ga0496121_0350131 3300048924 Bacteria 984
636 Ga0496121_0356028 3300048924 Bacteria 973
637 Ga0496121_0387884 3300048924 Bacteria 919
638 Ga0496121_0396726 3300048924 Bacteria 905
639 Ga0496122_0015031 3300048925 Bacteria 7432
640 Ga0496122_0028869 3300048925 Bacteria 4693
641 Ga0496123_0007272 3300048926 Bacteria 10506
642 Ga0496123_0228818 3300048926 Bacteria 932
643 Ga0496124_0016204 3300048927 Bacteria 7101
644 Ga0496124_0085986 3300048927 Bacteria 2575
645 Ga0496124_0216383 3300048927 Bacteria 1445
646 Ga0496125_0033654 3300048928 Bacteria 4531
647 Ga0496125_0168680 3300048928 Bacteria 1475
648 Ga0496125_0334344 3300048928 Bacteria 912
649 Ga0496126_0140886 3300048929 Bacteria 2076
650 Ga0496126_0289523 3300048929 Bacteria 1355
651 Ga0496126_0415484 3300048929 Bacteria 1088
652 Ga0496126_0441226 3300048929 Bacteria 1049
653 Ga0495682_0243807 3300049460 Bacteria 636
654 Ga0501031_0000029 3300049568 Bacteria 81284
655 Ga0501031_0070089 3300049568 Bacteria 2283
656 Ga0501031_0084502 3300049568 Bacteria 2069
657 Ga0501032_0000089 3300049569 Bacteria 79791
658 Ga0501032_0011660 3300049569 Bacteria 6301
659 Ga0501032_0084398 3300049569 Bacteria 2111
660 Ga0501033_0000105 3300049570 Bacteria 80985
661 Ga0501033_0151600 3300049570 Bacteria 1672
662 Ga0501033_0222085 3300049570 Bacteria 1344
663 Ga0501033_0372061 3300049570 Bacteria 999
664 Ga0501033_0443906 3300049570 Bacteria 902
665 Ga0501033_0475401 3300049570 Bacteria 866
666 Ga0501034_0000342 3300049571 Bacteria 81001
667 Ga0501034_0007978 3300049571 Bacteria 11240
668 Ga0501034_0024856 3300049571 Bacteria 6094
669 Ga0501034_0151383 3300049571 Bacteria 2295
670 Ga0501034_0241197 3300049571 Bacteria 1754
671 Ga0501036_0000041 3300049572 Bacteria 80998
672 Ga0501036_0002072 3300049572 Bacteria 15638
673 Ga0501037_0000101 3300049573 Bacteria 81001
674 Ga0501037_0004694 3300049573 Bacteria 9933
675 Ga0501037_0080821 3300049573 Bacteria 2357
676 Ga0501037_1008121 3300049573 Bacteria 542
677 Ga0501038_0000088 3300049574 Bacteria 78673
678 Ga0501038_0002514 3300049574 Bacteria 17083
679 Ga0501038_0795761 3300049574 Bacteria 703
680 Ga0501039_0000065 3300049575 Bacteria 81001
681 Ga0501039_0026529 3300049575 Bacteria 4451
682 Ga0501039_0144155 3300049575 Bacteria 1871
683 Ga0501039_0338487 3300049575 Bacteria 1182
684 Ga0501039_0418406 3300049575 Bacteria 1053
685 Ga0501040_0001670 3300049576 Bacteria 14189
686 Ga0501040_0304713 3300049576 Bacteria 1139
687 Ga0501043_0000568 3300049579 Bacteria 33011
688 Ga0501043_0001481 3300049579 Bacteria 20542
689 Ga0501043_0256957 3300049579 Bacteria 1344
690 Ga0501046_0003574 3300049580 Bacteria 14251
691 Ga0501046_0048867 3300049580 Bacteria 3348
692 Ga0501046_0108534 3300049580 Bacteria 2122
693 Ga0501047_0000615 3300049581 Bacteria 37668
694 Ga0501047_0006216 3300049581 Bacteria 11224
695 Ga0501047_0164252 3300049581 Bacteria 2091
696 Ga0501048_0055317 3300049582 Bacteria 2817
697 Ga0501068_0014704 3300049584 Bacteria 4478
698 Ga0501069_0008105 3300049585 Bacteria 5519
699 Ga0501069_0269288 3300049585 Bacteria 996
700 Ga0501070_0001300 3300049586 Bacteria 22407
701 Ga0501070_0009338 3300049586 Bacteria 8293
702 Ga0501070_0098294 3300049586 Bacteria 2421
703 Ga0501070_0284538 3300049586 Bacteria 1349
704 Ga0501070_0303802 3300049586 Bacteria 1300
705 Ga0501070_0517589 3300049586 Bacteria 957
706 Ga0501071_0163107 3300049587 Bacteria 1666
707 Ga0501072_0021978 3300049588 Bacteria 4949
708 Ga0501073_0001648 3300049589 Bacteria 16562
709 Ga0501073_0052202 3300049589 Bacteria 2863
710 Ga0501073_0912773 3300049589 Bacteria 605
711 Ga0501074_0035542 3300049590 Bacteria 3610
712 Ga0501080_0035601 3300049742 Bacteria 4646
713 Ga0501083_0001664 3300049744 Bacteria 15175
714 Ga0501083_0058877 3300049744 Bacteria 2570
715 Ga0501083_0560814 3300049744 Bacteria 743
716 Ga0501035_0000165 3300049822 Bacteria 81001
717 Ga0501035_0003791 3300049822 Bacteria 14401
718 Ga0501035_0770887 3300049822 Bacteria 770
719 Ga0501035_0787302 3300049822 Bacteria 760
720 Ga0501035_1224663 3300049822 Bacteria 581
721 Ga0501044_0000167 3300049823 Bacteria 81001
722 Ga0501044_0007044 3300049823 Bacteria 12368
723 Ga0501044_0295099 3300049823 Bacteria 1551
724 Ga0501044_0882804 3300049823 Bacteria 770
725 Ga0501045_0079174 3300049824 Bacteria 2423
726 Ga0501045_0252321 3300049824 Bacteria 1313
727 nmdc:mga03n38_107340_c1 3300050490 Bacteria 1355
728 nmdc:mga03n38_214573_c1 3300050490 Bacteria 1002
729 nmdc:mga00v17_57932_c1 3300050491 Bacteria 2371
730 nmdc:mga0yw44_161336_c1 3300050492 Bacteria 1468
731 nmdc:mga0yw44_202582_c1 3300050492 Bacteria 1311
732 nmdc:mga0yw44_261666_c1 3300050492 Bacteria 1153
733 nmdc:mga0yw44_30274_c1 3300050492 Bacteria 3134
734 nmdc:mga0yw44_37493_c1 3300050492 Bacteria 2862
735 nmdc:mga0yw44_43412_c1 3300050492 Bacteria 2684
736 nmdc:mga0yw44_8938_c1 3300050492 Bacteria 5027
737 nmdc:mga0k408_114395_c1 3300050493 Bacteria 1596
738 nmdc:mga0k408_691785_c1 3300050493 Bacteria 598
739 nmdc:mga0k408_82170_c1 3300050493 Bacteria 1030
740 nmdc:mga06z11_231456_c1 3300050494 Bacteria 1083
741 nmdc:mga06z11_657308_c1 3300050494 Bacteria 638
742 nmdc:mga06z11_92233_c1 3300050494 Bacteria 1647
743 nmdc:mga04h51_58806_c1 3300050495 Bacteria 1312
744 nmdc:mga07m45_206800_c1 3300050496 Bacteria 1142
745 nmdc:mga07m45_446929_c1 3300050496 Bacteria 750
746 nmdc:mga0qj67_26798_c1 3300050509 Bacteria 4463
747 nmdc:mga08y16_1124826_c1 3300050511 Bacteria 759
748 nmdc:mga0n895_1607365_c1 3300050512 Unclassified 614
749 nmdc:mga0n895_176379_c1 3300050512 Bacteria 2168
750 nmdc:mga0n895_67717_c1 3300050512 Bacteria 3536
