F489490
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1071 | 397 | 2142 | 170 |
Family's Representative Sequence
| Representative Sequence | 3300041411|Ga0439466_0026358|Ga0439466_0026358_342_905 |
| Length | 187 |
| Sequence | MAFRRAQGWLECAVMAEPVAGKRAGKVLMLLAWAAGLFLATRYFGDWEDRQQNPNTVVTSQHRDGFIEVQLASNRQGHFVSSGQINGRAVQFLIDTGATDVAVPGELAQSLGLRRGLSVMVGTANGMSQGFRTTLERLQLGDIVLRDVRALIAPGLDGEQVLLGMSAMKQLEFTQRGGTLLLRQSTK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 22 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 23 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 24 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 25 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 26 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 27 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 28 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 29 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 36 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 44 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 45 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 46 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 47 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 67 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 68 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 75 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 77 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 78 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 79 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 80 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 81 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 82 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 83 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 84 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 85 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 86 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 87 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 88 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 89 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 90 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 91 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 92 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 93 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 94 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 95 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 96 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 97 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 98 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 99 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 100 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 101 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 102 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 103 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 104 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 105 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 106 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 107 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 108 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 109 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 110 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 111 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 112 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 113 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 114 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 115 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 116 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 117 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 118 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 119 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 120 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 121 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 122 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 203 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 204 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 205 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 206 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 208 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 209 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 210 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 211 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 212 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 213 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 214 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 215 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 216 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 217 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 218 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 219 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 220 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 221 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 222 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 228 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 229 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 230 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 231 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 233 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 234 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 235 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 236 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 237 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 238 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 239 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 240 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 241 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 242 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 243 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 244 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 245 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 246 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 247 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 248 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 249 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 250 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 251 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 252 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 253 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 254 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 255 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 256 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 257 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 258 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 259 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 260 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 261 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 262 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 263 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 264 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 265 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 266 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 267 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 268 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 269 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 270 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 271 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 272 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 273 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 274 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 275 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 276 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 277 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 278 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 279 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 280 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 281 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 282 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 283 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 284 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 285 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 286 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 287 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 288 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 289 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 290 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 291 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 292 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 293 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 294 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 295 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 296 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 297 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 298 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 299 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 300 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 301 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 302 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 303 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 304 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 305 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 306 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 307 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 308 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 309 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 310 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 311 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 312 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 313 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 314 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 315 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 316 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 317 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 318 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 319 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 320 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 321 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 322 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 323 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 324 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 325 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 326 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 327 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 328 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 329 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 330 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 331 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 332 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 333 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 334 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 335 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 336 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 337 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 338 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 339 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 340 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 341 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 342 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 343 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 344 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 345 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 346 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 347 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 348 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 349 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 350 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 351 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 352 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 353 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 354 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 355 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 356 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 357 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 358 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 359 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 360 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 361 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 362 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 363 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 364 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 365 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 366 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 367 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 368 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 369 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 370 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 371 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 372 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 373 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 374 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 375 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 376 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 377 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 378 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 379 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 380 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 381 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 382 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 383 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 384 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 385 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 386 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 387 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 388 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 389 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 390 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 391 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 392 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 393 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 394 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 395 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 396 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 397 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.78 |
| Metatranscriptomes | 0 |
| Isolates | 15.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.3 |
| Nodule | 2.52 |
| Rhizoplane | 4.76 |
| Rhizosphere | 75.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439466_0026358 | 3300041411 | Bacteria | 2022 |
| 2 | MRS2a_Contig_25754 | 2124908027 | Bacteria | 1015 |
| 3 | MRS2a_Contig_87 | 2124908027 | Bacteria | 56496 |
| 4 | SwRhRL2b_contig_823445 | 2162886007 | Bacteria | 1760 |
| 5 | MRS1b_contig_7023920 | 2162886011 | Bacteria | 1667 |
| 6 | JGI25162J39368_1000182 | 3300002737 | Bacteria | 67382 |
| 7 | JGI25163J39215_1000321 | 3300002771 | Bacteria | 16005 |
| 8 | JGI25164J39214_1000148 | 3300002772 | Bacteria | 67382 |
| 9 | JGI25165J46597_1000268 | 3300003214 | Bacteria | 67382 |
| 10 | Ga0055536_1000236 | 3300003781 | Bacteria | 44432 |
| 11 | Ga0055536_1001317 | 3300003781 | Bacteria | 15222 |
| 12 | Ga0055536_1019163 | 3300003781 | Bacteria | 2162 |
| 13 | Ga0055530_10000306 | 3300003791 | Bacteria | 44433 |
| 14 | Ga0055530_10001752 | 3300003791 | Bacteria | 15179 |
| 15 | Ga0055540_1000206 | 3300003792 | Bacteria | 56925 |
| 16 | Ga0055540_1000419 | 3300003792 | Bacteria | 34104 |
| 17 | Ga0055540_1000474 | 3300003792 | Bacteria | 30974 |
| 18 | Ga0055531_10000477 | 3300003794 | Bacteria | 37014 |
| 19 | Ga0065714_10000019 | 3300005288 | Bacteria | 19369 |
| 20 | Ga0065714_10011662 | 3300005288 | Bacteria | 3508 |
| 21 | Ga0065714_10012738 | 3300005288 | Bacteria | 2074 |
| 22 | Ga0065714_10034416 | 3300005288 | Bacteria | 848 |
| 23 | Ga0065714_10087154 | 3300005288 | Bacteria | 2068 |
| 24 | Ga0065714_10287869 | 3300005288 | Bacteria | 710 |
| 25 | Ga0065704_10003413 | 3300005289 | Bacteria | 4450 |
| 26 | Ga0065704_10012074 | 3300005289 | Bacteria | 1780 |
| 27 | Ga0065704_10082686 | 3300005289 | Bacteria | 3565 |
| 28 | Ga0065704_10099048 | 3300005289 | Bacteria | 2327 |
| 29 | Ga0065704_10161646 | 3300005289 | Bacteria | 1350 |
| 30 | Ga0065712_10067752 | 3300005290 | Bacteria | 56880 |
| 31 | Ga0065712_10096860 | 3300005290 | Bacteria | 2169 |
| 32 | Ga0065715_10101174 | 3300005293 | Bacteria | 3228 |
| 33 | Ga0070669_100008907 | 3300005353 | Bacteria | 7160 |
| 34 | Ga0070669_100269027 | 3300005353 | Bacteria | 1362 |
| 35 | Ga0070669_100553514 | 3300005353 | Bacteria | 959 |
| 36 | Ga0070663_101344945 | 3300005455 | Bacteria | 631 |
| 37 | Ga0070662_100062570 | 3300005457 | Bacteria | 2720 |
| 38 | Ga0070665_100071816 | 3300005548 | Bacteria | 3468 |
| 39 | Ga0075363_100092501 | 3300006048 | Bacteria | 1666 |
| 40 | Ga0075364_10127227 | 3300006051 | Bacteria | 1708 |
| 41 | Ga0075364_10257433 | 3300006051 | Bacteria | 1186 |
| 42 | Ga0075364_10365612 | 3300006051 | Bacteria | 984 |
| 43 | Ga0075364_10666267 | 3300006051 | Bacteria | 710 |
| 44 | Ga0075432_10008575 | 3300006058 | Bacteria | 3487 |
| 45 | Ga0075432_10017483 | 3300006058 | Bacteria | 2446 |
| 46 | Ga0075432_10022560 | 3300006058 | Bacteria | 2153 |
| 47 | Ga0075432_10024477 | 3300006058 | Bacteria | 2069 |
| 48 | Ga0075432_10115199 | 3300006058 | Bacteria | 1005 |
| 49 | Ga0075432_10303509 | 3300006058 | Bacteria | 663 |
| 50 | Ga0075362_10071270 | 3300006177 | Bacteria | 1587 |
| 51 | Ga0075362_10158247 | 3300006177 | Bacteria | 1089 |
| 52 | Ga0075369_10298952 | 3300006186 | Bacteria | 751 |
| 53 | Ga0075436_100568384 | 3300006914 | Bacteria | 833 |
| 54 | Ga0075436_100634387 | 3300006914 | Bacteria | 788 |
| 55 | Ga0075436_100767859 | 3300006914 | Bacteria | 716 |
| 56 | Ga0099823_1000177 | 3300006944 | Bacteria | 35100 |
| 57 | Ga0099823_1016124 | 3300006944 | Bacteria | 7360 |
| 58 | Ga0079104_1000539 | 3300006946 | Bacteria | 39713 |
| 59 | Ga0079104_1018851 | 3300006946 | Bacteria | 1944 |
| 60 | Ga0105251_10000104 | 3300009011 | Bacteria | 83894 |
| 61 | Ga0105251_10019360 | 3300009011 | Bacteria | 3598 |
| 62 | Ga0105251_10020292 | 3300009011 | Bacteria | 3493 |
| 63 | Ga0105251_10026999 | 3300009011 | Bacteria | 2917 |
| 64 | Ga0105251_10043680 | 3300009011 | Bacteria | 2169 |
| 65 | Ga0105251_10047094 | 3300009011 | Bacteria | 2073 |
| 66 | Ga0105251_10065037 | 3300009011 | Bacteria | 1708 |
| 67 | Ga0105251_10102850 | 3300009011 | Bacteria | 1305 |
| 68 | Ga0105251_10114021 | 3300009011 | Bacteria | 1230 |
| 69 | Ga0105251_10161218 | 3300009011 | Bacteria | 1011 |
| 70 | Ga0105251_10167882 | 3300009011 | Bacteria | 989 |
| 71 | Ga0105244_10000133 | 3300009036 | Bacteria | 76114 |
| 72 | Ga0105244_10009150 | 3300009036 | Bacteria | 6112 |
| 73 | Ga0105244_10009484 | 3300009036 | Bacteria | 5982 |
| 74 | Ga0105244_10009597 | 3300009036 | Bacteria | 5934 |
| 75 | Ga0105244_10009634 | 3300009036 | Bacteria | 5918 |
| 76 | Ga0105244_10010441 | 3300009036 | Bacteria | 5631 |
| 77 | Ga0105244_10022468 | 3300009036 | Bacteria | 3471 |
| 78 | Ga0105244_10029465 | 3300009036 | Bacteria | 2933 |
| 79 | Ga0105244_10056126 | 3300009036 | Bacteria | 1994 |
| 80 | Ga0105250_10000361 | 3300009092 | Bacteria | 34547 |
| 81 | Ga0105250_10005073 | 3300009092 | Bacteria | 5955 |
| 82 | Ga0105250_10013889 | 3300009092 | Bacteria | 3317 |
| 83 | Ga0105250_10017753 | 3300009092 | Bacteria | 2889 |
| 84 | Ga0105250_10017773 | 3300009092 | Bacteria | 2887 |
| 85 | Ga0105250_10189942 | 3300009092 | Bacteria | 864 |
| 86 | Ga0105250_10284556 | 3300009092 | Bacteria | 712 |
| 87 | Ga0105250_10344527 | 3300009092 | Bacteria | 652 |
| 88 | Ga0105245_10457403 | 3300009098 | Bacteria | 1286 |
| 89 | Ga0105243_10001154 | 3300009148 | Bacteria | 23958 |
| 90 | Ga0105243_10001733 | 3300009148 | Bacteria | 18785 |
| 91 | Ga0105243_10059143 | 3300009148 | Bacteria | 3057 |
| 92 | Ga0105243_10107790 | 3300009148 | Bacteria | 2324 |
| 93 | Ga0105243_10173707 | 3300009148 | Bacteria | 1868 |
| 94 | Ga0105243_10992986 | 3300009148 | Bacteria | 841 |
| 95 | Ga0105246_10001162 | 3300011119 | Bacteria | 15286 |
| 96 | Ga0105246_10003513 | 3300011119 | Bacteria | 9492 |
| 97 | Ga0105246_10190086 | 3300011119 | Bacteria | 1589 |
| 98 | Ga0157345_1000176 | 3300012498 | Bacteria | 10171 |
| 99 | Ga0157373_10089733 | 3300013100 | Bacteria | 2165 |
| 100 | Ga0157373_10131522 | 3300013100 | Bacteria | 1760 |
| 101 | Ga0157373_10464642 | 3300013100 | Bacteria | 912 |
| 102 | Ga0157371_10000233 | 3300013102 | Bacteria | 79696 |
| 103 | Ga0157371_10011092 | 3300013102 | Bacteria | 6977 |
| 104 | Ga0157371_10034302 | 3300013102 | Bacteria | 3640 |
| 105 | Ga0157371_10068468 | 3300013102 | Bacteria | 2512 |
| 106 | Ga0157370_10000390 | 3300013104 | Bacteria | 55059 |
| 107 | Ga0157370_10061065 | 3300013104 | Bacteria | 3577 |
| 108 | Ga0157370_10155893 | 3300013104 | Bacteria | 2125 |
| 109 | Ga0157370_10257223 | 3300013104 | Bacteria | 1614 |
| 110 | Ga0157370_10965379 | 3300013104 | Bacteria | 772 |
| 111 | Ga0157369_10102595 | 3300013105 | Bacteria | 3048 |
| 112 | Ga0157369_10119736 | 3300013105 | Bacteria | 2794 |
| 113 | Ga0157369_10320900 | 3300013105 | Bacteria | 1610 |
| 114 | Ga0163162_10003052 | 3300013306 | Bacteria | 16000 |
| 115 | Ga0163162_10066822 | 3300013306 | Bacteria | 3645 |
| 116 | Ga0157372_10005864 | 3300013307 | Bacteria | 13075 |
| 117 | Ga0157372_10065827 | 3300013307 | Bacteria | 4070 |
| 118 | Ga0157375_10982389 | 3300013308 | Bacteria | 985 |
| 119 | Ga0157375_11933218 | 3300013308 | Bacteria | 701 |
| 120 | Ga0182008_10005996 | 3300014497 | Bacteria | 6842 |
| 121 | Ga0182008_10020651 | 3300014497 | Bacteria | 3388 |
| 122 | Ga0182008_10026627 | 3300014497 | Bacteria | 2932 |
| 123 | Ga0182008_10056527 | 3300014497 | Bacteria | 1939 |
| 124 | Ga0182008_10072364 | 3300014497 | Bacteria | 1696 |
| 125 | Ga0182006_1012868 | 3300015261 | Bacteria | 3650 |
| 126 | Ga0182006_1013084 | 3300015261 | Bacteria | 3612 |
| 127 | Ga0182006_1017999 | 3300015261 | Bacteria | 2991 |
| 128 | Ga0182006_1032087 | 3300015261 | Bacteria | 2113 |
| 129 | Ga0182006_1069247 | 3300015261 | Bacteria | 1312 |
| 130 | Ga0182007_10010965 | 3300015262 | Bacteria | 3551 |
| 131 | Ga0182005_1006759 | 3300015265 | Bacteria | 3477 |
| 132 | Ga0182005_1024762 | 3300015265 | Bacteria | 1638 |
| 133 | Ga0182005_1064846 | 3300015265 | Bacteria | 999 |
| 134 | Ga0182005_1067760 | 3300015265 | Bacteria | 978 |
| 135 | Ga0182005_1099210 | 3300015265 | Bacteria | 815 |
| 136 | Ga0163161_10035419 | 3300017792 | Bacteria | 3573 |
| 137 | Ga0163161_10039215 | 3300017792 | Bacteria | 3399 |
| 138 | Ga0163161_10039329 | 3300017792 | Bacteria | 3395 |
| 139 | Ga0163161_10106056 | 3300017792 | Bacteria | 2097 |
| 140 | Ga0163161_10214107 | 3300017792 | Bacteria | 1489 |
| 141 | Ga0163161_10823444 | 3300017792 | Bacteria | 782 |
| 142 | Ga0209760_100225 | 3300025207 | Bacteria | 24449 |
| 143 | Ga0209563_103226 | 3300025230 | Bacteria | 3429 |
| 144 | Ga0207427_100014 | 3300025231 | Bacteria | 561361 |
| 145 | Ga0209437_100016 | 3300025233 | Bacteria | 710118 |
| 146 | Ga0209233_1000036 | 3300025261 | Bacteria | 561361 |
| 147 | Ga0209676_1000025 | 3300025292 | Bacteria | 577569 |
| 148 | Ga0209676_1000096 | 3300025292 | Bacteria | 240620 |
| 149 | Ga0209676_1000326 | 3300025292 | Bacteria | 91787 |
| 150 | Ga0209676_1001088 | 3300025292 | Bacteria | 30532 |