751 nmdc:mga0n895_80940_c1 3300050512 Bacteria 3236
752 nmdc:mga0rr50_284255_c1 3300050513 Bacteria 1381
753 nmdc:mga0rr50_490755_c1 3300050513 Bacteria 1043
754 nmdc:mga0a205_1496505_c1 3300050515 Bacteria 523
755 nmdc:mga0sz30_101347_c1 3300050516 Bacteria 1258
756 nmdc:mga0sz30_228498_c1 3300050516 Bacteria 828
757 Ga0495601_0180054 3300053077 Bacteria 1382
758 Ga0495595_0279057 3300053084 Bacteria 839
759 Ga0495619_0002767 3300053085 Bacteria 11442
760 Ga0495619_0087807 3300053085 Bacteria 2103
761 Ga0500643_042229 3300053087 Bacteria 1335
762 Ga0500644_0025475 3300053088 Bacteria 1820
763 Ga0500644_0096976 3300053088 Bacteria 1114
764 Ga0500646_0133087 3300053090 Unclassified 810
765 Ga0500583_0276242 3300053092 Bacteria 826
766 Ga0500569_158614 3300053109 Bacteria 765
767 Ga0500594_0112269 3300053118 Bacteria 849
768 Ga0500658_0140858 3300053134 Bacteria 1081
769 Ga0500658_0150757 3300053134 Bacteria 1048
770 Ga0500568_0000166 3300053139 Bacteria 56994
771 Ga0500568_0350270 3300053139 Bacteria 535
772 Ga0500577_0128520 3300053142 Bacteria 1060
773 Ga0500577_0150934 3300053142 Bacteria 986
774 Ga0500590_026545 3300053148 Bacteria 3004
775 Ga0500604_0099341 3300053151 Bacteria 958
776 Ga0500616_0029126 3300053153 Bacteria 3040
777 Ga0500620_000133 3300053155 Bacteria 14871
778 Ga0500620_001817 3300053155 Bacteria 4085
779 Ga0500622_0001703 3300053156 Bacteria 17060
780 Ga0500627_0057098 3300053158 Bacteria 1711
781 Ga0500627_0116961 3300053158 Bacteria 1201
782 Ga0500636_0160856 3300053177 Bacteria 1224
783 Ga0500611_021544 3300053727 Bacteria 1231
784 Ga0500611_161785 3300053727 Bacteria 620
785 Ga0500645_010130 3300053730 Bacteria 3133
786 Ga0500601_045391 3300053737 Bacteria 540
787 Ga0501082_0007876 3300060353 Bacteria 9195
788 Ga0501082_1399874 3300060353 Bacteria 611
789 Ga0530510_0554289 3300061734 Bacteria 873
790 2503202913 2503198000 Bacteria 6884444
791 2509115366 2508501123 Bacteria 6283661
792 2509145262 2508501127 Bacteria 7037543
793 2509372310 2509276018 Bacteria 6910194
794 2509397395 2509276022 Bacteria 6200534
795 2512930271 2512875016 Bacteria 6529530
796 2513610063 2513237090 Bacteria 7096802
797 2514032836 2513237164 Bacteria 7563725
798 2514421137 2513237305 Bacteria 7293571
799 2514587121 2513237351 Bacteria 6968952
800 2585282937 2582581308 Bacteria 7413247
801 2585322477 2582581315 Bacteria 7318924
802 2585532430 2585427527 Bacteria 7273426
803 2585554553 2585427530 Bacteria 7383882
804 2588515920 2588253730 Bacteria 6881675
805 2597814471 2597489875 Bacteria 7010078
806 2599336085 2599185156 Bacteria 5403036
807 2599938220 2599185301 Bacteria 6161860
808 2616307500 2615840626 Bacteria 7921970
809 2616555046 2615840698 Bacteria 7319877
810 2617384327 2617270742 Bacteria 6808054
811 2643989679 2643221595 Bacteria 6565519
812 2644157710 2643221627 Bacteria 6761570
813 2671112279 2667528174 Bacteria 6435400
814 2688599764 2687453392 Bacteria 6880454
815 2694630558 2693429783 Bacteria 7019804
816 2694638937 2693429784 Bacteria 7241525
817 2723576542 2721755686 Bacteria 7343952
818 2756676030 2756170246 Bacteria 7451806
819 2770196226 2767802442 Bacteria 5747986
820 2778176110 2775507266 Bacteria 7392367
821 2792745937 2791355123 Bacteria 8049106
822 2819609502 2818991448 Bacteria 6772224
823 2819639600 2818991453 Bacteria 7181617
824 2838034702 2838029111 Bacteria 6603031
825 2842481405 2842475841 Bacteria 6603183
826 2842483289 2842482326 Bacteria 7212537
827 2842508349 2842502639 Bacteria 6604161
828 2842927502 2842922631 Bacteria 5824079
829 2844007072 2844002411 Bacteria 7168230
830 2844015052 2844009547 Bacteria 6728125
831 2847676173 2847670302 Bacteria 6165597
832 2847692812 2847686936 Bacteria 6278406
833 2856315959 2856314179 Bacteria 6477897
834 2856324763 2856320880 Bacteria 7263508
835 2856333043 2856328259 Bacteria 6528202
836 2856337599 2856334872 Bacteria 7037011
837 2856358215 2856356410 Bacteria 6297484
838 2856368676 2856364286 Bacteria 6939991
839 2857350436 2857349434 Bacteria 7926032
840 2857369882 2857367948 Bacteria 6965560
841 2869166854 2869162929 Bacteria 6399702
842 2869169950 2869169390 Bacteria 6659796
843 2869242063 2869234852 Bacteria 6654993
844 2869243063 2869242130 Bacteria 6609239
845 2869254284 2869249662 Bacteria 6868783
846 2869267981 2869264136 Bacteria 6880765
847 2869273461 2869271264 Bacteria 6908218
848 2869281246 2869278585 Bacteria 7077053
849 2869291171 2869285874 Bacteria 6901219
850 2871433451 2871429161 Bacteria 6547891
851 2871439225 2871435913 Bacteria 6880295
852 2871451928 2871444079 Bacteria 6423508
853 2871455078 2871451962 Bacteria 7336357
854 2871460537 2871459585 Bacteria 6866887
855 2871472463 2871466892 Bacteria 6923287
856 2871478735 2871474448 Bacteria 6806570
857 2871483465 2871481445 Bacteria 6700002
858 2871488991 2871488783 Bacteria 6929816
859 2871503139 2871495908 Bacteria 6935695
860 2874107141 2874102143 Bacteria 6342645
861 2874115639 2874109183 Bacteria 6517025
862 2874122959 2874116593 Bacteria 6674494
863 2874126140 2874123672 Bacteria 7238285
864 2874141088 2874139085 Bacteria 7021506
865 2874153052 2874146452 Bacteria 7533118
866 2874160317 2874155637 Bacteria 6724144
867 2874166168 2874162495 Bacteria 6174670
868 2874170216 2874168670 Bacteria 8062617
869 2876366164 2876363079 Bacteria 6544991
870 2876385700 2876377896 Bacteria 6565995
871 2876390940 2876386047 Bacteria 6698674
872 2876394828 2876392853 Bacteria 6660880
873 2876403444 2876399893 Bacteria 6927900
874 2876408738 2876406927 Bacteria 6191900
875 2876419343 2876413966 Bacteria 6831344
876 2876426602 2876420981 Bacteria 6687741