| 151 | Ga0209050_1000025 | 3300025298 | Bacteria | 528225 |
| 152 | Ga0209050_1000028 | 3300025298 | Bacteria | 477133 |
| 153 | Ga0209050_1000475 | 3300025298 | Bacteria | 70999 |
| 154 | Ga0209050_1002001 | 3300025298 | Bacteria | 19052 |
| 155 | Ga0209051_1000387 | 3300025303 | Bacteria | 62110 |
| 156 | Ga0209051_1000470 | 3300025303 | Bacteria | 52475 |
| 157 | Ga0209051_1000580 | 3300025303 | Bacteria | 43574 |
| 158 | Ga0209051_1007099 | 3300025303 | Bacteria | 6191 |
| 159 | Ga0209257_1000034 | 3300025304 | Bacteria | 662719 |
| 160 | Ga0209257_1009542 | 3300025304 | Bacteria | 5159 |
| 161 | Ga0207696_1000057 | 3300025711 | Bacteria | 249404 |
| 162 | Ga0207696_1000074 | 3300025711 | Bacteria | 215333 |
| 163 | Ga0207696_1000217 | 3300025711 | Bacteria | 83568 |
| 164 | Ga0207696_1002029 | 3300025711 | Bacteria | 10248 |
| 165 | Ga0207696_1010903 | 3300025711 | Bacteria | 3307 |
| 166 | Ga0207696_1016483 | 3300025711 | Bacteria | 2470 |
| 167 | Ga0207696_1016657 | 3300025711 | Bacteria | 2454 |
| 168 | Ga0207696_1045209 | 3300025711 | Bacteria | 1274 |
| 169 | Ga0207655_1000014 | 3300025728 | Bacteria | 607124 |
| 170 | Ga0207655_1000867 | 3300025728 | Bacteria | 32135 |
| 171 | Ga0207655_1000897 | 3300025728 | Bacteria | 31286 |
| 172 | Ga0207655_1000962 | 3300025728 | Bacteria | 29714 |
| 173 | Ga0207655_1002756 | 3300025728 | Bacteria | 13706 |
| 174 | Ga0207655_1002795 | 3300025728 | Bacteria | 13556 |
| 175 | Ga0207655_1004225 | 3300025728 | Bacteria | 10291 |
| 176 | Ga0207655_1005825 | 3300025728 | Bacteria | 8277 |
| 177 | Ga0207655_1007215 | 3300025728 | Bacteria | 7248 |
| 178 | Ga0207655_1016616 | 3300025728 | Bacteria | 4016 |
| 179 | Ga0207655_1017885 | 3300025728 | Bacteria | 3798 |
| 180 | Ga0207655_1019783 | 3300025728 | Bacteria | 3497 |
| 181 | Ga0207655_1030556 | 3300025728 | Bacteria | 2503 |
| 182 | Ga0207655_1044718 | 3300025728 | Bacteria | 1858 |
| 183 | Ga0207655_1076166 | 3300025728 | Bacteria | 1228 |
| 184 | Ga0207713_1000031 | 3300025735 | Bacteria | 283971 |
| 185 | Ga0207713_1000197 | 3300025735 | Bacteria | 83940 |
| 186 | Ga0207713_1000702 | 3300025735 | Bacteria | 31290 |
| 187 | Ga0207713_1002655 | 3300025735 | Bacteria | 12835 |
| 188 | Ga0207713_1003102 | 3300025735 | Bacteria | 11530 |
| 189 | Ga0207713_1004273 | 3300025735 | Bacteria | 9316 |
| 190 | Ga0207713_1004640 | 3300025735 | Bacteria | 8869 |
| 191 | Ga0207713_1006466 | 3300025735 | Bacteria | 7135 |
| 192 | Ga0207713_1010333 | 3300025735 | Bacteria | 5178 |
| 193 | Ga0207713_1010941 | 3300025735 | Bacteria | 4981 |
| 194 | Ga0207713_1016418 | 3300025735 | Bacteria | 3756 |
| 195 | Ga0207713_1016935 | 3300025735 | Bacteria | 3681 |
| 196 | Ga0207713_1105179 | 3300025735 | Bacteria | 967 |
| 197 | Ga0207645_10091590 | 3300025907 | Bacteria | 1955 |
| 198 | Ga0207657_10627873 | 3300025919 | Bacteria | 837 |
| 199 | Ga0207681_10009220 | 3300025923 | Bacteria | 6031 |
| 200 | Ga0207681_10255964 | 3300025923 | Bacteria | 1369 |
| 201 | Ga0207681_10441569 | 3300025923 | Bacteria | 1057 |
| 202 | Ga0207706_10033717 | 3300025933 | Bacteria | 4555 |
| 203 | Ga0207709_10000022 | 3300025935 | Bacteria | 383573 |
| 204 | Ga0207709_10001180 | 3300025935 | Bacteria | 18883 |
| 205 | Ga0207709_10002969 | 3300025935 | Bacteria | 10338 |
| 206 | Ga0207709_10011642 | 3300025935 | Bacteria | 4850 |
| 207 | Ga0207709_10038916 | 3300025935 | Bacteria | 2836 |
| 208 | Ga0207678_10199858 | 3300026067 | Bacteria | 1709 |
| 209 | Ga0209281_1000026 | 3300027111 | Bacteria | 465877 |
| 210 | Ga0209281_1006952 | 3300027111 | Bacteria | 2878 |
| 211 | Ga0209281_1013650 | 3300027111 | Bacteria | 1746 |
| 212 | Ga0209389_1000044 | 3300027296 | Bacteria | 122917 |
| 213 | Ga0209371_1000473 | 3300027312 | Bacteria | 39544 |
| 214 | Ga0209371_1050956 | 3300027312 | Bacteria | 795 |
| 215 | Ga0209995_1002635 | 3300027471 | Bacteria | 2841 |
| 216 | Ga0209999_1020422 | 3300027543 | Bacteria | 1216 |
| 217 | Ga0209983_1001939 | 3300027665 | Bacteria | 4588 |
| 218 | Ga0209971_1009555 | 3300027682 | Bacteria | 2297 |
| 219 | Ga0209974_10035406 | 3300027876 | Bacteria | 1658 |
| 220 | Ga0207428_10125749 | 3300027907 | Bacteria | 1964 |
| 221 | Ga0207428_10413525 | 3300027907 | Bacteria | 987 |
| 222 | Ga0207428_10564090 | 3300027907 | Bacteria | 823 |
| 223 | Ga0207428_10604899 | 3300027907 | Bacteria | 790 |
| 224 | Ga0207428_10802611 | 3300027907 | Bacteria | 669 |
| 225 | Ga0268266_10007185 | 3300028379 | Bacteria | 10086 |
| 226 | Ga0268256_1000399 | 3300030500 | Bacteria | 39584 |
| 227 | Ga0268256_1057278 | 3300030500 | Bacteria | 795 |
| 228 | Ga0307511_10033012 | 3300030521 | Bacteria | 4582 |
| 229 | Ga0316179_1078240 | 3300030734 | Bacteria | 3278 |
| 230 | Ga0316178_1090733 | 3300030735 | Bacteria | 26787 |
| 231 | Ga0307408_100038945 | 3300031548 | Bacteria | 3356 |
| 232 | Ga0307408_100522651 | 3300031548 | Bacteria | 1042 |
| 233 | Ga0307408_101049434 | 3300031548 | Bacteria | 753 |
| 234 | Ga0307516_10261146 | 3300031730 | Bacteria | 1422 |
| 235 | Ga0307406_10543306 | 3300031901 | Bacteria | 949 |
| 236 | Ga0307407_10056936 | 3300031903 | Bacteria | 2266 |
| 237 | Ga0307409_101261004 | 3300031995 | Bacteria | 763 |
| 238 | Ga0307414_10033174 | 3300032004 | Bacteria | 3410 |
| 239 | Ga0307411_10373293 | 3300032005 | Bacteria | 1170 |
| 240 | Ga0307510_10002054 | 3300033180 | Bacteria | 22761 |
| 241 | Ga0307510_10183661 | 3300033180 | Bacteria | 1650 |
| 242 | Ga0237819_00826 | 3300038705 | Bacteria | 9782 |
| 243 | Ga0439436_0000062 | 3300041404 | Bacteria | 29973 |
| 244 | Ga0439438_001641 | 3300041405 | Bacteria | 9819 |
| 245 | Ga0439438_001921 | 3300041405 | Bacteria | 9073 |
| 246 | Ga0439438_003489 | 3300041405 | Bacteria | 6350 |
| 247 | Ga0439438_008252 | 3300041405 | Bacteria | 3474 |
| 248 | Ga0439438_015684 | 3300041405 | Bacteria | 2220 |
| 249 | Ga0439438_017243 | 3300041405 | Bacteria | 2082 |
| 250 | Ga0439438_022627 | 3300041405 | Bacteria | 1741 |
| 251 | Ga0439447_001815 | 3300041407 | Bacteria | 7822 |
| 252 | Ga0439447_002310 | 3300041407 | Bacteria | 6979 |
| 253 | Ga0439447_002859 | 3300041407 | Bacteria | 6191 |
| 254 | Ga0439447_012464 | 3300041407 | Bacteria | 2442 |
| 255 | Ga0439447_016495 | 3300041407 | Bacteria | 2026 |
| 256 | Ga0439466_0002649 | 3300041411 | Bacteria | 6995 |
| 257 | Ga0439466_0013171 | 3300041411 | Bacteria | 3030 |
| 258 | Ga0439466_0013487 | 3300041411 | Bacteria | 2990 |
| 259 | Ga0439466_0022494 | 3300041411 | Bacteria | 2224 |
| 260 | Ga0439466_0023715 | 3300041411 | Bacteria | 2156 |
| 261 | Ga0439466_0028381 | 3300041411 | Bacteria | 1932 |
| 262 | Ga0439466_0039921 | 3300041411 | Bacteria | 1571 |
| 263 | Ga0439465_0124806 | 3300041413 | Bacteria | 905 |
| 264 | Ga0439432_014694 | 3300042006 | Bacteria | 2649 |
| 265 | Ga0439432_016195 | 3300042006 | Bacteria | 2511 |
| 266 | Ga0439432_019285 | 3300042006 | Bacteria | 2272 |
| 267 | Ga0439432_020115 | 3300042006 | Bacteria | 2220 |
| 268 | Ga0439432_029402 | 3300042006 | Bacteria | 1786 |
| 269 | Ga0439432_038164 | 3300042006 | Bacteria | 1530 |
| 270 | Ga0439451_000675 | 3300042009 | Bacteria | 6477 |
| 271 | Ga0439451_025628 | 3300042009 | Bacteria | 1188 |
| 272 | Ga0439451_068461 | 3300042009 | Bacteria | 711 |
| 273 | Ga0439452_000824 | 3300042010 | Bacteria | 14412 |
| 274 | Ga0439452_001540 | 3300042010 | Bacteria | 9282 |
| 275 | Ga0439452_002889 | 3300042010 | Bacteria | 6164 |
| 276 | Ga0439452_009982 | 3300042010 | Bacteria | 2777 |
| 277 | Ga0439452_014706 | 3300042010 | Bacteria | 2165 |
| 278 | Ga0439456_000398 | 3300042013 | Bacteria | 9734 |
| 279 | Ga0439456_013370 | 3300042013 | Bacteria | 1707 |
| 280 | Ga0439456_015375 | 3300042013 | Bacteria | 1597 |
| 281 | Ga0439456_023300 | 3300042013 | Bacteria | 1312 |
| 282 | Ga0439463_000024 | 3300042016 | Bacteria | 33011 |
| 283 | Ga0439463_001205 | 3300042016 | Bacteria | 6906 |
| 284 | Ga0439463_007919 | 3300042016 | Bacteria | 2624 |
| 285 | Ga0439463_113253 | 3300042016 | Bacteria | 700 |
| 286 | Ga0439463_161716 | 3300042016 | Bacteria | 580 |
| 287 | Ga0450911_000022 | 3300042115 | Bacteria | 91239 |
| 288 | Ga0450911_003916 | 3300042115 | Bacteria | 2521 |
| 289 | Ga0450911_011327 | 3300042115 | Bacteria | 1222 |
| 290 | Ga0450911_022730 | 3300042115 | Bacteria | 816 |
| 291 | Ga0450919_000300 | 3300042121 | Bacteria | 5837 |
| 292 | Ga0450919_004708 | 3300042121 | Bacteria | 1660 |
| 293 | Ga0450920_008064 | 3300042122 | Bacteria | 1919 |
| 294 | Ga0450922_000929 | 3300042124 | Bacteria | 2985 |
| 295 | Ga0450890_000272 | 3300042127 | Bacteria | 7619 |
| 296 | Ga0450900_000039 | 3300042136 | Bacteria | 5842 |
| 297 | Ga0450902_001104 | 3300042137 | Bacteria | 3584 |
| 298 | Ga0450902_001796 | 3300042137 | Bacteria | 2970 |
| 299 | Ga0450902_005699 | 3300042137 | Bacteria | 1892 |
| 300 | Ga0450902_007048 | 3300042137 | Bacteria | 1733 |
| 301 | Ga0450902_007937 | 3300042137 | Bacteria | 1650 |
| 302 | Ga0450902_008194 | 3300042137 | Bacteria | 1628 |
| 303 | Ga0450903_004487 | 3300042138 | Bacteria | 2379 |
| 304 | Ga0450903_022353 | 3300042138 | Bacteria | 975 |
| 305 | Ga0450904_002631 | 3300042139 | Bacteria | 2081 |
| 306 | Ga0450905_001598 | 3300042142 | Bacteria | 2889 |
| 307 | Ga0450905_001808 | 3300042142 | Bacteria | 2731 |
| 308 | Ga0450905_003686 | 3300042142 | Bacteria | 2014 |
| 309 | Ga0450905_006271 | 3300042142 | Bacteria | 1607 |
| 310 | Ga0450906_004750 | 3300042145 | Bacteria | 2829 |
| 311 | Ga0450907_000124 | 3300042146 | Bacteria | 29178 |
| 312 | Ga0450907_007158 | 3300042146 | Bacteria | 1862 |
| 313 | Ga0450907_007358 | 3300042146 | Bacteria | 1838 |
| 314 | Ga0450910_040012 | 3300042147 | Bacteria | 755 |
| 315 | Ga0439446_0010629 | 3300042156 | Bacteria | 2483 |
| 316 | Ga0439446_0012698 | 3300042156 | Bacteria | 2302 |
| 317 | Ga0439446_0013651 | 3300042156 | Bacteria | 2232 |
| 318 | Ga0439446_0015621 | 3300042156 | Bacteria | 2107 |
| 319 | Ga0450908_017304 | 3300042184 | Bacteria | 1280 |
| 320 | Ga0450909_000036 | 3300042185 | Bacteria | 10843 |
| 321 | Ga0450909_006604 | 3300042185 | Bacteria | 1671 |
| 322 | Ga0450909_008987 | 3300042185 | Bacteria | 1456 |
| 323 | Ga0450909_052867 | 3300042185 | Bacteria | 635 |
| 324 | Ga0439434_0001360 | 3300042435 | Bacteria | 7043 |
| 325 | Ga0439459_0011424 | 3300042438 | Bacteria | 1565 |
| 326 | Ga0439464_0075318 | 3300042439 | Bacteria | 1002 |
| 327 | Ga0439460_0003679 | 3300042461 | Bacteria | 3717 |
| 328 | Ga0439460_0010730 | 3300042461 | Bacteria | 2351 |
| 329 | Ga0439460_0014234 | 3300042461 | Bacteria | 2089 |
| 330 | Ga0439460_0237740 | 3300042461 | Bacteria | 627 |
| 331 | Ga0450916_004833 | 3300042530 | Bacteria | 1537 |
| 332 | Ga0450918_007824 | 3300042531 | Bacteria | 1883 |
| 333 | Ga0450918_024112 | 3300042531 | Bacteria | 1064 |
| 334 | Ga0450901_000816 | 3300042533 | Bacteria | 3652 |
| 335 | Ga0439440_0006947 | 3300042993 | Bacteria | 2290 |
| 336 | Ga0439440_0007972 | 3300042993 | Bacteria | 2163 |
| 337 | Ga0439440_0069018 | 3300042993 | Bacteria | 916 |
| 338 | Ga0495617_000314 | 3300046452 | Bacteria | 27313 |
| 339 | Ga0495617_013883 | 3300046452 | Bacteria | 2739 |
| 340 | Ga0495617_040566 | 3300046452 | Bacteria | 1556 |
| 341 | Ga0495617_078225 | 3300046452 | Bacteria | 1084 |
| 342 | Ga0495617_133897 | 3300046452 | Bacteria | 793 |
| 343 | Ga0495617_175316 | 3300046452 | Bacteria | 676 |
| 344 | Ga0495617_193406 | 3300046452 | Bacteria | 637 |
| 345 | Ga0495627_000175 | 3300046453 | Bacteria | 72658 |
| 346 | Ga0495627_002136 | 3300046453 | Bacteria | 9960 |
| 347 | Ga0495627_003507 | 3300046453 | Bacteria | 6877 |
| 348 | Ga0495627_012863 | 3300046453 | Bacteria | 2955 |
| 349 | Ga0495627_019179 | 3300046453 | Bacteria | 2298 |
| 350 | Ga0495627_073963 | 3300046453 | Bacteria | 992 |
| 351 | Ga0495627_198216 | 3300046453 | Bacteria | 553 |
| 352 | Ga0495603_0125989 | 3300046455 | Bacteria | 1492 |
| 353 | Ga0495603_0288222 | 3300046455 | Bacteria | 943 |
| 354 | Ga0495603_0454553 | 3300046455 | Bacteria | 733 |
| 355 | Ga0495590_0007321 | 3300046457 | Bacteria | 4262 |
| 356 | Ga0495590_0012337 | 3300046457 | Bacteria | 3171 |
| 357 | Ga0495590_0025012 | 3300046457 | Bacteria | 2100 |
| 358 | Ga0495590_0111044 | 3300046457 | Bacteria | 978 |
| 359 | Ga0495591_000161 | 3300046458 | Bacteria | 71199 |
| 360 | Ga0495591_004389 | 3300046458 | Bacteria | 6926 |
| 361 | Ga0495591_004607 | 3300046458 | Bacteria | 6648 |
| 362 | Ga0495591_005579 | 3300046458 | Bacteria | 5783 |
| 363 | Ga0495591_006363 | 3300046458 | Bacteria | 5237 |
| 364 | Ga0495591_008772 | 3300046458 | Bacteria | 4101 |
| 365 | Ga0495591_009985 | 3300046458 | Bacteria | 3723 |
| 366 | Ga0495591_010205 | 3300046458 | Bacteria | 3658 |
| 367 | Ga0495591_011193 | 3300046458 | Bacteria | 3414 |
| 368 | Ga0495591_021567 | 3300046458 | Bacteria | 2098 |
| 369 | Ga0495591_027782 | 3300046458 | Bacteria | 1740 |
| 370 | Ga0495591_032286 | 3300046458 | Bacteria | 1560 |
| 371 | Ga0495638_0039352 | 3300046460 | Bacteria | 3001 |
| 372 | Ga0495638_0045227 | 3300046460 | Bacteria | 2770 |
| 373 | Ga0495638_0070691 | 3300046460 | Bacteria | 2136 |
| 374 | Ga0495638_0080123 | 3300046460 | Bacteria | 1984 |
| 375 | Ga0495638_0080330 | 3300046460 | Bacteria | 1981 |
| 376 | Ga0495638_0082015 | 3300046460 | Bacteria | 1956 |
| 377 | Ga0495638_0099669 | 3300046460 | Bacteria | 1738 |
| 378 | Ga0495638_0132551 | 3300046460 | Bacteria | 1462 |
| 379 | Ga0495653_0010870 | 3300046463 | Bacteria | 7452 |
| 380 | Ga0495653_0024884 | 3300046463 | Bacteria | 4817 |
| 381 | Ga0495653_0138868 | 3300046463 | Bacteria | 1711 |
| 382 | Ga0495650_0000626 | 3300046471 | Bacteria | 47586 |
| 383 | Ga0495650_0028194 | 3300046471 | Bacteria | 2582 |
| 384 | Ga0495650_0031717 | 3300046471 | Bacteria | 2373 |
| 385 | Ga0495650_0036266 | 3300046471 | Bacteria | 2159 |
| 386 | Ga0495650_0232151 | 3300046471 | Bacteria | 632 |
| 387 | Ga0495582_0006770 | 3300046473 | Bacteria | 6374 |
| 388 | Ga0495605_0000388 | 3300046474 | Bacteria | 40603 |
| 389 | Ga0495605_0000507 | 3300046474 | Bacteria | 33437 |
| 390 | Ga0495605_0001585 | 3300046474 | Bacteria | 14736 |
| 391 | Ga0495605_0005024 | 3300046474 | Bacteria | 7732 |
| 392 | Ga0495605_0011668 | 3300046474 | Bacteria | 4889 |
| 393 | Ga0495605_0029762 | 3300046474 | Bacteria | 2805 |
| 394 | Ga0495605_0044954 | 3300046474 | Bacteria | 2180 |
| 395 | Ga0495605_0045373 | 3300046474 | Bacteria | 2166 |
| 396 | Ga0495605_0047739 | 3300046474 | Bacteria | 2099 |
| 397 | Ga0495605_0066514 | 3300046474 | Bacteria | 1712 |
| 398 | Ga0495605_0070223 | 3300046474 | Bacteria | 1657 |
| 399 | Ga0495605_0075372 | 3300046474 | Bacteria | 1586 |
| 400 | Ga0495605_0078382 | 3300046474 | Bacteria | 1548 |
| 401 | Ga0495605_0082909 | 3300046474 | Bacteria | 1497 |
| 402 | Ga0495605_0175897 | 3300046474 | Bacteria | 943 |
| 403 | Ga0495639_0000692 | 3300046475 | Bacteria | 15433 |
| 404 | Ga0495639_0014581 | 3300046475 | Bacteria | 3404 |
| 405 | Ga0495639_0047854 | 3300046475 | Bacteria | 1938 |
| 406 | Ga0495639_0095030 | 3300046475 | Bacteria | 1402 |
| 407 | Ga0495584_0000577 | 3300046491 | Bacteria | 24773 |
| 408 | Ga0495584_0013493 | 3300046491 | Bacteria | 4171 |
| 409 | Ga0495584_0016937 | 3300046491 | Bacteria | 3713 |
| 410 | Ga0495584_0030107 | 3300046491 | Bacteria | 2750 |
| 411 | Ga0495584_0031464 | 3300046491 | Bacteria | 2686 |
| 412 | Ga0495584_0033867 | 3300046491 | Bacteria | 2584 |
| 413 | Ga0495584_0124413 | 3300046491 | Bacteria | 1306 |
| 414 | Ga0495585_0000557 | 3300046492 | Bacteria | 35226 |
| 415 | Ga0495585_0050673 | 3300046492 | Bacteria | 2302 |
| 416 | Ga0495585_0066298 | 3300046492 | Bacteria | 1976 |
| 417 | Ga0495585_0092772 | 3300046492 | Bacteria | 1624 |
| 418 | Ga0495585_0189010 | 3300046492 | Bacteria | 1054 |
| 419 | Ga0495594_0026096 | 3300046499 | Bacteria | 3141 |
| 420 | Ga0495594_0035133 | 3300046499 | Bacteria | 2729 |
| 421 | Ga0495594_0044846 | 3300046499 | Bacteria | 2426 |
| 422 | Ga0495596_0000324 | 3300046500 | Bacteria | 31137 |
| 423 | Ga0495596_0023163 | 3300046500 | Bacteria | 2521 |
| 424 | Ga0495596_0318012 | 3300046500 | Bacteria | 605 |
| 425 | Ga0495607_0000534 | 3300046501 | Bacteria | 37333 |
| 426 | Ga0495607_0000578 | 3300046501 | Bacteria | 35660 |
| 427 | Ga0495607_0000620 | 3300046501 | Bacteria | 34430 |
| 428 | Ga0495607_0006804 | 3300046501 | Bacteria | 7981 |
| 429 | Ga0495607_0008047 | 3300046501 | Bacteria | 7239 |
| 430 | Ga0495607_0011632 | 3300046501 | Bacteria | 5848 |
| 431 | Ga0495607_0021909 | 3300046501 | Bacteria | 4019 |
| 432 | Ga0495607_0025325 | 3300046501 | Bacteria | 3691 |
| 433 | Ga0495607_0033400 | 3300046501 | Bacteria | 3130 |
| 434 | Ga0495607_0036117 | 3300046501 | Bacteria | 2981 |
| 435 | Ga0495607_0041558 | 3300046501 | Bacteria | 2730 |
| 436 | Ga0495607_0044632 | 3300046501 | Bacteria | 2612 |
| 437 | Ga0495607_0045910 | 3300046501 | Bacteria | 2567 |
| 438 | Ga0495607_0051532 | 3300046501 | Bacteria | 2389 |
| 439 | Ga0495607_0068252 | 3300046501 | Bacteria | 1994 |
| 440 | Ga0495607_0082324 | 3300046501 | Bacteria | 1766 |
| 441 | Ga0495607_0091896 | 3300046501 | Bacteria | 1643 |
| 442 | Ga0495607_0349154 | 3300046501 | Bacteria | 683 |
| 443 | Ga0495583_0000899 | 3300046506 | Bacteria | 35446 |
| 444 | Ga0495583_0005200 | 3300046506 | Bacteria | 8949 |
| 445 | Ga0495583_0005349 | 3300046506 | Bacteria | 8751 |
| 446 | Ga0495583_0042002 | 3300046506 | Bacteria | 2138 |
| 447 | Ga0495583_0050567 | 3300046506 | Bacteria | 1898 |
| 448 | Ga0495583_0058426 | 3300046506 | Bacteria | 1731 |
| 449 | Ga0495606_0000352 | 3300046507 | Bacteria | 78743 |
| 450 | Ga0495606_0001099 | 3300046507 | Bacteria | 38715 |
| 451 | Ga0495606_0007808 | 3300046507 | Bacteria | 9461 |
| 452 | Ga0495606_0011823 | 3300046507 | Bacteria | 7069 |
| 453 | Ga0495606_0011952 | 3300046507 | Bacteria | 7014 |
| 454 | Ga0495606_0020823 | 3300046507 | Bacteria | 4821 |
| 455 | Ga0495606_0021648 | 3300046507 | Bacteria | 4703 |
| 456 | Ga0495606_0034675 | 3300046507 | Bacteria | 3461 |
| 457 | Ga0495606_0075924 | 3300046507 | Bacteria | 2101 |
| 458 | Ga0495606_0109992 | 3300046507 | Bacteria | 1663 |
| 459 | Ga0495606_0118500 | 3300046507 | Bacteria | 1587 |
| 460 | Ga0495606_0154697 | 3300046507 | Bacteria | 1343 |
| 461 | Ga0495610_0006298 | 3300046512 | Bacteria | 8213 |
| 462 | Ga0495610_0009612 | 3300046512 | Bacteria | 6095 |
| 463 | Ga0495610_0027880 | 3300046512 | Bacteria | 2994 |
| 464 | Ga0495610_0028497 | 3300046512 | Bacteria | 2952 |
| 465 | Ga0495610_0036858 | 3300046512 | Bacteria | 2495 |
| 466 | Ga0495610_0044484 | 3300046512 | Bacteria | 2203 |
| 467 | Ga0495610_0045758 | 3300046512 | Bacteria | 2163 |
| 468 | Ga0495610_0052518 | 3300046512 | Bacteria | 1978 |
| 469 | Ga0495610_0058862 | 3300046512 | Bacteria | 1836 |
| 470 | Ga0495610_0059247 | 3300046512 | Bacteria | 1828 |
| 471 | Ga0495610_0171192 | 3300046512 | Bacteria | 910 |
| 472 | Ga0495616_0010661 | 3300046513 | Bacteria | 5309 |
| 473 | Ga0495616_0016872 | 3300046513 | Bacteria | 4033 |
| 474 | Ga0495616_0021933 | 3300046513 | Bacteria | 3452 |
| 475 | Ga0495616_0023399 | 3300046513 | Bacteria | 3322 |
| 476 | Ga0495616_0027472 | 3300046513 | Bacteria | 3019 |
| 477 | Ga0495616_0032193 | 3300046513 | Bacteria | 2741 |
| 478 | Ga0495616_0040787 | 3300046513 | Bacteria | 2370 |
| 479 | Ga0495616_0072174 | 3300046513 | Bacteria | 1667 |
| 480 | Ga0495616_0114461 | 3300046513 | Bacteria | 1250 |
| 481 | Ga0495620_0000091 | 3300046515 | Bacteria | 73076 |
| 482 | Ga0495620_0002337 | 3300046515 | Bacteria | 10996 |
| 483 | Ga0495620_0004494 | 3300046515 | Bacteria | 7847 |
| 484 | Ga0495620_0020359 | 3300046515 | Bacteria | 3241 |
| 485 | Ga0495620_0028010 | 3300046515 | Bacteria | 2626 |
| 486 | Ga0495620_0029249 | 3300046515 | Bacteria | 2552 |
| 487 | Ga0495620_0038026 | 3300046515 | Bacteria | 2138 |
| 488 | Ga0495620_0039369 | 3300046515 | Bacteria | 2089 |
| 489 | Ga0495620_0049177 | 3300046515 | Bacteria | 1805 |
| 490 | Ga0495620_0064944 | 3300046515 | Bacteria | 1507 |
| 491 | Ga0495630_0127785 | 3300046517 | Bacteria | 1929 |
| 492 | Ga0495630_0145040 | 3300046517 | Bacteria | 1805 |
| 493 | Ga0495630_0279041 | 3300046517 | Bacteria | 1276 |
| 494 | Ga0495630_0370659 | 3300046517 | Bacteria | 1096 |
| 495 | Ga0495631_0002843 | 3300046518 | Bacteria | 9611 |
| 496 | Ga0495631_0003080 | 3300046518 | Bacteria | 9200 |
| 497 | Ga0495631_0011798 | 3300046518 | Bacteria | 4285 |
| 498 | Ga0495631_0021649 | 3300046518 | Bacteria | 2993 |
| 499 | Ga0495631_0040057 | 3300046518 | Bacteria | 2076 |
| 500 | Ga0495632_0002770 | 3300046519 | Bacteria | 13022 |
| 501 | Ga0495632_0003643 | 3300046519 | Bacteria | 10826 |
| 502 | Ga0495632_0003662 | 3300046519 | Bacteria | 10781 |
| 503 | Ga0495632_0004504 | 3300046519 | Bacteria | 9442 |
| 504 | Ga0495632_0006990 | 3300046519 | Bacteria | 7161 |
| 505 | Ga0495632_0009636 | 3300046519 | Bacteria | 5799 |
| 506 | Ga0495632_0026667 | 3300046519 | Bacteria | 3038 |
| 507 | Ga0495632_0029199 | 3300046519 | Bacteria | 2873 |
| 508 | Ga0495632_0031569 | 3300046519 | Bacteria | 2736 |
| 509 | Ga0495632_0053755 | 3300046519 | Bacteria | 1976 |
| 510 | Ga0495632_0061568 | 3300046519 | Bacteria | 1821 |
| 511 | Ga0495632_0156950 | 3300046519 | Bacteria | 1049 |
| 512 | Ga0495632_0157832 | 3300046519 | Bacteria | 1046 |
| 513 | Ga0495637_0000020 | 3300046520 | Bacteria | 181611 |
| 514 | Ga0495637_0001123 | 3300046520 | Bacteria | 16388 |
| 515 | Ga0495637_0007688 | 3300046520 | Bacteria | 5332 |
| 516 | Ga0495637_0009343 | 3300046520 | Bacteria | 4785 |
| 517 | Ga0495637_0020649 | 3300046520 | Bacteria | 3028 |
| 518 | Ga0495637_0028059 | 3300046520 | Bacteria | 2515 |
| 519 | Ga0495637_0034687 | 3300046520 | Bacteria | 2207 |
| 520 | Ga0495637_0037795 | 3300046520 | Bacteria | 2093 |
| 521 | Ga0495637_0040927 | 3300046520 | Bacteria | 1991 |
| 522 | Ga0495637_0075269 | 3300046520 | Bacteria | 1355 |
| 523 | Ga0495637_0105298 | 3300046520 | Bacteria | 1098 |
| 524 | Ga0495637_0198272 | 3300046520 | Bacteria | 738 |
| 525 | Ga0495643_0000501 | 3300046522 | Bacteria | 49358 |
| 526 | Ga0495643_0001109 | 3300046522 | Bacteria | 26822 |
| 527 | Ga0495643_0001225 | 3300046522 | Bacteria | 24781 |
| 528 | Ga0495643_0006782 | 3300046522 | Bacteria | 7485 |
| 529 | Ga0495643_0024246 | 3300046522 | Bacteria | 3443 |
| 530 | Ga0495643_0039993 | 3300046522 | Bacteria | 2562 |
| 531 | Ga0495643_0047632 | 3300046522 | Bacteria | 2320 |
| 532 | Ga0495643_0067351 | 3300046522 | Bacteria | 1887 |
| 533 | Ga0495643_0084275 | 3300046522 | Bacteria | 1649 |
| 534 | Ga0495643_0093464 | 3300046522 | Bacteria | 1549 |
| 535 | Ga0495644_0002973 | 3300046523 | Bacteria | 6717 |
| 536 | Ga0495644_0010727 | 3300046523 | Bacteria | 3530 |
| 537 | Ga0495644_0011748 | 3300046523 | Bacteria | 3371 |
| 538 | Ga0495644_0030339 | 3300046523 | Bacteria | 2042 |
| 539 | Ga0495644_0156428 | 3300046523 | Bacteria | 873 |
| 540 | Ga0495648_0000968 | 3300046524 | Bacteria | 29625 |
| 541 | Ga0495648_0002060 | 3300046524 | Bacteria | 19023 |
| 542 | Ga0495648_0009495 | 3300046524 | Bacteria | 7524 |
| 543 | Ga0495648_0015522 | 3300046524 | Bacteria | 5528 |
| 544 | Ga0495648_0021856 | 3300046524 | Bacteria | 4419 |
| 545 | Ga0495648_0068510 | 3300046524 | Bacteria | 2069 |
| 546 | Ga0495648_0070662 | 3300046524 | Bacteria | 2027 |
| 547 | Ga0495648_0078195 | 3300046524 | Bacteria | 1892 |
| 548 | Ga0495648_0081364 | 3300046524 | Bacteria | 1842 |
| 549 | Ga0495648_0112072 | 3300046524 | Bacteria | 1482 |
| 550 | Ga0495648_0140022 | 3300046524 | Bacteria | 1274 |
| 551 | Ga0495648_0216240 | 3300046524 | Bacteria | 948 |
| 552 | Ga0495666_0022401 | 3300046526 | Bacteria | 3128 |
| 553 | Ga0495666_0044347 | 3300046526 | Bacteria | 2147 |
| 554 | Ga0495666_0131039 | 3300046526 | Bacteria | 1171 |
| 555 | Ga0495642_0000682 | 3300046528 | Bacteria | 16828 |
| 556 | Ga0495642_0000820 | 3300046528 | Bacteria | 14963 |
| 557 | Ga0495642_0001726 | 3300046528 | Bacteria | 9408 |
| 558 | Ga0495652_0241365 | 3300046529 | Bacteria | 1344 |
| 559 | Ga0495654_0003950 | 3300046530 | Bacteria | 8947 |