877 2878040227 2878035449 Bacteria 6555736
878 2878732838 2878730984 Bacteria 6380721
879 2878742871 2878738818 Bacteria 7136951
880 2878751062 2878745973 Bacteria 6867388
881 2878753754 2878753008 Bacteria 6922523
882 2878767028 2878760144 Bacteria 6823465
883 2878774226 2878767105 Bacteria 6898628
884 2878778107 2878774303 Bacteria 6108671
885 2878784245 2878781027 Bacteria 6834456
886 2881156502 2881155292 Bacteria 6461656
887 2881168156 2881161766 Bacteria 7127907
888 2881851538 2881845957 Bacteria 6611900
889 2881856533 2881853255 Bacteria 6698367
890 2881865797 2881861095 Bacteria 7128710
891 2882633341 2882632389 Bacteria 8154593
892 2885310029 2885305155 Bacteria 7348390
893 2885316767 2885312484 Bacteria 6415165
894 2885324136 2885318864 Bacteria 6729568
895 2885331517 2885326080 Bacteria 7134805
896 2885340274 2885334103 Bacteria 7216818
897 2885347501 2885342637 Bacteria 7011821
898 2885355065 2885350715 Bacteria 6787678
899 2888340950 2888337043 Bacteria 6629336
900 2888348152 2888343758 Bacteria 6611049
901 2888356395 2888350351 Bacteria 7372807
902 2889011309 2889010040 Bacteria 6749192
903 2889016963 2889016732 Bacteria 6700763
904 2889790766 2889790730 Bacteria 5689708
905 2889915149 2889914905 Bacteria 5702301
906 2903452368 2903448605 Bacteria 7357801
907 2903495651 2903492973 Bacteria 13473544
908 2903505754 2903492973 Bacteria 13473544
909 2903514150 2903513507 Bacteria 6344008
910 2903524032 2903521522 Bacteria 6525694
911 2903533785 2903528002 Bacteria 6586099
912 2903548328 2903540706 Bacteria 7062119
913 2904661459 2904659560 Bacteria 6685615
914 2906312925 2906308376 Bacteria 6841989
915 2906325637 2906321335 Bacteria 6579571
916 2906328942 2906328253 Bacteria 6585166
917 2906354298 2906354277 Bacteria 6991324
918 2906364448 2906363423 Bacteria 6856682
919 2906374601 2906370794 Bacteria 6881062
920 2906378093 2906378014 Bacteria 6911440
921 2906398767 2906393657 Bacteria 6790866
922 2906406700 2906401398 Bacteria 6693206
923 2906409469 2906408224 Bacteria 6162342
924 2906416096 2906414383 Bacteria 6580790
925 2919410766 2919408235 Bacteria 6149349
926 2922131870 2922130491 Bacteria 7173936
927 2922154563 2922151315 Bacteria 6902399
928 2922162643 2922158528 Bacteria 6573167
929 2922176523 2922172374 Bacteria 6167644
930 2922178670 2922178524 Bacteria 6025201
931 2922188260 2922185730 Bacteria 7113964
932 2922362749 2922361189 Bacteria 7436256
933 2924718731 2924710171 Bacteria 6752351
934 2924719441 2924718760 Bacteria 6331356
935 2924731567 2924726620 Bacteria 6271473
936 2924735005 2924733363 Bacteria 7574837
937 2924742797 2924741084 Bacteria 6661321
938 2924749933 2924748358 Bacteria 6154725
939 2924763416 2924762789 Bacteria 6561353
940 2924780671 2924776078 Bacteria 7492003
941 2924789894 2924784321 Bacteria 7416538
942 2937820845 2937813078 Bacteria 7783518
943 2937823561 2937822353 Bacteria 7290551
944 2937854359 2937848649 Bacteria 6983481
945 2937868013 2937861824 Bacteria 6660327
946 2937876299 2937868953 Bacteria 6639878
947 2937879831 2937877337 Bacteria 7246526
948 2937892407 2937891427 Bacteria 6357007
949 2937974574 2937972304 Bacteria 7532020
950 2937981166 2937980651 Bacteria 6517427
951 2938002152 2937994558 Bacteria 7036190
952 2938021942 2938014810 Bacteria 6700592
953 2939672511 2939669807 Bacteria 5028511
954 2958037208 2958034702 Bacteria 6989922
955 2958046920 2958041894 Bacteria 13082850
956 2958056264 2958041894 Bacteria 13082850
957 2958067434 2958064165 Bacteria 7158582
958 2958076833 2958071322 Bacteria 6815895
959 2958087009 2958084443 Bacteria 7312792
960 2958095647 2958092219 Bacteria 6861151
961 2958107606 2958100919 Bacteria 6800575
962 2958109848 2958108152 Bacteria 6681128
963 2958122121 2958115193 Bacteria 6923548
964 2958124550 2958122699 Bacteria 7280457
965 2958135572 2958130278 Bacteria 6897202
966 2958138615 2958137437 Bacteria 6050276
967 2958146722 2958144490 Bacteria 6677056
968 2958160077 2958158011 Bacteria 6058449
969 2958172206 2958165035 Bacteria 6906348
970 2958173648 2958172287 Bacteria 6716688
971 2958185063 2958179912 Bacteria 6874908
972 2961083330 2961077736 Bacteria 7079850
973 2961116611 2961114664 Bacteria 6680456
974 2961130970 2961127735 Bacteria 7196641
975 2961142583 2961136820 Bacteria 6775228
976 2961170654 2961163497 Bacteria 6901077
977 2961170941 2961170736 Bacteria 7072258
978 2961189245 2961183825 Bacteria 6688536
979 2963648960 2963644680 Bacteria 6530403
980 2965025401 2965018300 Bacteria 6883036
981 2965028010 2965025482 Bacteria 6532201
982 2965042660 2965040258 Bacteria 6855979
983 2965050373 2965047637 Bacteria 6623551
984 2965069361 2965062239 Bacteria 7412989
985 2965109375 2965102966 Bacteria 6800987
986 2965122597 2965119406 Bacteria 6956431
987 2968003521 2967996073 Bacteria 6787468
988 2968004287 2968003550 Bacteria 6929263
989 2968019974 2968016561 Bacteria 7022047
990 2968084148 2968083720 Bacteria 7351627
991 2968095930 2968091066 Bacteria 6052692
992 2968100378 2968097103 Bacteria 6107094
993 2968112518 2968110612 Bacteria 6814636
994 2968121293 2968117919 Bacteria 6536078
995 2968132240 2968128360 Bacteria 6270294
996 2968179040 2968171901 Bacteria 6894245
997 2970473295 2970469710 Bacteria 6969209
998 2970495417 2970489779 Bacteria 6517260
999 2970503531 2970503327 Bacteria 7099517
1000 2970514100 2970510686 Bacteria 7006402
1001 2970539070 2970532167 Bacteria 6553173
1002 2970544424 2970540015 Bacteria 6977556
1003 2970549158 2970547951 Bacteria 6931819
1004 2970561884 2970554993 Bacteria 6814252
1005 2970595850 2970593180 Bacteria 7073582