| 560 | Ga0495654_0004366 | 3300046530 | Bacteria | 8414 |
| 561 | Ga0495654_0005946 | 3300046530 | Bacteria | 7011 |
| 562 | Ga0495654_0015554 | 3300046530 | Bacteria | 4038 |
| 563 | Ga0495654_0019233 | 3300046530 | Bacteria | 3573 |
| 564 | Ga0495654_0027363 | 3300046530 | Bacteria | 2924 |
| 565 | Ga0495654_0032814 | 3300046530 | Bacteria | 2630 |
| 566 | Ga0495654_0069119 | 3300046530 | Bacteria | 1677 |
| 567 | Ga0495654_0093713 | 3300046530 | Bacteria | 1390 |
| 568 | Ga0495654_0144436 | 3300046530 | Bacteria | 1057 |
| 569 | Ga0495654_0148699 | 3300046530 | Bacteria | 1037 |
| 570 | Ga0495654_0175132 | 3300046530 | Bacteria | 932 |
| 571 | Ga0495665_0623007 | 3300046531 | Bacteria | 538 |
| 572 | Ga0495586_0014612 | 3300046535 | Bacteria | 4172 |
| 573 | Ga0495587_0002819 | 3300046536 | Bacteria | 11638 |
| 574 | Ga0495587_0026456 | 3300046536 | Bacteria | 3538 |
| 575 | Ga0495609_0000290 | 3300046538 | Bacteria | 46264 |
| 576 | Ga0495609_0001221 | 3300046538 | Bacteria | 17712 |
| 577 | Ga0495609_0014550 | 3300046538 | Bacteria | 3695 |
| 578 | Ga0495609_0019466 | 3300046538 | Bacteria | 3141 |
| 579 | Ga0495609_0029957 | 3300046538 | Bacteria | 2476 |
| 580 | Ga0495609_0046854 | 3300046538 | Bacteria | 1936 |
| 581 | Ga0495609_0241104 | 3300046538 | Bacteria | 746 |
| 582 | Ga0495609_0332898 | 3300046538 | Bacteria | 614 |
| 583 | Ga0495597_0000124 | 3300046542 | Bacteria | 69872 |
| 584 | Ga0495597_0013161 | 3300046542 | Bacteria | 3970 |
| 585 | Ga0495597_0016570 | 3300046542 | Bacteria | 3479 |
| 586 | Ga0495597_0040570 | 3300046542 | Bacteria | 2080 |
| 587 | Ga0495597_0093547 | 3300046542 | Bacteria | 1273 |
| 588 | Ga0495597_0138656 | 3300046542 | Bacteria | 1004 |
| 589 | Ga0495597_0173872 | 3300046542 | Bacteria | 873 |
| 590 | Ga0495622_0002899 | 3300046557 | Bacteria | 8187 |
| 591 | Ga0495622_0003756 | 3300046557 | Bacteria | 7103 |
| 592 | Ga0495622_0031292 | 3300046557 | Bacteria | 2487 |
| 593 | Ga0495622_0071392 | 3300046557 | Bacteria | 1602 |
| 594 | Ga0495622_0071700 | 3300046557 | Bacteria | 1598 |
| 595 | Ga0495622_0163069 | 3300046557 | Bacteria | 1004 |
| 596 | Ga0495633_0002988 | 3300046558 | Bacteria | 11567 |
| 597 | Ga0495633_0056961 | 3300046558 | Bacteria | 1836 |
| 598 | Ga0495633_0057199 | 3300046558 | Bacteria | 1832 |
| 599 | Ga0495656_0010252 | 3300046615 | Bacteria | 3400 |
| 600 | Ga0495668_0007486 | 3300046616 | Bacteria | 6972 |
| 601 | Ga0495668_0008203 | 3300046616 | Bacteria | 6557 |
| 602 | Ga0495668_0049213 | 3300046616 | Bacteria | 2337 |
| 603 | Ga0495668_0082720 | 3300046616 | Bacteria | 1761 |
| 604 | Ga0495668_0128969 | 3300046616 | Bacteria | 1384 |
| 605 | Ga0495634_0006248 | 3300046642 | Bacteria | 9070 |
| 606 | Ga0495634_0249873 | 3300046642 | Bacteria | 1085 |
| 607 | Ga0495611_0000246 | 3300046648 | Bacteria | 37614 |
| 608 | Ga0495611_0005069 | 3300046648 | Bacteria | 5648 |
| 609 | Ga0495611_0006086 | 3300046648 | Bacteria | 5147 |
| 610 | Ga0495611_0037491 | 3300046648 | Bacteria | 2154 |
| 611 | Ga0495611_0046602 | 3300046648 | Bacteria | 1944 |
| 612 | Ga0495611_0059863 | 3300046648 | Bacteria | 1729 |
| 613 | Ga0495625_0000133 | 3300046660 | Bacteria | 115381 |
| 614 | Ga0495625_0013436 | 3300046660 | Bacteria | 6580 |
| 615 | Ga0495625_0041245 | 3300046660 | Bacteria | 3360 |
| 616 | Ga0495625_0063578 | 3300046660 | Bacteria | 2605 |
| 617 | Ga0495625_0078318 | 3300046660 | Bacteria | 2307 |
| 618 | Ga0495625_0100065 | 3300046660 | Bacteria | 1993 |
| 619 | Ga0495625_0105766 | 3300046660 | Bacteria | 1927 |
| 620 | Ga0495625_0147171 | 3300046660 | Bacteria | 1585 |
| 621 | Ga0495625_0212990 | 3300046660 | Bacteria | 1269 |
| 622 | Ga0495635_0013225 | 3300046663 | Bacteria | 5776 |
| 623 | Ga0495635_0020866 | 3300046663 | Bacteria | 4564 |
| 624 | Ga0495661_0000370 | 3300046665 | Bacteria | 48701 |
| 625 | Ga0495661_0000387 | 3300046665 | Bacteria | 47232 |
| 626 | Ga0495661_0006814 | 3300046665 | Bacteria | 8000 |
| 627 | Ga0495661_0007392 | 3300046665 | Bacteria | 7656 |
| 628 | Ga0495661_0074784 | 3300046665 | Bacteria | 1970 |
| 629 | Ga0495661_0081303 | 3300046665 | Bacteria | 1867 |
| 630 | Ga0495661_0302773 | 3300046665 | Bacteria | 799 |
| 631 | Ga0495661_0326963 | 3300046665 | Bacteria | 760 |
| 632 | Ga0495588_0015482 | 3300046674 | Bacteria | 3671 |
| 633 | Ga0495588_0084129 | 3300046674 | Bacteria | 1662 |
| 634 | Ga0495623_0050615 | 3300046679 | Bacteria | 2630 |
| 635 | Ga0495623_0065286 | 3300046679 | Bacteria | 2276 |
| 636 | Ga0495646_0016248 | 3300046680 | Bacteria | 4724 |
| 637 | Ga0495646_0024531 | 3300046680 | Bacteria | 3797 |
| 638 | Ga0495646_0084373 | 3300046680 | Bacteria | 1844 |
| 639 | Ga0495669_0005649 | 3300046684 | Bacteria | 5220 |
| 640 | Ga0495613_0095466 | 3300046689 | Bacteria | 2150 |
| 641 | Ga0495613_0269555 | 3300046689 | Bacteria | 1184 |
| 642 | Ga0495624_0017341 | 3300046690 | Bacteria | 4835 |
| 643 | Ga0495670_0002253 | 3300046691 | Bacteria | 9515 |
| 644 | Ga0495670_0027490 | 3300046691 | Bacteria | 2818 |
| 645 | Ga0495670_0038449 | 3300046691 | Bacteria | 2385 |
| 646 | Ga0495670_0045040 | 3300046691 | Bacteria | 2202 |
| 647 | Ga0495670_0051702 | 3300046691 | Bacteria | 2056 |
| 648 | Ga0495670_0226566 | 3300046691 | Bacteria | 993 |
| 649 | Ga0495670_0254715 | 3300046691 | Bacteria | 936 |
| 650 | Ga0495671_0004223 | 3300046692 | Bacteria | 8648 |
| 651 | Ga0495671_0005897 | 3300046692 | Bacteria | 7128 |
| 652 | Ga0495671_0007349 | 3300046692 | Bacteria | 6287 |
| 653 | Ga0495671_0009941 | 3300046692 | Bacteria | 5293 |
| 654 | Ga0495671_0031351 | 3300046692 | Bacteria | 2718 |
| 655 | Ga0495671_0033507 | 3300046692 | Bacteria | 2616 |
| 656 | Ga0495671_0034565 | 3300046692 | Bacteria | 2569 |
| 657 | Ga0495671_0045516 | 3300046692 | Bacteria | 2196 |
| 658 | Ga0495671_0047926 | 3300046692 | Bacteria | 2132 |
| 659 | Ga0495671_0049424 | 3300046692 | Bacteria | 2096 |
| 660 | Ga0495671_0055645 | 3300046692 | Bacteria | 1959 |
| 661 | Ga0495671_0132293 | 3300046692 | Bacteria | 1216 |
| 662 | Ga0495649_0048044 | 3300046694 | Bacteria | 2319 |
| 663 | Ga0495649_0060180 | 3300046694 | Bacteria | 2044 |
| 664 | Ga0495649_0081869 | 3300046694 | Bacteria | 1725 |
| 665 | Ga0495649_0082824 | 3300046694 | Bacteria | 1714 |
| 666 | Ga0495649_0085606 | 3300046694 | Bacteria | 1682 |
| 667 | Ga0495649_0105302 | 3300046694 | Bacteria | 1497 |
| 668 | Ga0495649_0113253 | 3300046694 | Bacteria | 1437 |
| 669 | Ga0495649_0211547 | 3300046694 | Bacteria | 1004 |
| 670 | Ga0495589_0000698 | 3300046794 | Bacteria | 21863 |
| 671 | Ga0495589_0015727 | 3300046794 | Bacteria | 3889 |
| 672 | Ga0495589_0041352 | 3300046794 | Bacteria | 2300 |
| 673 | Ga0495589_0051354 | 3300046794 | Bacteria | 2038 |
| 674 | Ga0495589_0052660 | 3300046794 | Bacteria | 2010 |
| 675 | Ga0495589_0052770 | 3300046794 | Bacteria | 2007 |
| 676 | Ga0495589_0116343 | 3300046794 | Bacteria | 1288 |
| 677 | Ga0495600_0013015 | 3300046809 | Bacteria | 5217 |
| 678 | Ga0495600_0080500 | 3300046809 | Bacteria | 2126 |
| 679 | Ga0495660_0000430 | 3300046810 | Bacteria | 35274 |
| 680 | Ga0495660_0024905 | 3300046810 | Bacteria | 3403 |
| 681 | Ga0495660_0025369 | 3300046810 | Bacteria | 3367 |
| 682 | Ga0495660_0045130 | 3300046810 | Bacteria | 2420 |
| 683 | Ga0495660_0057511 | 3300046810 | Bacteria | 2097 |
| 684 | Ga0495660_0061691 | 3300046810 | Bacteria | 2011 |
| 685 | Ga0495660_0063952 | 3300046810 | Bacteria | 1967 |
| 686 | Ga0495660_0216834 | 3300046810 | Bacteria | 904 |
| 687 | Ga0495581_0023930 | 3300047315 | Bacteria | 3539 |
| 688 | Ga0495604_0049683 | 3300047317 | Bacteria | 3257 |
| 689 | Ga0495604_0054144 | 3300047317 | Bacteria | 3097 |
| 690 | Ga0495604_0076917 | 3300047317 | Bacteria | 2509 |
| 691 | Ga0495636_0006766 | 3300047318 | Bacteria | 4505 |
| 692 | Ga0495636_0048398 | 3300047318 | Bacteria | 1776 |
| 693 | Ga0495674_0026989 | 3300047319 | Bacteria | 5252 |
| 694 | Ga0495672_0003108 | 3300047320 | Bacteria | 14494 |
| 695 | Ga0495672_0005519 | 3300047320 | Bacteria | 10013 |
| 696 | Ga0495672_0008532 | 3300047320 | Bacteria | 7544 |
| 697 | Ga0495672_0013766 | 3300047320 | Bacteria | 5565 |
| 698 | Ga0495672_0017277 | 3300047320 | Bacteria | 4829 |
| 699 | Ga0495672_0039260 | 3300047320 | Bacteria | 2879 |
| 700 | Ga0495672_0039926 | 3300047320 | Bacteria | 2850 |
| 701 | Ga0495672_0051371 | 3300047320 | Bacteria | 2428 |
| 702 | Ga0495672_0066149 | 3300047320 | Bacteria | 2063 |
| 703 | Ga0495672_0072863 | 3300047320 | Bacteria | 1939 |
| 704 | Ga0495672_0074919 | 3300047320 | Bacteria | 1904 |
| 705 | Ga0495672_0083549 | 3300047320 | Bacteria | 1773 |
| 706 | Ga0495672_0084040 | 3300047320 | Bacteria | 1766 |
| 707 | Ga0495672_0104812 | 3300047320 | Bacteria | 1527 |
| 708 | Ga0495672_0106052 | 3300047320 | Bacteria | 1515 |
| 709 | Ga0495672_0264052 | 3300047320 | Bacteria | 829 |
| 710 | Ga0495676_0000202 | 3300047321 | Bacteria | 46973 |
| 711 | Ga0495676_0103938 | 3300047321 | Bacteria | 2096 |
| 712 | Ga0495676_0328254 | 3300047321 | Bacteria | 1027 |
| 713 | Ga0495680_0010632 | 3300047322 | Bacteria | 8206 |
| 714 | Ga0495680_0066973 | 3300047322 | Bacteria | 2746 |
| 715 | Ga0495680_0106174 | 3300047322 | Bacteria | 2087 |
| 716 | Ga0495680_0175340 | 3300047322 | Bacteria | 1550 |
| 717 | Ga0495683_0001649 | 3300047323 | Bacteria | 14281 |
| 718 | Ga0495683_0052649 | 3300047323 | Bacteria | 2031 |
| 719 | Ga0495683_0058262 | 3300047323 | Bacteria | 1918 |
| 720 | Ga0495683_0064625 | 3300047323 | Bacteria | 1806 |
| 721 | Ga0495683_0208798 | 3300047323 | Bacteria | 876 |
| 722 | Ga0495683_0252427 | 3300047323 | Bacteria | 773 |
| 723 | Ga0495687_005986 | 3300047443 | Bacteria | 7581 |
| 724 | Ga0495687_078465 | 3300047443 | Bacteria | 1300 |
| 725 | Ga0495687_078642 | 3300047443 | Bacteria | 1298 |
| 726 | Ga0495687_111603 | 3300047443 | Bacteria | 1004 |
| 727 | Ga0495675_0002810 | 3300047444 | Bacteria | 10426 |
| 728 | Ga0495675_0024366 | 3300047444 | Bacteria | 3857 |
| 729 | Ga0495677_0001888 | 3300047445 | Bacteria | 8371 |
| 730 | Ga0495679_000643 | 3300047446 | Bacteria | 23429 |
| 731 | Ga0495679_020145 | 3300047446 | Bacteria | 2327 |
| 732 | Ga0495679_024325 | 3300047446 | Bacteria | 2041 |
| 733 | Ga0495685_049997 | 3300047447 | Bacteria | 1419 |
| 734 | Ga0495685_089876 | 3300047447 | Bacteria | 1018 |
| 735 | Ga0495673_0002259 | 3300047469 | Bacteria | 13826 |
| 736 | Ga0495673_0003730 | 3300047469 | Bacteria | 9894 |
| 737 | Ga0495673_0010555 | 3300047469 | Bacteria | 5013 |
| 738 | Ga0495673_0011356 | 3300047469 | Bacteria | 4792 |
| 739 | Ga0495673_0015661 | 3300047469 | Bacteria | 3899 |
| 740 | Ga0495673_0020515 | 3300047469 | Bacteria | 3287 |
| 741 | Ga0495673_0020663 | 3300047469 | Bacteria | 3274 |
| 742 | Ga0495673_0022687 | 3300047469 | Bacteria | 3071 |
| 743 | Ga0495673_0029183 | 3300047469 | Bacteria | 2605 |
| 744 | Ga0495673_0037694 | 3300047469 | Bacteria | 2205 |
| 745 | Ga0495673_0037778 | 3300047469 | Bacteria | 2202 |
| 746 | Ga0495673_0039685 | 3300047469 | Bacteria | 2134 |
| 747 | Ga0495673_0040037 | 3300047469 | Bacteria | 2121 |
| 748 | Ga0495673_0040566 | 3300047469 | Bacteria | 2102 |
| 749 | Ga0495673_0062208 | 3300047469 | Bacteria | 1595 |
| 750 | Ga0495673_0070525 | 3300047469 | Bacteria | 1471 |
| 751 | Ga0495673_0083538 | 3300047469 | Bacteria | 1318 |
| 752 | Ga0495673_0102250 | 3300047469 | Bacteria | 1156 |
| 753 | Ga0495673_0187617 | 3300047469 | Bacteria | 779 |
| 754 | Ga0495681_0007827 | 3300047470 | Bacteria | 6766 |
| 755 | Ga0495681_0008230 | 3300047470 | Bacteria | 6553 |
| 756 | Ga0495681_0016374 | 3300047470 | Bacteria | 4157 |
| 757 | Ga0495681_0018404 | 3300047470 | Bacteria | 3849 |
| 758 | Ga0495681_0023306 | 3300047470 | Bacteria | 3292 |
| 759 | Ga0495681_0050440 | 3300047470 | Bacteria | 1961 |
| 760 | Ga0495681_0092415 | 3300047470 | Bacteria | 1334 |
| 761 | Ga0495681_0114735 | 3300047470 | Bacteria | 1162 |
| 762 | Ga0495681_0132883 | 3300047470 | Bacteria | 1057 |
| 763 | Ga0495681_0155058 | 3300047470 | Bacteria | 958 |
| 764 | Ga0495681_0172580 | 3300047470 | Bacteria | 893 |
| 765 | Ga0495684_0355180 | 3300047471 | Bacteria | 1039 |
| 766 | Ga0495686_0030487 | 3300047472 | Bacteria | 3502 |
| 767 | Ga0495686_0040000 | 3300047472 | Bacteria | 2992 |
| 768 | Ga0495686_0045996 | 3300047472 | Bacteria | 2760 |
| 769 | Ga0495686_0087385 | 3300047472 | Bacteria | 1896 |
| 770 | Ga0495593_0040694 | 3300047673 | Bacteria | 2501 |
| 771 | Ga0495593_0064489 | 3300047673 | Bacteria | 1912 |
| 772 | Ga0495593_0087067 | 3300047673 | Bacteria | 1610 |
| 773 | Ga0495593_0088568 | 3300047673 | Bacteria | 1595 |
| 774 | Ga0495593_0428703 | 3300047673 | Bacteria | 661 |
| 775 | Ga0495602_0030647 | 3300048088 | Bacteria | 5098 |
| 776 | Ga0495614_0049165 | 3300048089 | Bacteria | 1808 |
| 777 | Ga0495626_0000371 | 3300048091 | Bacteria | 46963 |
| 778 | Ga0495626_0000714 | 3300048091 | Bacteria | 31159 |
| 779 | Ga0495626_0001454 | 3300048091 | Bacteria | 18746 |
| 780 | Ga0495626_0019345 | 3300048091 | Bacteria | 3407 |
| 781 | Ga0495626_0019436 | 3300048091 | Bacteria | 3398 |
| 782 | Ga0495626_0021312 | 3300048091 | Bacteria | 3216 |
| 783 | Ga0495626_0026151 | 3300048091 | Bacteria | 2847 |
| 784 | Ga0495626_0044676 | 3300048091 | Bacteria | 2071 |
| 785 | Ga0495626_0109088 | 3300048091 | Bacteria | 1200 |
| 786 | Ga0495626_0250479 | 3300048091 | Bacteria | 710 |
| 787 | Ga0496101_0196899 | 3300048904 | Bacteria | 1557 |
| 788 | Ga0496102_0002520 | 3300048905 | Bacteria | 15639 |
| 789 | Ga0496102_0151353 | 3300048905 | Bacteria | 2180 |
| 790 | Ga0496103_0078049 | 3300048906 | Bacteria | 2079 |
| 791 | Ga0496103_0278873 | 3300048906 | Bacteria | 1075 |
| 792 | Ga0496104_0593530 | 3300048907 | Bacteria | 1018 |
| 793 | Ga0496106_0867098 | 3300048909 | Bacteria | 714 |
| 794 | Ga0496108_1342889 | 3300048911 | Bacteria | 600 |
| 795 | Ga0496110_0103273 | 3300048913 | Bacteria | 2557 |
| 796 | Ga0496110_0188243 | 3300048913 | Bacteria | 1874 |
| 797 | Ga0496110_0363999 | 3300048913 | Bacteria | 1317 |
| 798 | Ga0496111_0043669 | 3300048914 | Bacteria | 3222 |
| 799 | Ga0496111_0382164 | 3300048914 | Bacteria | 1041 |
| 800 | Ga0496111_0550360 | 3300048914 | Bacteria | 847 |
| 801 | Ga0496113_0296097 | 3300048916 | Bacteria | 1295 |
| 802 | Ga0496114_0022211 | 3300048917 | Bacteria | 5169 |
| 803 | Ga0496116_0000567 | 3300048919 | Bacteria | 49501 |
| 804 | Ga0496116_0000699 | 3300048919 | Bacteria | 43452 |
| 805 | Ga0496116_0004261 | 3300048919 | Bacteria | 13720 |
| 806 | Ga0496116_0049029 | 3300048919 | Bacteria | 2828 |
| 807 | Ga0496116_0078719 | 3300048919 | Bacteria | 2054 |
| 808 | Ga0496116_0336904 | 3300048919 | Bacteria | 698 |
| 809 | Ga0496117_0004225 | 3300048920 | Bacteria | 16035 |
| 810 | Ga0496117_0005023 | 3300048920 | Bacteria | 14183 |
| 811 | Ga0496117_0007729 | 3300048920 | Bacteria | 10395 |
| 812 | Ga0496117_0008113 | 3300048920 | Bacteria | 10042 |
| 813 | Ga0496117_0014922 | 3300048920 | Bacteria | 6660 |
| 814 | Ga0496117_0086225 | 3300048920 | Bacteria | 2041 |
| 815 | Ga0496117_0144853 | 3300048920 | Bacteria | 1416 |
| 816 | Ga0496117_0196015 | 3300048920 | Bacteria | 1145 |
| 817 | Ga0496118_0005868 | 3300048921 | Bacteria | 13762 |
| 818 | Ga0496118_0007244 | 3300048921 | Bacteria | 11838 |
| 819 | Ga0496118_0032262 | 3300048921 | Bacteria | 4320 |
| 820 | Ga0496118_0074304 | 3300048921 | Bacteria | 2430 |
| 821 | Ga0496118_0097296 | 3300048921 | Bacteria | 2003 |
| 822 | Ga0496118_0098574 | 3300048921 | Bacteria | 1984 |
| 823 | Ga0496118_0100630 | 3300048921 | Bacteria | 1954 |
| 824 | Ga0496118_0121122 | 3300048921 | Bacteria | 1705 |
| 825 | Ga0496119_0000448 | 3300048922 | Bacteria | 56340 |
| 826 | Ga0496119_0111855 | 3300048922 | Bacteria | 1514 |
| 827 | Ga0496119_0128606 | 3300048922 | Bacteria | 1383 |
| 828 | Ga0496120_0011575 | 3300048923 | Bacteria | 6059 |
| 829 | Ga0496120_0032332 | 3300048923 | Bacteria | 3155 |
| 830 | Ga0496121_0002566 | 3300048924 | Bacteria | 27498 |
| 831 | Ga0496121_0006254 | 3300048924 | Bacteria | 14906 |
| 832 | Ga0496121_0019527 | 3300048924 | Bacteria | 6768 |
| 833 | Ga0496121_0095092 | 3300048924 | Bacteria | 2316 |
| 834 | Ga0496121_0111870 | 3300048924 | Bacteria | 2081 |
| 835 | Ga0496121_0118041 | 3300048924 | Bacteria | 2009 |
| 836 | Ga0496121_0127729 | 3300048924 | Bacteria | 1908 |
| 837 | Ga0496121_0205742 | 3300048924 | Bacteria | 1398 |
| 838 | Ga0496121_0229324 | 3300048924 | Bacteria | 1302 |
| 839 | Ga0496122_0001701 | 3300048925 | Bacteria | 34110 |
| 840 | Ga0496122_0007075 | 3300048925 | Bacteria | 12602 |
| 841 | Ga0496122_0011031 | 3300048925 | Bacteria | 9228 |
| 842 | Ga0496122_0017734 | 3300048925 | Bacteria | 6628 |
| 843 | Ga0496122_0091597 | 3300048925 | Bacteria | 2069 |
| 844 | Ga0496122_0098023 | 3300048925 | Bacteria | 1970 |
| 845 | Ga0496122_0166008 | 3300048925 | Bacteria | 1338 |
| 846 | Ga0496122_0174758 | 3300048925 | Bacteria | 1289 |
| 847 | Ga0496122_0268116 | 3300048925 | Bacteria | 942 |
| 848 | Ga0496122_0323162 | 3300048925 | Bacteria | 819 |
| 849 | Ga0496123_0000921 | 3300048926 | Bacteria | 46120 |
| 850 | Ga0496123_0005745 | 3300048926 | Bacteria | 12348 |
| 851 | Ga0496123_0013598 | 3300048926 | Bacteria | 6814 |
| 852 | Ga0496123_0058117 | 3300048926 | Bacteria | 2512 |
| 853 | Ga0496123_0093072 | 3300048926 | Bacteria | 1781 |
| 854 | Ga0496123_0113652 | 3300048926 | Bacteria | 1541 |
| 855 | Ga0496123_0126664 | 3300048926 | Bacteria | 1424 |
| 856 | Ga0496124_0000819 | 3300048927 | Bacteria | 50577 |
| 857 | Ga0496124_0005666 | 3300048927 | Bacteria | 13926 |
| 858 | Ga0496124_0008908 | 3300048927 | Bacteria | 10401 |
| 859 | Ga0496124_0011151 | 3300048927 | Bacteria | 9016 |
| 860 | Ga0496124_0011466 | 3300048927 | Bacteria | 8861 |
| 861 | Ga0496124_0019795 | 3300048927 | Bacteria | 6246 |
| 862 | Ga0496124_0058677 | 3300048927 | Bacteria | 3235 |
| 863 | Ga0496124_0059470 | 3300048927 | Bacteria | 3210 |
| 864 | Ga0496124_0114283 | 3300048927 | Bacteria | 2168 |
| 865 | Ga0496124_0131547 | 3300048927 | Bacteria | 1987 |
| 866 | Ga0496124_0136898 | 3300048927 | Bacteria | 1937 |
| 867 | Ga0496124_0151777 | 3300048927 | Bacteria | 1816 |
| 868 | Ga0496124_0277513 | 3300048927 | Bacteria | 1223 |
| 869 | Ga0496124_0455981 | 3300048927 | Bacteria | 870 |
| 870 | Ga0496124_0466505 | 3300048927 | Bacteria | 856 |
| 871 | Ga0496125_0003089 | 3300048928 | Bacteria | 20785 |
| 872 | Ga0496125_0013401 | 3300048928 | Bacteria | 8062 |
| 873 | Ga0496125_0026312 | 3300048928 | Bacteria | 5305 |
| 874 | Ga0496125_0052637 | 3300048928 | Bacteria | 3346 |
| 875 | Ga0496125_0062016 | 3300048928 | Bacteria | 2993 |
| 876 | Ga0496125_0554067 | 3300048928 | Bacteria | 636 |
| 877 | Ga0496126_0049457 | 3300048929 | Bacteria | 3838 |
| 878 | Ga0496126_0072255 | 3300048929 | Bacteria | 3069 |
| 879 | Ga0496126_0144861 | 3300048929 | Bacteria | 2041 |
| 880 | Ga0496126_0162350 | 3300048929 | Bacteria | 1908 |
| 881 | Ga0495678_002756 | 3300049459 | Bacteria | 11517 |
| 882 | Ga0495678_007238 | 3300049459 | Bacteria | 5780 |
| 883 | Ga0495678_012788 | 3300049459 | Bacteria | 3964 |
| 884 | Ga0495678_015303 | 3300049459 | Bacteria | 3535 |
| 885 | Ga0495678_023461 | 3300049459 | Bacteria | 2679 |
| 886 | Ga0495678_028824 | 3300049459 | Bacteria | 2337 |
| 887 | Ga0495678_041403 | 3300049459 | Bacteria | 1843 |
| 888 | Ga0495678_046690 | 3300049459 | Bacteria | 1700 |
| 889 | Ga0495678_047526 | 3300049459 | Bacteria | 1679 |
| 890 | Ga0495678_065995 | 3300049459 | Bacteria | 1342 |
| 891 | Ga0495678_082378 | 3300049459 | Bacteria | 1151 |
| 892 | Ga0495678_121117 | 3300049459 | Bacteria | 878 |
| 893 | Ga0495682_0001724 | 3300049460 | Bacteria | 11092 |
| 894 | Ga0495682_0027114 | 3300049460 | Bacteria | 2125 |
| 895 | Ga0501032_0090360 | 3300049569 | Bacteria | 2032 |
| 896 | Ga0501034_0000738 | 3300049571 | Bacteria | 49438 |
| 897 | Ga0501034_0681955 | 3300049571 | Bacteria | 927 |
| 898 | Ga0501034_0793866 | 3300049571 | Bacteria | 840 |
| 899 | Ga0501037_0248769 | 3300049573 | Bacteria | 1244 |
| 900 | Ga0501241_005375 | 3300049758 | Bacteria | 2390 |
| 901 | Ga0501226_000004 | 3300049853 | Bacteria | 284656 |
| 902 | nmdc:mga03683_171216_c1 | 3300050489 | Bacteria | 987 |
| 903 | nmdc:mga00v17_406375_c1 | 3300050491 | Bacteria | 885 |
| 904 | nmdc:mga00v17_55754_c1 | 3300050491 | Bacteria | 2414 |
| 905 | nmdc:mga08x19_295642_c1 | 3300050514 | Bacteria | 1124 |
| 906 | nmdc:mga0sz30_206282_c1 | 3300050516 | Bacteria | 873 |
| 907 | Ga0500659_0001983 | 3300053135 | Bacteria | 12589 |
| 908 | Ga0500573_0068504 | 3300053140 | Bacteria | 2026 |
| 909 | 2511256135 | 2511231004 | Bacteria | 6669789 |
| 910 | 2511263371 | 2511231006 | Bacteria | 6794709 |
| 911 | 2511272757 | 2511231007 | Bacteria | 6306603 |
| 912 | 2511277666 | 2511231008 | Bacteria | 6624100 |
| 913 | 2511288716 | 2511231010 | Bacteria | 6373152 |
| 914 | 2511297418 | 2511231011 | Bacteria | 6149768 |
| 915 | 2511303359 | 2511231012 | Bacteria | 6738011 |
| 916 | 2511316381 | 2511231014 | Bacteria | 6462302 |
| 917 | 2511319382 | 2511231015 | Bacteria | 6598026 |
| 918 | 2511323483 | 2511231016 | Bacteria | 6704427 |
| 919 | 2511330925 | 2511231017 | Bacteria | 6503007 |
| 920 | 2511337836 | 2511231018 | Bacteria | 6436256 |
| 921 | 2511344598 | 2511231019 | Bacteria | 6520662 |
| 922 | 2511349178 | 2511231020 | Bacteria | 6115223 |
| 923 | 2511358647 | 2511231021 | Bacteria | 7302637 |
| 924 | 2511365080 | 2511231022 | Bacteria | 6719296 |
| 925 | 2511367709 | 2511231023 | Bacteria | 6808468 |
| 926 | 2511375593 | 2511231024 | Bacteria | 5835885 |
| 927 | 2511414364 | 2511231031 | Bacteria | 6558529 |
| 928 | 2512326021 | 2512047018 | Bacteria | 6663241 |
| 929 | 2554818000 | 2554235132 | Bacteria | 6772433 |
| 930 | 2555667495 | 2554235341 | Bacteria | 6867980 |
| 931 | 2583789740 | 2582580891 | Bacteria | 6800976 |
| 932 | 2597855724 | 2597489887 | Bacteria | 6666321 |
| 933 | 2599327299 | 2599185155 | Bacteria | 5827168 |
| 934 | 2599356716 | 2599185160 | Bacteria | 6844013 |
| 935 | 2599363252 | 2599185161 | Bacteria | 6960462 |
| 936 | 2599369796 | 2599185162 | Bacteria | 6957254 |
| 937 | 2599376361 | 2599185163 | Bacteria | 6995158 |
| 938 | 2599381821 | 2599185164 | Bacteria | 6841688 |
| 939 | 2599388035 | 2599185165 | Bacteria | 6843250 |
| 940 | 2599395441 | 2599185166 | Bacteria | 6959206 |
| 941 | 2599407206 | 2599185168 | Bacteria | 6997636 |
| 942 | 2599463549 | 2599185181 | Bacteria | 6844519 |
| 943 | 2599469101 | 2599185182 | Bacteria | 6883168 |
| 944 | 2599485626 | 2599185185 | Bacteria | 6652270 |
| 945 | 2599492568 | 2599185186 | Bacteria | 6831633 |
| 946 | 2599500036 | 2599185188 | Bacteria | 6164180 |
| 947 | 2599616729 | 2599185212 | Bacteria | 6765997 |
| 948 | 2599806756 | 2599185257 | Bacteria | 6492581 |
| 949 | 2599930968 | 2599185300 | Bacteria | 6062622 |
| 950 | 2599994770 | 2599185311 | Bacteria | 6354990 |
| 951 | 2600027277 | 2599185316 | Bacteria | 6320029 |
| 952 | 2600036789 | 2599185318 | Bacteria | 6961590 |
| 953 | 2600045022 | 2599185319 | Bacteria | 6637840 |
| 954 | 2600061135 | 2599185322 | Bacteria | 6763055 |
| 955 | 2600068512 | 2599185323 | Bacteria | 6688755 |
| 956 | 2600077741 | 2599185325 | Bacteria | 6324919 |
| 957 | 2600216178 | 2599185356 | Bacteria | 6843884 |
| 958 | 2600364816 | 2600254931 | Bacteria | 6734225 |
| 959 | 2601627113 | 2600255283 | Bacteria | 6061572 |
| 960 | 2601776345 | 2600255313 | Bacteria | 6842543 |
| 961 | 2601797905 | 2600255318 | Bacteria | 6383414 |
| 962 | 2606076612 | 2603880185 | Bacteria | 6379190 |
| 963 | 2606128974 | 2603880199 | Bacteria | 6377649 |
| 964 | 2608380691 | 2606217733 | Bacteria | 6360972 |
| 965 | 2624478293 | 2623620443 | Bacteria | 6427864 |
| 966 | 2624489834 | 2623620446 | Bacteria | 6500345 |
| 967 | 2643841057 | 2643221565 | Bacteria | 6216018 |
| 968 | 2643954832 | 2643221589 | Bacteria | 6250934 |
| 969 | 2644024472 | 2643221602 | Bacteria | 6249926 |
| 970 | 2644190168 | 2643221633 | Bacteria | 6733554 |
| 971 | 2671099894 | 2667528171 | Bacteria | 6900659 |