1006 2970622128 2970619444 Bacteria 6986144
1007 2970632920 2970627176 Bacteria 6680862
1008 2977822969 2977821940 Bacteria 6906439
1009 2977835025 2977828996 Bacteria 7007971
1010 2977849143 2977843712 Bacteria 6753583
1011 2977853144 2977851361 Bacteria 6694324
1012 2977859508 2977858184 Bacteria 6215359
1013 2977872365 2977864932 Bacteria 7534097
1014 2977875180 2977872689 Bacteria 7270173
1015 2977911182 2977907340 Bacteria 6577984
1016 2977919878 2977915119 Bacteria 6829656
1017 2977926772 2977922695 Bacteria 6956781
1018 2977941331 2977935797 Bacteria 6252826
1019 2977948147 2977942078 Bacteria 7570577
1020 2977957174 2977950692 Bacteria 6893264
1021 2977963503 2977957713 Bacteria 6877875
1022 2977989822 2977986579 Bacteria 6581278
1023 2979713826 2979710463 Bacteria 6785254
1024 2979749927 2979742915 Bacteria 7301278
1025 2979771389 2979764755 Bacteria 6610066
1026 2979775040 2979772303 Bacteria 6618277
1027 2979781869 2979779861 Bacteria 6219781
1028 2979815760 2979808191 Bacteria 7179355
1029 2987637622 2987636660 Bacteria 8088555
1030 2987645915 2987645492 Bacteria 6117018
1031 2987657929 2987652177 Bacteria 6969023
1032 2987666893 2987659509 Bacteria 6966464
1033 2987667757 2987666974 Bacteria 6509233
1034 2987676467 2987673487 Bacteria 6884027
1035 2996339223 2996336353 Bacteria 5511628
1036 2996342878 2996341866 Bacteria 6643098
1037 2996351514 2996348954 Bacteria 7239054
1038 2996389405 2996386984 Bacteria 6978667
1039 3000138890 3000135777 Bacteria 6891109
1040 3004170477 3004167301 Bacteria 8330599
1041 3004195897 3004188549 Bacteria 6952365
1042 3004201557 3004195979 Bacteria 6776956
1043 3004206056 3004203850 Bacteria 7307914
1044 3004215015 3004211236 Bacteria 7417683
1045 3004222394 3004218560 Bacteria 7421728
1046 3004239897 3004232784 Bacteria 6662140
1047 3004242427 3004239961 Bacteria 6892290
1048 3004251875 3004248173 Bacteria 6563236
1049 3004278214 3004275668 Bacteria 7114440
1050 3004293945 3004289098 Bacteria 6135450
1051 3004339868 3004334049 Bacteria 8449246
1052 3005418384 3005416602 Bacteria 7064308
1053 637080050 637000159 Bacteria 7596297
1054 649874270 649633066 Bacteria 6690028
1055 8004306854 8004300914 Bacteria 6132239
1056 8004367874 8004361976 Bacteria 6858373
1057 8004375325 8004374579 Bacteria 6898112
1058 8004390623 8004387939 Bacteria 7049250
1059 8004400172 8004395343 Bacteria 6620908
1060 8004447064 8004445564 Bacteria 6322258
1061 8004634259 8004633249 Bacteria 6723080
1062 8004642143 8004640170 Bacteria 6723001
1063 8004699758 8004695233 Bacteria 6731676
1064 8004713555 8004703790 Bacteria 8006957
1065 8004719183 8004714634 Bacteria 6776161
1066 8004733974 8004727605 Bacteria 6643904
1067 8005318724 8005314921 Bacteria 7072929
1068 8005488394 8005484373 Bacteria 6297373
1069 8005648863 8005645114 Bacteria 6950293
1070 8005682100 8005682033 Bacteria 6726518
1071 8024486915 8024486573 Bacteria 6540512
1072 8055622273 8055617313 Bacteria 7548464
1073 Ga0157375_10285223
1074 JGI24737J22298_10086342
1075 JGI25155J39150_1000012
1076 JGI25156J39149_1000049
1077 JGI25162J39368_1000409
1078 JGI25154J39366_1000033
1079 JGI25157J39369_1000055
1080 JGI25157J39369_1005196
1081 JGI25406J46586_10033808
1082 JGI25165J46597_1000451
1083 JGI25165J46597_1000751
1084 JGI25165J46597_1002590
1085 JGI25165J46597_1003128
1086 rootH1_10058850
1087 rootL2_10050130
1088 rootH1_10117942
1089 JGI25160J50197_1000006
1090 JGI25161J50226_1000004
1091 Ga0055529_1002835
1092 Ga0055531_10032276
1093 Ga0058692_1006656
1094 Ga0055543_1000002
1095 Ga0065165_1000217
1096 Ga0070676_10108950
1097 Ga0070676_10560885
1098 Ga0070683_100004415
1099 Ga0070683_100115544
1100 Ga0070690_100001109
1101 Ga0070690_100997503
1102 Ga0070670_100068469
1103 Ga0070670_101935719
1104 Ga0068869_100118429
1105 Ga0068869_100476543
1106 Ga0070666_10040691
1107 Ga0070682_100663079
1108 Ga0070682_101440986
1109 Ga0068868_100014124
1110 Ga0070660_100195945
1111 Ga0070660_100201365
1112 Ga0070689_100016865
1113 Ga0070689_100431153
1114 Ga0070689_102110629
1115 Ga0070687_100358863
1116 Ga0070661_100435917
1117 Ga0070661_100728618
1118 Ga0070692_10040382
1119 Ga0070692_10041040
1120 Ga0070668_100015632
1121 Ga0070668_100722745
1122 Ga0070675_100147408
1123 Ga0070675_100222426
1124 Ga0070671_100023742
1125 Ga0070674_100848085
1126 Ga0070673_100159902
1127 Ga0070688_100005647
1128 Ga0070659_100018986
1129 Ga0070659_100154474
1130 Ga0070667_100111726
1131 Ga0070667_100210007
1132 Ga0070703_10045652
1133 Ga0070709_10148714
1134 Ga0070709_10678779
1135 Ga0070714_100146762
1136 Ga0070714_100480131
1137 Ga0070713_100066016
1138 Ga0070710_10143648
1139 Ga0070701_10305264
1140 Ga0070711_100220000
1141 Ga0070711_100695741
1142 Ga0070694_100164050
1143 Ga0070708_100013164
1144 Ga0070663_100014018
1145 Ga0070663_100126962
1146 Ga0070678_100030078
1147 Ga0070678_100168676
1148 Ga0070662_100040770
1149 Ga0070662_100151828
1150 Ga0070662_101346805
1151 Ga0070681_10815339
1152 Ga0068867_100097316
1153 Ga0070685_10013532
1154 Ga0070706_100008686
1155 Ga0070706_100087810
1156 Ga0070706_100339940
1157 Ga0070706_100511836
1158 Ga0070698_100219263
1159 Ga0070699_100302304
1160 Ga0070699_100475769
1161 Ga0070679_100121532
1162 Ga0070679_100404757
1163 Ga0070684_100026463
1164 Ga0070684_100078473
1165 Ga0070684_100932386
1166 Ga0070697_100058870
1167 Ga0070697_101067127
1168 Ga0068853_100041286
1169 Ga0068853_100048352
1170 Ga0070672_100506080
1171 Ga0070672_101293921
1172 Ga0070695_100510040
1173 Ga0070696_100057561
1174 Ga0070696_100401647
1175 Ga0070693_100001562
1176 Ga0070693_100360508
1177 Ga0070693_100412388