| 972 | 2671772407 | 2671180172 | Bacteria | 6495783 |
| 973 | 2678261066 | 2675903515 | Bacteria | 6580491 |
| 974 | 2691331290 | 2690315857 | Bacteria | 4396207 |
| 975 | 2715749277 | 2713897148 | Bacteria | 5883533 |
| 976 | 2715755546 | 2713897149 | Bacteria | 6506249 |
| 977 | 2718632227 | 2718217725 | Bacteria | 5758958 |
| 978 | 2729146050 | 2728369097 | Bacteria | 4333476 |
| 979 | 2738687514 | 2738541271 | Bacteria | 5657310 |
| 980 | 2739200530 | 2738543004 | Bacteria | 6381073 |
| 981 | 2739259992 | 2738543015 | Bacteria | 6750701 |
| 982 | 2739263135 | 2738543016 | Bacteria | 5657564 |
| 983 | 2739287079 | 2738543020 | Bacteria | 5718238 |
| 984 | 2739292392 | 2738543021 | Bacteria | 5718241 |
| 985 | 2739311351 | 2738543025 | Bacteria | 6600348 |
| 986 | 2743735143 | 2740892503 | Bacteria | 6855563 |
| 987 | 2745006377 | 2744054620 | Bacteria | 6551379 |
| 988 | 2765581677 | 2765235841 | Bacteria | 6137024 |
| 989 | 2774119486 | 2773857670 | Bacteria | 6407454 |
| 990 | 2774134806 | 2773857673 | Bacteria | 6513460 |
| 991 | 2784260975 | 2784132063 | Bacteria | 6262788 |
| 992 | 2784315897 | 2784132072 | Bacteria | 6596533 |
| 993 | 2794594105 | 2791355520 | Bacteria | 5948615 |
| 994 | 2807406307 | 2806310737 | Bacteria | 5751088 |
| 995 | 2807454660 | 2806310745 | Bacteria | 5742165 |
| 996 | 2808906547 | 2808606373 | Bacteria | 4423627 |
| 997 | 2808932617 | 2808606377 | Bacteria | 6646337 |
| 998 | 2808954738 | 2808606381 | Bacteria | 6646461 |
| 999 | 2808955945 | 2808606382 | Bacteria | 6841132 |
| 1000 | 2812370285 | 2811994881 | Bacteria | 6298475 |
| 1001 | 2819657302 | 2818991456 | Bacteria | 6123676 |
| 1002 | 2819705290 | 2818991464 | Bacteria | 6907494 |
| 1003 | 2826586199 | 2826581358 | Bacteria | 5963467 |
| 1004 | 2842809859 | 2842805378 | Bacteria | 5385175 |
| 1005 | 2842817831 | 2842815866 | Bacteria | 5947510 |
| 1006 | 2842834232 | 2842832357 | Bacteria | 5959113 |
| 1007 | 2842846291 | 2842843487 | Bacteria | 6004777 |
| 1008 | 2842851779 | 2842849001 | Bacteria | 5924277 |
| 1009 | 2844667969 | 2844665904 | Bacteria | 6817974 |
| 1010 | 2852660380 | 2852657418 | Bacteria | 6472974 |
| 1011 | 2860343567 | 2860339153 | Bacteria | 6846989 |
| 1012 | 2878030235 | 2878029506 | Bacteria | 6418441 |
| 1013 | 2880231185 | 2880230671 | Bacteria | 6140320 |
| 1014 | 2904519640 | 2904518522 | Bacteria | 6068986 |
| 1015 | 2904555548 | 2904550169 | Bacteria | 6221258 |
| 1016 | 2908447100 | 2908446538 | Bacteria | 6829095 |
| 1017 | 2912964252 | 2912963787 | Bacteria | 5646108 |
| 1018 | 2917071246 | 2917070673 | Bacteria | 6868303 |
| 1019 | 2919066081 | 2919063839 | Bacteria | 6302690 |
| 1020 | 2919157658 | 2919155634 | Bacteria | 4860545 |
| 1021 | 2919389701 | 2919385768 | Bacteria | 5897293 |
| 1022 | 2919460058 | 2919456309 | Bacteria | 6586567 |
| 1023 | 2919488630 | 2919487758 | Bacteria | 5929766 |
| 1024 | 2919534852 | 2919534386 | Bacteria | 4577686 |
| 1025 | 2919692070 | 2919688452 | Bacteria | 4595932 |
| 1026 | 2919698885 | 2919697872 | Bacteria | 6553725 |
| 1027 | 2923154139 | 2923153595 | Bacteria | 6870622 |
| 1028 | 2923524373 | 2923519811 | Bacteria | 6298479 |
| 1029 | 2931371771 | 2931369376 | Bacteria | 6847892 |
| 1030 | 2931398915 | 2931396565 | Bacteria | 7251677 |
| 1031 | 2935359073 | 2935353572 | Unclassified | 6955622 |
| 1032 | 2939641178 | 2939636861 | Bacteria | 6297853 |
| 1033 | 2939655368 | 2939651529 | Bacteria | 5895393 |
| 1034 | 2945967659 | 2945961074 | Bacteria | 7342064 |
| 1035 | 2946012440 | 2946006987 | Bacteria | 6705746 |
| 1036 | 2969305030 | 2969304461 | Bacteria | 6601805 |
| 1037 | 2974293280 | 2974289157 | Bacteria | 6080362 |
| 1038 | 2984291920 | 2984286254 | Bacteria | 6702062 |
| 1039 | 2998140537 | 2998139840 | Bacteria | 6073514 |
| 1040 | 3007399691 | 3007395558 | Bacteria | 6755444 |
| 1041 | 3007420087 | 3007419365 | Bacteria | 7026924 |
| 1042 | 3007517989 | 3007511990 | Bacteria | 6481491 |
| 1043 | 3007616489 | 3007614139 | Bacteria | 6053559 |
| 1044 | 3007621973 | 3007619802 | Bacteria | 6411688 |
| 1045 | 3007720334 | 3007718800 | Bacteria | 5971527 |
| 1046 | 3007809365 | 3007803356 | Bacteria | 5931491 |
| 1047 | 3007859769 | 3007855910 | Bacteria | 5637581 |
| 1048 | 3007864258 | 3007861166 | Bacteria | 6045338 |
| 1049 | 3007875214 | 3007872151 | Bacteria | 5268868 |
| 1050 | 637317890 | 637000220 | Bacteria | 7074893 |
| 1051 | 640489750 | 640427133 | Bacteria | 4567418 |
| 1052 | 651177763 | 651053060 | Bacteria | 4689946 |
| 1053 | 8011352721 | 8011350971 | Bacteria | 6158957 |
| 1054 | 8015688389 | 8015687852 | Bacteria | 6613826 |
| 1055 | 8019770374 | 8019769354 | Bacteria | 6924660 |
| 1056 | 8019777411 | 8019775933 | Bacteria | 6858656 |
| 1057 | 8030000203 | 8029995093 | Bacteria | 5990776 |
| 1058 | 8052495117 | 8052494512 | Bacteria | 5765634 |
| 1059 | 8054930774 | 8054929484 | Bacteria | 5599761 |
| 1060 | 8055771485 | 8055770955 | Bacteria | 6827675 |
| 1061 | 8055879904 | 8055878733 | Bacteria | 5907058 |
| 1062 | 8056116803 | 8056115690 | Bacteria | 5527654 |
| 1063 | 8056125399 | 8056120720 | Bacteria | 5758328 |
| 1064 | 8056126542 | 8056125926 | Bacteria | 6228218 |
| 1065 | 8056142477 | 8056137416 | Bacteria | 6147080 |
| 1066 | 8056158585 | 8056155041 | Bacteria | 6486948 |
| 1067 | 8056170515 | 8056166840 | Bacteria | 5820959 |
| 1068 | 8056176633 | 8056172158 | Bacteria | 6133900 |
| 1069 | 8056182974 | 8056177738 | Bacteria | 6748268 |
| 1070 | 8056573363 | 8056569372 | Bacteria | 5997322 |
| 1071 | 8057802776 | 8057798959 | Bacteria | 6713499 |
| 1072 | Ga0439466_0026358 | |||
| 1073 | MRS2a_Contig_25754 | |||
| 1074 | MRS2a_Contig_87 | |||
| 1075 | SwRhRL2b_contig_823445 | |||
| 1076 | MRS1b_contig_7023920 | |||
| 1077 | JGI25162J39368_1000182 | |||
| 1078 | JGI25163J39215_1000321 | |||
| 1079 | JGI25164J39214_1000148 | |||
| 1080 | JGI25165J46597_1000268 | |||
| 1081 | Ga0055536_1000236 | |||
| 1082 | Ga0055536_1001317 | |||
| 1083 | Ga0055536_1019163 | |||
| 1084 | Ga0055530_10000306 | |||
| 1085 | Ga0055530_10001752 | |||
| 1086 | Ga0055540_1000206 | |||
| 1087 | Ga0055540_1000419 | |||
| 1088 | Ga0055540_1000474 | |||
| 1089 | Ga0055531_10000477 | |||
| 1090 | Ga0065714_10000019 | |||
| 1091 | Ga0065714_10011662 | |||
| 1092 | Ga0065714_10012738 | |||
| 1093 | Ga0065714_10034416 | |||
| 1094 | Ga0065714_10087154 | |||
| 1095 | Ga0065714_10287869 | |||
| 1096 | Ga0065704_10003413 | |||
| 1097 | Ga0065704_10012074 | |||
| 1098 | Ga0065704_10082686 | |||
| 1099 | Ga0065704_10099048 | |||
| 1100 | Ga0065704_10161646 | |||
| 1101 | Ga0065712_10067752 | |||
| 1102 | Ga0065712_10096860 | |||
| 1103 | Ga0065715_10101174 | |||
| 1104 | Ga0070669_100008907 | |||
| 1105 | Ga0070669_100269027 | |||
| 1106 | Ga0070669_100553514 | |||
| 1107 | Ga0070663_101344945 | |||
| 1108 | Ga0070662_100062570 | |||
| 1109 | Ga0070665_100071816 | |||
| 1110 | Ga0075363_100092501 | |||
| 1111 | Ga0075364_10127227 | |||
| 1112 | Ga0075364_10257433 | |||
| 1113 | Ga0075364_10365612 | |||
| 1114 | Ga0075364_10666267 | |||
| 1115 | Ga0075432_10008575 | |||
| 1116 | Ga0075432_10017483 | |||
| 1117 | Ga0075432_10022560 | |||
| 1118 | Ga0075432_10024477 | |||
| 1119 | Ga0075432_10115199 | |||
| 1120 | Ga0075432_10303509 | |||
| 1121 | Ga0075362_10071270 | |||
| 1122 | Ga0075362_10158247 | |||
| 1123 | Ga0075369_10298952 | |||
| 1124 | Ga0075436_100568384 | |||
| 1125 | Ga0075436_100634387 | |||
| 1126 | Ga0075436_100767859 | |||
| 1127 | Ga0099823_1000177 | |||
| 1128 | Ga0099823_1016124 | |||
| 1129 | Ga0079104_1000539 | |||
| 1130 | Ga0079104_1018851 | |||
| 1131 | Ga0105251_10000104 | |||
| 1132 | Ga0105251_10019360 | |||
| 1133 | Ga0105251_10020292 | |||
| 1134 | Ga0105251_10026999 | |||
| 1135 | Ga0105251_10043680 | |||
| 1136 | Ga0105251_10047094 | |||
| 1137 | Ga0105251_10065037 | |||
| 1138 | Ga0105251_10102850 | |||
| 1139 | Ga0105251_10114021 | |||
| 1140 | Ga0105251_10161218 | |||
| 1141 | Ga0105251_10167882 | |||
| 1142 | Ga0105244_10000133 | |||
| 1143 | Ga0105244_10009150 | |||
| 1144 | Ga0105244_10009484 | |||
| 1145 | Ga0105244_10009597 | |||
| 1146 | Ga0105244_10009634 | |||
| 1147 | Ga0105244_10010441 | |||
| 1148 | Ga0105244_10022468 | |||
| 1149 | Ga0105244_10029465 | |||
| 1150 | Ga0105244_10056126 | |||
| 1151 | Ga0105250_10000361 | |||
| 1152 | Ga0105250_10005073 | |||
| 1153 | Ga0105250_10013889 | |||
| 1154 | Ga0105250_10017753 | |||
| 1155 | Ga0105250_10017773 | |||
| 1156 | Ga0105250_10189942 | |||
| 1157 | Ga0105250_10284556 | |||
| 1158 | Ga0105250_10344527 | |||
| 1159 | Ga0105245_10457403 | |||
| 1160 | Ga0105243_10001154 | |||
| 1161 | Ga0105243_10001733 | |||
| 1162 | Ga0105243_10059143 | |||
| 1163 | Ga0105243_10107790 | |||
| 1164 | Ga0105243_10173707 | |||
| 1165 | Ga0105243_10992986 | |||
| 1166 | Ga0105246_10001162 | |||
| 1167 | Ga0105246_10003513 | |||
| 1168 | Ga0105246_10190086 | |||
| 1169 | Ga0157345_1000176 | |||
| 1170 | Ga0157373_10089733 | |||
| 1171 | Ga0157373_10131522 | |||
| 1172 | Ga0157373_10464642 | |||
| 1173 | Ga0157371_10000233 | |||
| 1174 | Ga0157371_10011092 | |||
| 1175 | Ga0157371_10034302 | |||
| 1176 | Ga0157371_10068468 | |||
| 1177 | Ga0157370_10000390 | |||
| 1178 | Ga0157370_10061065 | |||
| 1179 | Ga0157370_10155893 | |||
| 1180 | Ga0157370_10257223 | |||
| 1181 | Ga0157370_10965379 | |||
| 1182 | Ga0157369_10102595 | |||
| 1183 | Ga0157369_10119736 | |||
| 1184 | Ga0157369_10320900 | |||
| 1185 | Ga0163162_10003052 | |||
| 1186 | Ga0163162_10066822 | |||
| 1187 | Ga0157372_10005864 | |||
| 1188 | Ga0157372_10065827 | |||
| 1189 | Ga0157375_10982389 | |||
| 1190 | Ga0157375_11933218 | |||
| 1191 | Ga0182008_10005996 | |||
| 1192 | Ga0182008_10020651 | |||
| 1193 | Ga0182008_10026627 | |||
| 1194 | Ga0182008_10056527 | |||
| 1195 | Ga0182008_10072364 | |||
| 1196 | Ga0182006_1012868 | |||
| 1197 | Ga0182006_1013084 | |||
| 1198 | Ga0182006_1017999 | |||
| 1199 | Ga0182006_1032087 | |||
| 1200 | Ga0182006_1069247 | |||
| 1201 | Ga0182007_10010965 | |||
| 1202 | Ga0182005_1006759 | |||
| 1203 | Ga0182005_1024762 | |||
| 1204 | Ga0182005_1064846 | |||
| 1205 | Ga0182005_1067760 | |||
| 1206 | Ga0182005_1099210 | |||
| 1207 | Ga0163161_10035419 | |||
| 1208 | Ga0163161_10039215 | |||
| 1209 | Ga0163161_10039329 | |||
| 1210 | Ga0163161_10106056 | |||
| 1211 | Ga0163161_10214107 | |||
| 1212 | Ga0163161_10823444 | |||
| 1213 | Ga0209760_100225 | |||
| 1214 | Ga0209563_103226 | |||
| 1215 | Ga0207427_100014 | |||
| 1216 | Ga0209437_100016 | |||
| 1217 | Ga0209233_1000036 | |||
| 1218 | Ga0209676_1000025 | |||
| 1219 | Ga0209676_1000096 | |||
| 1220 | Ga0209676_1000326 | |||
| 1221 | Ga0209676_1001088 | |||
| 1222 | Ga0209050_1000025 | |||
| 1223 | Ga0209050_1000028 | |||
| 1224 | Ga0209050_1000475 | |||
| 1225 | Ga0209050_1002001 | |||
| 1226 | Ga0209051_1000387 | |||
| 1227 | Ga0209051_1000470 | |||
| 1228 | Ga0209051_1000580 | |||
| 1229 | Ga0209051_1007099 | |||
| 1230 | Ga0209257_1000034 | |||
| 1231 | Ga0209257_1009542 | |||
| 1232 | Ga0207696_1000057 | |||
| 1233 | Ga0207696_1000074 | |||
| 1234 | Ga0207696_1000217 | |||
| 1235 | Ga0207696_1002029 | |||
| 1236 | Ga0207696_1010903 | |||
| 1237 | Ga0207696_1016483 | |||
| 1238 | Ga0207696_1016657 | |||
| 1239 | Ga0207696_1045209 | |||
| 1240 | Ga0207655_1000014 | |||
| 1241 | Ga0207655_1000867 | |||
| 1242 | Ga0207655_1000897 | |||
| 1243 | Ga0207655_1000962 | |||
| 1244 | Ga0207655_1002756 | |||
| 1245 | Ga0207655_1002795 | |||
| 1246 | Ga0207655_1004225 | |||
| 1247 | Ga0207655_1005825 | |||
| 1248 | Ga0207655_1007215 | |||
| 1249 | Ga0207655_1016616 | |||
| 1250 | Ga0207655_1017885 | |||
| 1251 | Ga0207655_1019783 | |||
| 1252 | Ga0207655_1030556 | |||
| 1253 | Ga0207655_1044718 | |||
| 1254 | Ga0207655_1076166 | |||
| 1255 | Ga0207713_1000031 | |||
| 1256 | Ga0207713_1000197 | |||
| 1257 | Ga0207713_1000702 | |||
| 1258 | Ga0207713_1002655 | |||
| 1259 | Ga0207713_1003102 | |||
| 1260 | Ga0207713_1004273 | |||
| 1261 | Ga0207713_1004640 | |||
| 1262 | Ga0207713_1006466 | |||