1178 Ga0070693_100546376
1179 Ga0070665_100019496
1180 Ga0070665_100038818
1181 Ga0070665_100077971
1182 Ga0070665_100191236
1183 Ga0070665_101130126
1184 Ga0070704_101105291
1185 Ga0068855_100020260
1186 Ga0068855_101089338
1187 Ga0070664_100145227
1188 Ga0070664_100495691
1189 Ga0068857_100378897
1190 Ga0068854_100033267
1191 Ga0068854_100179420
1192 Ga0068854_100372752
1193 Ga0068854_100539130
1194 Ga0068854_100570293
1195 Ga0068856_100017550
1196 Ga0068856_100048373
1197 Ga0068856_100174500
1198 Ga0068856_100425180
1199 Ga0068856_100793777
1200 Ga0070702_100133744
1201 Ga0068852_100444254
1202 Ga0068852_100596356
1203 Ga0068852_100811565
1204 Ga0068859_100017209
1205 Ga0068859_100042947
1206 Ga0068864_100016950
1207 Ga0068866_10003917
1208 Ga0068861_100038431
1209 Ga0068861_100300440
1210 Ga0068851_10462369
1211 Ga0068870_10003953
1212 Ga0068870_10164082
1213 Ga0068863_100003402
1214 Ga0068863_100051797
1215 Ga0068858_100011123
1216 Ga0068860_100020171
1217 Ga0068860_100054850
1218 Ga0068860_100083677
1219 Ga0068862_100004166
1220 Ga0068862_100040969
1221 Ga0081455_10001675
1222 Ga0081455_10173948
1223 Ga0081455_10470213
1224 Ga0081540_1040542
1225 Ga0081540_1057821
1226 Ga0081539_10000618
1227 Ga0070717_10907771
1228 Ga0075365_10015498
1229 Ga0075365_10072207
1230 Ga0075365_10197970
1231 Ga0075365_10272444
1232 Ga0075365_10307663
1233 Ga0075365_10491806
1234 Ga0075365_10494289
1235 Ga0075368_10011941
1236 Ga0075368_10081928
1237 Ga0075363_100002924
1238 Ga0075363_100132179
1239 Ga0075363_100298334
1240 Ga0075363_100702781
1241 Ga0075364_10062267
1242 Ga0075364_10203047
1243 Ga0070715_10288158
1244 Ga0070716_100090595
1245 Ga0070716_101092972
1246 Ga0070712_100064468
1247 Ga0070712_100123228
1248 Ga0075362_10061619
1249 Ga0075362_10092666
1250 Ga0075367_10036831
1251 Ga0075367_10497286
1252 Ga0075369_10008375
1253 Ga0075369_10033384
1254 Ga0075369_10052739
1255 Ga0075366_10255203
1256 Ga0075366_10260231
1257 Ga0097621_100038513
1258 Ga0097621_100093240
1259 Ga0097621_101692877
1260 Ga0075370_10059181
1261 Ga0075370_10216447
1262 Ga0068871_100028765
1263 Ga0068871_100193854
1264 Ga0068871_101367831
1265 Ga0075428_101110063
1266 Ga0075428_101256105
1267 Ga0075428_101407786
1268 Ga0075433_10123825
1269 Ga0075434_100086846
1270 Ga0075434_100243109
1271 Ga0075434_100383731
1272 Ga0075434_101542761
1273 Ga0068865_100442734
1274 Ga0068865_101644105
1275 Ga0075436_100051706
1276 Ga0097620_100017209
1277 Ga0097620_100042945
1278 Ga0075435_100034557
1279 Ga0075435_100063062
1280 Ga0105251_10195264
1281 Ga0105240_10000019
1282 Ga0105240_10457028
1283 Ga0111539_10573542
1284 Ga0111539_10973472
1285 Ga0105245_10008787
1286 Ga0105245_10012249
1287 Ga0105245_10704444
1288 Ga0105247_10256876
1289 Ga0105247_10546399
1290 Ga0114129_10039195
1291 Ga0114129_10370718
1292 Ga0114129_10563610
1293 Ga0105243_10190745
1294 Ga0105241_10002809
1295 Ga0105241_10077444
1296 Ga0105241_10347763
1297 Ga0105241_10490484
1298 Ga0105242_10035997
1299 Ga0105242_10041919
1300 Ga0105248_10006767
1301 Ga0105248_10229862
1302 Ga0105248_11734653
1303 Ga0105237_10002910
1304 Ga0105237_10012671
1305 Ga0105237_10077167
1306 Ga0105237_10382410
1307 Ga0105237_10435300
1308 Ga0105237_10466562
1309 Ga0105237_11493899
1310 Ga0105238_10060166
1311 Ga0105238_10273171
1312 Ga0105238_11010446
1313 Ga0105249_10230499
1314 Ga0105249_11103659
1315 Ga0105249_12154987
1316 Ga0105239_10128194
1317 Ga0105239_10134799
1318 Ga0105239_10239237
1319 Ga0105239_10351218
1320 Ga0105239_10633232
1321 Ga0105239_10685589
1322 Ga0105239_10731283
1323 Ga0105246_10002739
1324 Ga0105246_10353557
1325 Ga0157373_10192573
1326 Ga0157370_10005600
1327 Ga0157370_10292468
1328 Ga0157370_10337594
1329 Ga0157370_10694780
1330 Ga0157369_10076560
1331 Ga0157369_10495572
1332 Ga0157369_10854730
1333 Ga0157374_10003517
1334 Ga0157374_11717190
1335 Ga0157378_10063609
1336 Ga0157378_12092061
1337 Ga0163162_10025504
1338 Ga0163162_10059392
1339 Ga0163162_10204780
1340 Ga0163162_10485167
1341 Ga0157372_10609250
1342 Ga0157375_10314707
1343 Ga0163163_10001121
1344 Ga0163163_10026152
1345 Ga0157380_10874693
1346 Ga0157380_12638696
1347 Ga0182008_10035672
1348 Ga0182008_10560614
1349 Ga0157377_10009889
1350 Ga0157377_10092924
1351 Ga0157379_10167803
1352 Ga0157379_10272786
1353 Ga0157376_10011305
1354 Ga0157376_10194108
1355 Ga0182007_10001799
1356 Ga0163161_10056365
1357 Ga0209435_100005
1358 Ga0207427_102108
1359 Ga0209437_100078
1360 Ga0209437_100174
1361 Ga0209646_1000011
1362 Ga0209646_1023495
1363 Ga0209026_1000002
1364 Ga0209026_1000008
1365 Ga0209677_100155
1366 Ga0209148_1000038
1367 Ga0209148_1016798
1368 Ga0209759_1000004
1369 Ga0209759_1000062
1370 Ga0209233_1000163
1371 Ga0209233_1000295
1372 Ga0209233_1000406
1373 Ga0209233_1000459
1374 Ga0209233_1021668
1375 Ga0209455_1000068
1376 Ga0209130_1000032
1377 Ga0209050_1003331
1378 Ga0207426_1000077
1379 Ga0209051_1038770
1380 Ga0209257_1000391
1381 Ga0207656_10225020
1382 Ga0207692_10039561
1383 Ga0207692_10090768
1384 Ga0207710_10077360
1385 Ga0207680_10015128
1386 Ga0207685_10059770
1387 Ga0207699_10040648
1388 Ga0207699_10327775
1389 Ga0207645_10025760
1390 Ga0207643_10023502
1391 Ga0207643_10124895
1392 Ga0207684_10038843
1393 Ga0207684_10084523
1394 Ga0207684_11277072
1395 Ga0207654_10014926
1396 Ga0207654_10159569
1397 Ga0207654_10335573
1398 Ga0207654_11374694
1399 Ga0207707_10056150
1400 Ga0207707_10472017
1401 Ga0207695_10000049
1402 Ga0207695_10175437
1403 Ga0207695_11099778
1404 Ga0207671_10000107
1405 Ga0207671_10049865
1406 Ga0207671_10060840
1407 Ga0207671_10388757
1408 Ga0207693_10000558
1409 Ga0207693_10051017
1410 Ga0207663_10168312
1411 Ga0207660_10442138
1412 Ga0207657_10014392
1413 Ga0207657_10113296
1414 Ga0207657_10177322
1415 Ga0207649_10606028
1416 Ga0207649_10812270
1417 Ga0207652_10132651
1418 Ga0207646_10001541
1419 Ga0207694_10035236
1420 Ga0207694_10446700
1421 Ga0207650_10000477
1422 Ga0207650_10083345
1423 Ga0207650_10435903
1424 Ga0207659_10213861
1425 Ga0207659_10230444
1426 Ga0207687_10001595
1427 Ga0207687_10025741
1428 Ga0207700_10001422
1429 Ga0207700_10305806
1430 Ga0207664_10000296
1431 Ga0207664_10466015
1432 Ga0207644_10002914
1433 Ga0207644_10118116
1434 Ga0207706_10027114
1435 Ga0207706_10089484
1436 Ga0207686_10006016
1437 Ga0207686_10334137
1438 Ga0207709_10227160
1439 Ga0207670_10031179
1440 Ga0207670_10283678
1441 Ga0207704_10072663
1442 Ga0207665_10106835
1443 Ga0207665_10132494
1444 Ga0207665_11106381
1445 Ga0207691_10297604
1446 Ga0207711_10004034
1447 Ga0207711_10054658
1448 Ga0207711_10448455
1449 Ga0207689_10031989
1450 Ga0207689_10660630
1451 Ga0207661_10473456
1452 Ga0207679_10037522
1453 Ga0207679_10316884
1454 Ga0207667_10079509
1455 Ga0207667_10080403
1456 Ga0207667_10606848
1457 Ga0207651_10370449
1458 Ga0207712_10433228
1459 Ga0207668_10003707
1460 Ga0207668_10027672
1461 Ga0207668_11430096
1462 Ga0207640_10008587
1463 Ga0207640_10012091
1464 Ga0207640_10059253
1465 Ga0207640_10072069
1466 Ga0207640_10344320
1467 Ga0207640_10987061
1468 Ga0207658_10052756
1469 Ga0207658_10094354
1470 Ga0207658_10914940
1471 Ga0207677_10000248
1472 Ga0207677_10381933
1473 Ga0207703_10001121
1474 Ga0207703_10079383
1475 Ga0207639_10811518
1476 Ga0207678_10002052
1477 Ga0207678_10042892
1478 Ga0207678_10389641
1479 Ga0207678_10466427
1480 Ga0207678_10638271
1481 Ga0207678_10761691
1482 Ga0207702_10015468
1483 Ga0207702_10072567
1484 Ga0207702_10313993
1485 Ga0207702_10517488
1486 Ga0207641_10021168
1487 Ga0207641_10186488
1488 Ga0207641_11265584
1489 Ga0207648_10056634
1490 Ga0207648_10102140
1491 Ga0207676_10000469
1492 Ga0207676_10009086
1493 Ga0207674_10024745
1494 Ga0207674_10080475
1495 Ga0207674_10599445
1496 Ga0207675_100056894
1497 Ga0207675_100283481
1498 Ga0207675_100550380
1499 Ga0207683_10000360
1500 Ga0207683_10019671
1501 Ga0207683_10572015
1502 Ga0207683_10600782
1503 Ga0207698_10370471
1504 Ga0209371_1002352
1505 Ga0209813_10052941
1506 Ga0209813_10095870
1507 Ga0268266_10025564
1508 Ga0268266_10028161
1509 Ga0268266_10049048
1510 Ga0268266_10124597
1511 Ga0268266_10404969
1512 Ga0268266_11396610
1513 Ga0268265_10003500
1514 Ga0268265_10049071
1515 Ga0268264_10056516
1516 Ga0268264_10971504
1517 Ga0265318_10018055
1518 Ga0268256_1001392
1519 Ga0265320_10268405
1520 Ga0265340_10022597
1521 Ga0265339_10024295
1522 Ga0265316_10412068
1523 Ga0265314_10012601
1524 Ga0265342_10088083
1525 Ga0307516_10725376
1526 Ga0307409_101612142
1527 Ga0307411_10369021
1528 Ga0307415_101332403
1529 Ga0307415_101674920
1530 Ga0307510_10290443
1531 Ga0373926_0121389
1532 Ga0373934_0013305
1533 Ga0373944_0060322
1534 Ga0373923_0043909
1535 Ga0373936_0154063
1536 Ga0373957_0155392
1537 Ga0373943_0012736
1538 Ga0373943_0437342
1539 Ga0373955_0137627
1540 Ga0316574_0175533
1541 Ga0316574_0195944
1542 Ga0373931_0847727
1543 Ga0373935_0072789
1544 Ga0373935_1470185
1545 Ga0373927_0077959
1546 Ga0373927_0286186
1547 Ga0373933_0393421
1548 Ga0373947_0018394
1549 Ga0373947_0079611
1550 Ga0373947_0440315
1551 Ga0373937_0032518
1552 Ga0373937_0376865
1553 Ga0373925_0039450
1554 Ga0373925_0173837
1555 Ga0373925_0491564
1556 Ga0395899_0080802
1557 Ga0395900_0077724
1558 Ga0395900_0439240
1559 Ga0395900_0450508
1560 Ga0395900_0494426
1561 Ga0395898_0325883
1562 Ga0395898_0415077
1563 Ga0395905_0002511
1564 Ga0395905_0081298
1565 Ga0395905_0550179
1566 Ga0395901_0224404
1567 Ga0395901_0237617
1568 Ga0400483_050340
1569 Ga0439465_0111548
1570 Ga0439465_0275238
1571 Ga0451791_1047365
1572 Ga0451791_1794651
1573 Ga0451851_1330176
1574 Ga0451853_0507671
1575 Ga0439458_0043656
1576 Ga0466965_0115597
1577 Ga0466963_0146131
1578 Ga0453684_1268054
1579 Ga0466970_0055250
1580 Ga0466957_0086720
1581 Ga0466958_0171889
1582 Ga0466967_0027095
1583 Ga0466967_0191984
1584 Ga0495617_136699
1585 Ga0495603_0118140
1586 Ga0495603_0310118
1587 Ga0495629_0082150
1588 Ga0495629_0679695
1589 Ga0495629_0761145
1590 Ga0495638_0076719
1591 Ga0495638_0149918
1592 Ga0495651_0107051
1593 Ga0495650_0068952
1594 Ga0495580_0062266
1595 Ga0495580_0150420
1596 Ga0495580_0306180
1597 Ga0495582_0176866
1598 Ga0495639_0005383
1599 Ga0495662_0053229
1600 Ga0495662_0428280
1601 Ga0495664_0130979
1602 Ga0495664_0536136
1603 Ga0495584_0169388
1604 Ga0495583_0104359
1605 Ga0495606_0017761
1606 Ga0495610_0221909
1607 Ga0495618_0391022
1608 Ga0495620_0094341
1609 Ga0495628_0269666
1610 Ga0495628_0868432
1611 Ga0495630_0060699
1612 Ga0495632_0201304
1613 Ga0495637_0080732
1614 Ga0495643_0136318
1615 Ga0495643_0146309
1616 Ga0495642_0341521
1617 Ga0495665_0508357
1618 Ga0495586_0256205
1619 Ga0495587_0257617
1620 Ga0495621_0105483
1621 Ga0495597_0335892
1622 Ga0495645_0055113
1623 Ga0495622_0078029
1624 Ga0495633_0266016
1625 Ga0495668_0037916
1626 Ga0495634_0073434
1627 Ga0495611_0410626
1628 Ga0495625_0101034
1629 Ga0495625_0260538
1630 Ga0495635_0011655
1631 Ga0495659_0098466
1632 Ga0495588_0178063
1633 Ga0495588_0241563
1634 Ga0495599_0472315
1635 Ga0495623_0216090
1636 Ga0495647_0062032
1637 Ga0495658_0062452
1638 Ga0495658_0447513
1639 Ga0495613_0083242
1640 Ga0495624_0606900
1641 Ga0495671_0291230
1642 Ga0495600_0723251
1643 Ga0495660_0295024
1644 Ga0495581_0005328
1645 Ga0495604_0102281
1646 Ga0495674_0710209
1647 Ga0495680_0136468
1648 Ga0495675_0316367
1649 Ga0495673_0061590
1650 Ga0495684_0002800
1651 Ga0495686_0001344
1652 Ga0495686_0004281
1653 Ga0495686_0225129
1654 Ga0495686_0324620
1655 Ga0495593_0035980
1656 Ga0495602_0185756
1657 Ga0495614_0202786
1658 Ga0495626_0068239
1659 Ga0496100_0107400
1660 Ga0496100_0697534
1661 Ga0496101_0458849
1662 Ga0496101_0723962
1663 Ga0496102_0058945
1664 Ga0496102_0119772
1665 Ga0496102_0170368
1666 Ga0496102_0442994
1667 Ga0496102_0882466
1668 Ga0496102_1541362
1669 Ga0496103_0008600
1670 Ga0496103_0451191
1671 Ga0496103_0561861
1672 Ga0496103_0752537
1673 Ga0496104_0112574
1674 Ga0496104_0310483
1675 Ga0496104_0430370
1676 Ga0496106_0393733
1677 Ga0496108_0092581
1678 Ga0496109_0020806
1679 Ga0496109_0028690
1680 Ga0496109_0066496
1681 Ga0496112_0100291
1682 Ga0496112_0448721
1683 Ga0496112_0753786
1684 Ga0496113_0482462
1685 Ga0496113_0528886
1686 Ga0496114_0932126
1687 Ga0496116_0241673
1688 Ga0496117_0012597
1689 Ga0496117_0192772
1690 Ga0496117_0196028
1691 Ga0496117_0285939
1692 Ga0496118_0014194
1693 Ga0496118_0137693
1694 Ga0496118_0198803
1695 Ga0496118_0401192
1696 Ga0496119_0028340
1697 Ga0496119_0066026
1698 Ga0496119_0104079
1699 Ga0496119_0173112
1700 Ga0496120_0012029
1701 Ga0496120_0048852
1702 Ga0496120_0051814
1703 Ga0496121_0018609
1704 Ga0496121_0022113
1705 Ga0496121_0100452
1706 Ga0496121_0101189
1707 Ga0496121_0350131
1708 Ga0496121_0356028
1709 Ga0496121_0387884
1710 Ga0496121_0396726
1711 Ga0496122_0015031
1712 Ga0496122_0028869
1713 Ga0496123_0007272
1714 Ga0496123_0228818
1715 Ga0496124_0016204
1716 Ga0496124_0085986
1717 Ga0496124_0216383
1718 Ga0496125_0033654
1719 Ga0496125_0168680
1720 Ga0496125_0334344
1721 Ga0496126_0140886
1722 Ga0496126_0289523
1723 Ga0496126_0415484
1724 Ga0496126_0441226
1725 Ga0495682_0243807
1726 Ga0501031_0000029
1727 Ga0501031_0070089
1728 Ga0501031_0084502
1729 Ga0501032_0000089
1730 Ga0501032_0011660
1731 Ga0501032_0084398
1732 Ga0501033_0000105
1733 Ga0501033_0151600
1734 Ga0501033_0222085
1735 Ga0501033_0372061
1736 Ga0501033_0443906
1737 Ga0501033_0475401
1738 Ga0501034_0000342
1739 Ga0501034_0007978
1740 Ga0501034_0024856
1741 Ga0501034_0151383
1742 Ga0501034_0241197
1743 Ga0501036_0000041
1744 Ga0501036_0002072
1745 Ga0501037_0000101
1746 Ga0501037_0004694
1747 Ga0501037_0080821
1748 Ga0501037_1008121
1749 Ga0501038_0000088
1750 Ga0501038_0002514
1751 Ga0501038_0795761
1752 Ga0501039_0000065
1753 Ga0501039_0026529
1754 Ga0501039_0144155
1755 Ga0501039_0338487
1756 Ga0501039_0418406
1757 Ga0501040_0001670
1758 Ga0501040_0304713
1759 Ga0501043_0000568
1760 Ga0501043_0001481
1761 Ga0501043_0256957
1762 Ga0501046_0003574
1763 Ga0501046_0048867
1764 Ga0501046_0108534
1765 Ga0501047_0000615
1766 Ga0501047_0006216
1767 Ga0501047_0164252
1768 Ga0501048_0055317
1769 Ga0501068_0014704
1770 Ga0501069_0008105
1771 Ga0501069_0269288
1772 Ga0501070_0001300
1773 Ga0501070_0009338
1774 Ga0501070_0098294
1775 Ga0501070_0284538
1776 Ga0501070_0303802
1777 Ga0501070_0517589
1778 Ga0501071_0163107
1779 Ga0501072_0021978
1780 Ga0501073_0001648
1781 Ga0501073_0052202
1782 Ga0501073_0912773
1783 Ga0501074_0035542
1784 Ga0501080_0035601
1785 Ga0501083_0001664
1786 Ga0501083_0058877
1787 Ga0501083_0560814
1788 Ga0501035_0000165
1789 Ga0501035_0003791
1790 Ga0501035_0770887
1791 Ga0501035_0787302
1792 Ga0501035_1224663
1793 Ga0501044_0000167
1794 Ga0501044_0007044
1795 Ga0501044_0295099
1796 Ga0501044_0882804
1797 Ga0501045_0079174
1798 Ga0501045_0252321
1799 nmdc:mga03n38_107340_c1
1800 nmdc:mga03n38_214573_c1
1801 nmdc:mga00v17_57932_c1
1802 nmdc:mga0yw44_161336_c1
1803 nmdc:mga0yw44_202582_c1
1804 nmdc:mga0yw44_261666_c1
1805 nmdc:mga0yw44_30274_c1
1806 nmdc:mga0yw44_37493_c1
1807 nmdc:mga0yw44_43412_c1
1808 nmdc:mga0yw44_8938_c1
1809 nmdc:mga0k408_114395_c1
1810 nmdc:mga0k408_691785_c1
1811 nmdc:mga0k408_82170_c1
1812 nmdc:mga06z11_231456_c1
1813 nmdc:mga06z11_657308_c1
1814 nmdc:mga06z11_92233_c1
1815 nmdc:mga04h51_58806_c1
1816 nmdc:mga07m45_206800_c1
1817 nmdc:mga07m45_446929_c1
1818 nmdc:mga0qj67_26798_c1
1819 nmdc:mga08y16_1124826_c1
1820 nmdc:mga0n895_1607365_c1
1821 nmdc:mga0n895_176379_c1
1822 nmdc:mga0n895_67717_c1
1823 nmdc:mga0n895_80940_c1
1824 nmdc:mga0rr50_284255_c1
1825 nmdc:mga0rr50_490755_c1
1826 nmdc:mga0a205_1496505_c1
1827 nmdc:mga0sz30_101347_c1
1828 nmdc:mga0sz30_228498_c1
1829 Ga0495601_0180054
1830 Ga0495595_0279057
1831 Ga0495619_0002767
1832 Ga0495619_0087807
1833 Ga0500643_042229
1834 Ga0500644_0025475
1835 Ga0500644_0096976
1836 Ga0500646_0133087
1837 Ga0500583_0276242
1838 Ga0500569_158614
1839 Ga0500594_0112269
1840 Ga0500658_0140858
1841 Ga0500658_0150757
1842 Ga0500568_0000166
1843 Ga0500568_0350270
1844 Ga0500577_0128520
1845 Ga0500577_0150934
1846 Ga0500590_026545
1847 Ga0500604_0099341
1848 Ga0500616_0029126
1849 Ga0500620_000133
1850 Ga0500620_001817
1851 Ga0500622_0001703
1852 Ga0500627_0057098
1853 Ga0500627_0116961
1854 Ga0500636_0160856
1855 Ga0500611_021544
1856 Ga0500611_161785
1857 Ga0500645_010130
1858 Ga0500601_045391
1859 Ga0501082_0007876
1860 Ga0501082_1399874
1861 Ga0530510_0554289
1862 2503202913
1863 2509115366
1864 2509145262
1865 2509372310
1866 2509397395
1867 2512930271
1868 2513610063
1869 2514032836
1870 2514421137
1871 2514587121
1872 2585282937
1873 2585322477
1874 2585532430
1875 2585554553
1876 2588515920
1877 2597814471
1878 2599336085
1879 2599938220
1880 2616307500
1881 2616555046
1882 2617384327
1883 2643989679
1884 2644157710
1885 2671112279
1886 2688599764
1887 2694630558
1888 2694638937
1889 2723576542
1890 2756676030
1891 2770196226
1892 2778176110
1893 2792745937
1894 2819609502
1895 2819639600
1896 2838034702
1897 2842481405
1898 2842483289
1899 2842508349
1900 2842927502
1901 2844007072
1902 2844015052
1903 2847676173
1904 2847692812
1905 2856315959
1906 2856324763
1907 2856333043
1908 2856337599
1909 2856358215
1910 2856368676
1911 2857350436
1912 2857369882
1913 2869166854
1914 2869169950
1915 2869242063
1916 2869243063
1917 2869254284
1918 2869267981
1919 2869273461
1920 2869281246
1921 2869291171
1922 2871433451
1923 2871439225
1924 2871451928
1925 2871455078
1926 2871460537
1927 2871472463
1928 2871478735
1929 2871483465
1930 2871488991
1931 2871503139
1932 2874107141
1933 2874115639
1934 2874122959
1935 2874126140
1936 2874141088
1937 2874153052
1938 2874160317
1939 2874166168
1940 2874170216
1941 2876366164
1942 2876385700
1943 2876390940
1944 2876394828
1945 2876403444
1946 2876408738
1947 2876419343
1948 2876426602
1949 2878040227
1950 2878732838
1951 2878742871
1952 2878751062
1953 2878753754
1954 2878767028
1955 2878774226
1956 2878778107
1957 2878784245
1958 2881156502
1959 2881168156
1960 2881851538
1961 2881856533
1962 2881865797
1963 2882633341
1964 2885310029
1965 2885316767
1966 2885324136
1967 2885331517
1968 2885340274
1969 2885347501
1970 2885355065
1971 2888340950
1972 2888348152
1973 2888356395
1974 2889011309
1975 2889016963
1976 2889790766
1977 2889915149
1978 2903452368
1979 2903495651
1980 2903505754
1981 2903514150
1982 2903524032
1983 2903533785
1984 2903548328
1985 2904661459
1986 2906312925
1987 2906325637
1988 2906328942
1989 2906354298
1990 2906364448
1991 2906374601
1992 2906378093
1993 2906398767
1994 2906406700
1995 2906409469
1996 2906416096
1997 2919410766
1998 2922131870
1999 2922154563
2000 2922162643
2001 2922176523
2002 2922178670
2003 2922188260
2004 2922362749
2005 2924718731
2006 2924719441
2007 2924731567
2008 2924735005
2009 2924742797
2010 2924749933
2011 2924763416
2012 2924780671
2013 2924789894
2014 2937820845
2015 2937823561
2016 2937854359
2017 2937868013
2018 2937876299
2019 2937879831
2020 2937892407
2021 2937974574
2022 2937981166
2023 2938002152
2024 2938021942
2025 2939672511
2026 2958037208
2027 2958046920
2028 2958056264
2029 2958067434
2030 2958076833
2031 2958087009
2032 2958095647
2033 2958107606
2034 2958109848
2035 2958122121
2036 2958124550
2037 2958135572
2038 2958138615
2039 2958146722
2040 2958160077
2041 2958172206
2042 2958173648
2043 2958185063
2044 2961083330
2045 2961116611
2046 2961130970
2047 2961142583
2048 2961170654
2049 2961170941
2050 2961189245
2051 2963648960
2052 2965025401
2053 2965028010
2054 2965042660
2055 2965050373
2056 2965069361
2057 2965109375
2058 2965122597
2059 2968003521
2060 2968004287
2061 2968019974
2062 2968084148
2063 2968095930
2064 2968100378
2065 2968112518
2066 2968121293
2067 2968132240
2068 2968179040
2069 2970473295
2070 2970495417
2071 2970503531
2072 2970514100
2073 2970539070
2074 2970544424
2075 2970549158
2076 2970561884
2077 2970595850
2078 2970622128
2079 2970632920
2080 2977822969
2081 2977835025
2082 2977849143
2083 2977853144
2084 2977859508
2085 2977872365
2086 2977875180
2087 2977911182
2088 2977919878
2089 2977926772
2090 2977941331
2091 2977948147
2092 2977957174
2093 2977963503
2094 2977989822
2095 2979713826
2096 2979749927
2097 2979771389
2098 2979775040
2099 2979781869
2100 2979815760
2101 2987637622
2102 2987645915
2103 2987657929
2104 2987666893
2105 2987667757
2106 2987676467
2107 2996339223
2108 2996342878
2109 2996351514
2110 2996389405
2111 3000138890
2112 3004170477
2113 3004195897
2114 3004201557
2115 3004206056
2116 3004215015
2117 3004222394
2118 3004239897
2119 3004242427
2120 3004251875
2121 3004278214
2122 3004293945
2123 3004339868
2124 3005418384
2125 637080050
2126 649874270
2127 8004306854
2128 8004367874
2129 8004375325
2130 8004390623
2131 8004400172
2132 8004447064
2133 8004634259
2134 8004642143
2135 8004699758
2136 8004713555
2137 8004719183
2138 8004733974
2139 8005318724
2140 8005488394
2141 8005648863
2142 8005682100
2143 8024486915
2144 8055622273

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05025

RbsD_FucU

RbsD / FucU transport protein family

25

168

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ob5-assembly1.cif.gz_A-2 crystal structure of protein atu2016, putative sugar binding protein 0.9303 1 142
2ob5-assembly1.cif.gz_A-2 crystal structure of protein atu2016, putative sugar binding protein 0.8995 1 142
3mvk-assembly1.cif.gz_G the crystal structure of fucu from bifidobacterium longum to 1.65a 0.8729 5 142
3mvk-assembly5.cif.gz_D the crystal structure of fucu from bifidobacterium longum to 1.65a 0.8623 5 142
3mvk-assembly5.cif.gz_D the crystal structure of fucu from bifidobacterium longum to 1.65a 0.8452 5 142
ID Description Score Start End Superfamily
2ob5A00 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.8934 1 142 3.40.1650.10
2ob5A00 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.8697 1 142 3.40.1650.10
4a34B01 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.8494 10 139 3.40.1650.10
4a34B01 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.8433 10 139 3.40.1650.10
3mvkF01 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.8223 10 139 3.40.1650.10
ID Description Score Start End GO Terms
AF-A0A2N7S7P9-F1-model_v4 deleted 0.9836 72 146
AF-A0A160UX95-F1-model_v4 deleted 0.9696 72 141
AF-A0A2N7S7P9-F1-model_v4 deleted 0.9585 72 146
AF-A0A160UX95-F1-model_v4 deleted 0.9435 72 141
AF-A0A4R3X7S5-F1-model_v4 L-fucose mutarotase 0.9365 1 145 GO:0006004
GO:0016857
GO:0036065
GO:0042806
GO:0062193

Map