| 1263 | Ga0207713_1010333 | |||
| 1264 | Ga0207713_1010941 | |||
| 1265 | Ga0207713_1016418 | |||
| 1266 | Ga0207713_1016935 | |||
| 1267 | Ga0207713_1105179 | |||
| 1268 | Ga0207645_10091590 | |||
| 1269 | Ga0207657_10627873 | |||
| 1270 | Ga0207681_10009220 | |||
| 1271 | Ga0207681_10255964 | |||
| 1272 | Ga0207681_10441569 | |||
| 1273 | Ga0207706_10033717 | |||
| 1274 | Ga0207709_10000022 | |||
| 1275 | Ga0207709_10001180 | |||
| 1276 | Ga0207709_10002969 | |||
| 1277 | Ga0207709_10011642 | |||
| 1278 | Ga0207709_10038916 | |||
| 1279 | Ga0207678_10199858 | |||
| 1280 | Ga0209281_1000026 | |||
| 1281 | Ga0209281_1006952 | |||
| 1282 | Ga0209281_1013650 | |||
| 1283 | Ga0209389_1000044 | |||
| 1284 | Ga0209371_1000473 | |||
| 1285 | Ga0209371_1050956 | |||
| 1286 | Ga0209995_1002635 | |||
| 1287 | Ga0209999_1020422 | |||
| 1288 | Ga0209983_1001939 | |||
| 1289 | Ga0209971_1009555 | |||
| 1290 | Ga0209974_10035406 | |||
| 1291 | Ga0207428_10125749 | |||
| 1292 | Ga0207428_10413525 | |||
| 1293 | Ga0207428_10564090 | |||
| 1294 | Ga0207428_10604899 | |||
| 1295 | Ga0207428_10802611 | |||
| 1296 | Ga0268266_10007185 | |||
| 1297 | Ga0268256_1000399 | |||
| 1298 | Ga0268256_1057278 | |||
| 1299 | Ga0307511_10033012 | |||
| 1300 | Ga0316179_1078240 | |||
| 1301 | Ga0316178_1090733 | |||
| 1302 | Ga0307408_100038945 | |||
| 1303 | Ga0307408_100522651 | |||
| 1304 | Ga0307408_101049434 | |||
| 1305 | Ga0307516_10261146 | |||
| 1306 | Ga0307406_10543306 | |||
| 1307 | Ga0307407_10056936 | |||
| 1308 | Ga0307409_101261004 | |||
| 1309 | Ga0307414_10033174 | |||
| 1310 | Ga0307411_10373293 | |||
| 1311 | Ga0307510_10002054 | |||
| 1312 | Ga0307510_10183661 | |||
| 1313 | Ga0237819_00826 | |||
| 1314 | Ga0439436_0000062 | |||
| 1315 | Ga0439438_001641 | |||
| 1316 | Ga0439438_001921 | |||
| 1317 | Ga0439438_003489 | |||
| 1318 | Ga0439438_008252 | |||
| 1319 | Ga0439438_015684 | |||
| 1320 | Ga0439438_017243 | |||
| 1321 | Ga0439438_022627 | |||
| 1322 | Ga0439447_001815 | |||
| 1323 | Ga0439447_002310 | |||
| 1324 | Ga0439447_002859 | |||
| 1325 | Ga0439447_012464 | |||
| 1326 | Ga0439447_016495 | |||
| 1327 | Ga0439466_0002649 | |||
| 1328 | Ga0439466_0013171 | |||
| 1329 | Ga0439466_0013487 | |||
| 1330 | Ga0439466_0022494 | |||
| 1331 | Ga0439466_0023715 | |||
| 1332 | Ga0439466_0028381 | |||
| 1333 | Ga0439466_0039921 | |||
| 1334 | Ga0439465_0124806 | |||
| 1335 | Ga0439432_014694 | |||
| 1336 | Ga0439432_016195 | |||
| 1337 | Ga0439432_019285 | |||
| 1338 | Ga0439432_020115 | |||
| 1339 | Ga0439432_029402 | |||
| 1340 | Ga0439432_038164 | |||
| 1341 | Ga0439451_000675 | |||
| 1342 | Ga0439451_025628 | |||
| 1343 | Ga0439451_068461 | |||
| 1344 | Ga0439452_000824 | |||
| 1345 | Ga0439452_001540 | |||
| 1346 | Ga0439452_002889 | |||
| 1347 | Ga0439452_009982 | |||
| 1348 | Ga0439452_014706 | |||
| 1349 | Ga0439456_000398 | |||
| 1350 | Ga0439456_013370 | |||
| 1351 | Ga0439456_015375 | |||
| 1352 | Ga0439456_023300 | |||
| 1353 | Ga0439463_000024 | |||
| 1354 | Ga0439463_001205 | |||
| 1355 | Ga0439463_007919 | |||
| 1356 | Ga0439463_113253 | |||
| 1357 | Ga0439463_161716 | |||
| 1358 | Ga0450911_000022 | |||
| 1359 | Ga0450911_003916 | |||
| 1360 | Ga0450911_011327 | |||
| 1361 | Ga0450911_022730 | |||
| 1362 | Ga0450919_000300 | |||
| 1363 | Ga0450919_004708 | |||
| 1364 | Ga0450920_008064 | |||
| 1365 | Ga0450922_000929 | |||
| 1366 | Ga0450890_000272 | |||
| 1367 | Ga0450900_000039 | |||
| 1368 | Ga0450902_001104 | |||
| 1369 | Ga0450902_001796 | |||
| 1370 | Ga0450902_005699 | |||
| 1371 | Ga0450902_007048 | |||
| 1372 | Ga0450902_007937 | |||
| 1373 | Ga0450902_008194 | |||
| 1374 | Ga0450903_004487 | |||
| 1375 | Ga0450903_022353 | |||
| 1376 | Ga0450904_002631 | |||
| 1377 | Ga0450905_001598 | |||
| 1378 | Ga0450905_001808 | |||
| 1379 | Ga0450905_003686 | |||
| 1380 | Ga0450905_006271 | |||
| 1381 | Ga0450906_004750 | |||
| 1382 | Ga0450907_000124 | |||
| 1383 | Ga0450907_007158 | |||
| 1384 | Ga0450907_007358 | |||
| 1385 | Ga0450910_040012 | |||
| 1386 | Ga0439446_0010629 | |||
| 1387 | Ga0439446_0012698 | |||
| 1388 | Ga0439446_0013651 | |||
| 1389 | Ga0439446_0015621 | |||
| 1390 | Ga0450908_017304 | |||
| 1391 | Ga0450909_000036 | |||
| 1392 | Ga0450909_006604 | |||
| 1393 | Ga0450909_008987 | |||
| 1394 | Ga0450909_052867 | |||
| 1395 | Ga0439434_0001360 | |||
| 1396 | Ga0439459_0011424 | |||
| 1397 | Ga0439464_0075318 | |||
| 1398 | Ga0439460_0003679 | |||
| 1399 | Ga0439460_0010730 | |||
| 1400 | Ga0439460_0014234 | |||
| 1401 | Ga0439460_0237740 | |||
| 1402 | Ga0450916_004833 | |||
| 1403 | Ga0450918_007824 | |||
| 1404 | Ga0450918_024112 | |||
| 1405 | Ga0450901_000816 | |||
| 1406 | Ga0439440_0006947 | |||
| 1407 | Ga0439440_0007972 | |||
| 1408 | Ga0439440_0069018 | |||
| 1409 | Ga0495617_000314 | |||
| 1410 | Ga0495617_013883 | |||
| 1411 | Ga0495617_040566 | |||
| 1412 | Ga0495617_078225 | |||
| 1413 | Ga0495617_133897 | |||
| 1414 | Ga0495617_175316 | |||
| 1415 | Ga0495617_193406 | |||
| 1416 | Ga0495627_000175 | |||
| 1417 | Ga0495627_002136 | |||
| 1418 | Ga0495627_003507 | |||
| 1419 | Ga0495627_012863 | |||
| 1420 | Ga0495627_019179 | |||
| 1421 | Ga0495627_073963 | |||
| 1422 | Ga0495627_198216 | |||
| 1423 | Ga0495603_0125989 | |||
| 1424 | Ga0495603_0288222 | |||
| 1425 | Ga0495603_0454553 | |||
| 1426 | Ga0495590_0007321 | |||
| 1427 | Ga0495590_0012337 | |||
| 1428 | Ga0495590_0025012 | |||
| 1429 | Ga0495590_0111044 | |||
| 1430 | Ga0495591_000161 | |||
| 1431 | Ga0495591_004389 | |||
| 1432 | Ga0495591_004607 | |||
| 1433 | Ga0495591_005579 | |||
| 1434 | Ga0495591_006363 | |||
| 1435 | Ga0495591_008772 | |||
| 1436 | Ga0495591_009985 | |||
| 1437 | Ga0495591_010205 | |||
| 1438 | Ga0495591_011193 | |||
| 1439 | Ga0495591_021567 | |||
| 1440 | Ga0495591_027782 | |||
| 1441 | Ga0495591_032286 | |||
| 1442 | Ga0495638_0039352 | |||
| 1443 | Ga0495638_0045227 | |||
| 1444 | Ga0495638_0070691 | |||
| 1445 | Ga0495638_0080123 | |||
| 1446 | Ga0495638_0080330 | |||
| 1447 | Ga0495638_0082015 | |||
| 1448 | Ga0495638_0099669 | |||
| 1449 | Ga0495638_0132551 | |||
| 1450 | Ga0495653_0010870 | |||
| 1451 | Ga0495653_0024884 | |||
| 1452 | Ga0495653_0138868 | |||
| 1453 | Ga0495650_0000626 | |||
| 1454 | Ga0495650_0028194 | |||
| 1455 | Ga0495650_0031717 | |||
| 1456 | Ga0495650_0036266 | |||
| 1457 | Ga0495650_0232151 | |||
| 1458 | Ga0495582_0006770 | |||
| 1459 | Ga0495605_0000388 | |||
| 1460 | Ga0495605_0000507 | |||
| 1461 | Ga0495605_0001585 | |||
| 1462 | Ga0495605_0005024 | |||
| 1463 | Ga0495605_0011668 | |||
| 1464 | Ga0495605_0029762 | |||
| 1465 | Ga0495605_0044954 | |||
| 1466 | Ga0495605_0045373 | |||
| 1467 | Ga0495605_0047739 | |||
| 1468 | Ga0495605_0066514 | |||
| 1469 | Ga0495605_0070223 | |||
| 1470 | Ga0495605_0075372 | |||
| 1471 | Ga0495605_0078382 | |||
| 1472 | Ga0495605_0082909 | |||
| 1473 | Ga0495605_0175897 | |||
| 1474 | Ga0495639_0000692 | |||
| 1475 | Ga0495639_0014581 | |||
| 1476 | Ga0495639_0047854 | |||
| 1477 | Ga0495639_0095030 | |||
| 1478 | Ga0495584_0000577 | |||
| 1479 | Ga0495584_0013493 | |||
| 1480 | Ga0495584_0016937 | |||
| 1481 | Ga0495584_0030107 | |||
| 1482 | Ga0495584_0031464 | |||
| 1483 | Ga0495584_0033867 | |||
| 1484 | Ga0495584_0124413 | |||
| 1485 | Ga0495585_0000557 | |||
| 1486 | Ga0495585_0050673 | |||
| 1487 | Ga0495585_0066298 | |||
| 1488 | Ga0495585_0092772 | |||
| 1489 | Ga0495585_0189010 | |||
| 1490 | Ga0495594_0026096 | |||
| 1491 | Ga0495594_0035133 | |||
| 1492 | Ga0495594_0044846 | |||
| 1493 | Ga0495596_0000324 | |||
| 1494 | Ga0495596_0023163 | |||
| 1495 | Ga0495596_0318012 | |||
| 1496 | Ga0495607_0000534 | |||
| 1497 | Ga0495607_0000578 | |||
| 1498 | Ga0495607_0000620 | |||
| 1499 | Ga0495607_0006804 | |||
| 1500 | Ga0495607_0008047 | |||
| 1501 | Ga0495607_0011632 | |||
| 1502 | Ga0495607_0021909 | |||
| 1503 | Ga0495607_0025325 | |||
| 1504 | Ga0495607_0033400 | |||
| 1505 | Ga0495607_0036117 | |||
| 1506 | Ga0495607_0041558 | |||
| 1507 | Ga0495607_0044632 | |||
| 1508 | Ga0495607_0045910 | |||
| 1509 | Ga0495607_0051532 | |||
| 1510 | Ga0495607_0068252 | |||
| 1511 | Ga0495607_0082324 | |||
| 1512 | Ga0495607_0091896 | |||
| 1513 | Ga0495607_0349154 | |||
| 1514 | Ga0495583_0000899 | |||
| 1515 | Ga0495583_0005200 | |||
| 1516 | Ga0495583_0005349 | |||
| 1517 | Ga0495583_0042002 | |||
| 1518 | Ga0495583_0050567 | |||
| 1519 | Ga0495583_0058426 | |||
| 1520 | Ga0495606_0000352 | |||
| 1521 | Ga0495606_0001099 | |||
| 1522 | Ga0495606_0007808 | |||
| 1523 | Ga0495606_0011823 | |||
| 1524 | Ga0495606_0011952 | |||
| 1525 | Ga0495606_0020823 | |||
| 1526 | Ga0495606_0021648 | |||
| 1527 | Ga0495606_0034675 | |||
| 1528 | Ga0495606_0075924 | |||
| 1529 | Ga0495606_0109992 | |||
| 1530 | Ga0495606_0118500 | |||
| 1531 | Ga0495606_0154697 | |||
| 1532 | Ga0495610_0006298 | |||
| 1533 | Ga0495610_0009612 | |||
| 1534 | Ga0495610_0027880 | |||
| 1535 | Ga0495610_0028497 | |||
| 1536 | Ga0495610_0036858 | |||
| 1537 | Ga0495610_0044484 | |||
| 1538 | Ga0495610_0045758 | |||
| 1539 | Ga0495610_0052518 | |||
| 1540 | Ga0495610_0058862 | |||
| 1541 | Ga0495610_0059247 | |||
| 1542 | Ga0495610_0171192 | |||
| 1543 | Ga0495616_0010661 | |||
| 1544 | Ga0495616_0016872 | |||
| 1545 | Ga0495616_0021933 | |||
| 1546 | Ga0495616_0023399 | |||
| 1547 | Ga0495616_0027472 | |||
| 1548 | Ga0495616_0032193 | |||
| 1549 | Ga0495616_0040787 | |||
| 1550 | Ga0495616_0072174 | |||
| 1551 | Ga0495616_0114461 | |||
| 1552 | Ga0495620_0000091 | |||
| 1553 | Ga0495620_0002337 | |||
| 1554 | Ga0495620_0004494 | |||
| 1555 | Ga0495620_0020359 | |||
| 1556 | Ga0495620_0028010 | |||
| 1557 | Ga0495620_0029249 | |||
| 1558 | Ga0495620_0038026 | |||
| 1559 | Ga0495620_0039369 | |||
| 1560 | Ga0495620_0049177 | |||
| 1561 | Ga0495620_0064944 | |||
| 1562 | Ga0495630_0127785 | |||
| 1563 | Ga0495630_0145040 | |||
| 1564 | Ga0495630_0279041 | |||
| 1565 | Ga0495630_0370659 | |||
| 1566 | Ga0495631_0002843 | |||
| 1567 | Ga0495631_0003080 | |||
| 1568 | Ga0495631_0011798 | |||
| 1569 | Ga0495631_0021649 | |||
| 1570 | Ga0495631_0040057 | |||
| 1571 | Ga0495632_0002770 | |||
| 1572 | Ga0495632_0003643 | |||
| 1573 | Ga0495632_0003662 | |||
| 1574 | Ga0495632_0004504 | |||
| 1575 | Ga0495632_0006990 | |||
| 1576 | Ga0495632_0009636 | |||
| 1577 | Ga0495632_0026667 | |||
| 1578 | Ga0495632_0029199 | |||
| 1579 | Ga0495632_0031569 | |||
| 1580 | Ga0495632_0053755 | |||
| 1581 | Ga0495632_0061568 | |||
| 1582 | Ga0495632_0156950 | |||
| 1583 | Ga0495632_0157832 | |||
| 1584 | Ga0495637_0000020 | |||
| 1585 | Ga0495637_0001123 | |||
| 1586 | Ga0495637_0007688 | |||
| 1587 | Ga0495637_0009343 | |||
| 1588 | Ga0495637_0020649 | |||
| 1589 | Ga0495637_0028059 | |||
| 1590 | Ga0495637_0034687 | |||
| 1591 | Ga0495637_0037795 | |||
| 1592 | Ga0495637_0040927 | |||
| 1593 | Ga0495637_0075269 | |||
| 1594 | Ga0495637_0105298 | |||
| 1595 | Ga0495637_0198272 | |||
| 1596 | Ga0495643_0000501 | |||
| 1597 | Ga0495643_0001109 | |||
| 1598 | Ga0495643_0001225 | |||
| 1599 | Ga0495643_0006782 | |||
| 1600 | Ga0495643_0024246 | |||
| 1601 | Ga0495643_0039993 | |||
| 1602 | Ga0495643_0047632 | |||
| 1603 | Ga0495643_0067351 | |||
| 1604 | Ga0495643_0084275 | |||
| 1605 | Ga0495643_0093464 | |||
| 1606 | Ga0495644_0002973 | |||
| 1607 | Ga0495644_0010727 | |||
| 1608 | Ga0495644_0011748 | |||
| 1609 | Ga0495644_0030339 | |||
| 1610 | Ga0495644_0156428 | |||
| 1611 | Ga0495648_0000968 | |||
| 1612 | Ga0495648_0002060 | |||
| 1613 | Ga0495648_0009495 | |||
| 1614 | Ga0495648_0015522 | |||
| 1615 | Ga0495648_0021856 | |||
| 1616 | Ga0495648_0068510 | |||
| 1617 | Ga0495648_0070662 | |||
| 1618 | Ga0495648_0078195 | |||
| 1619 | Ga0495648_0081364 | |||
| 1620 | Ga0495648_0112072 | |||
| 1621 | Ga0495648_0140022 | |||
| 1622 | Ga0495648_0216240 | |||
| 1623 | Ga0495666_0022401 | |||
| 1624 | Ga0495666_0044347 | |||
| 1625 | Ga0495666_0131039 | |||
| 1626 | Ga0495642_0000682 | |||
| 1627 | Ga0495642_0000820 | |||
| 1628 | Ga0495642_0001726 | |||
| 1629 | Ga0495652_0241365 | |||
| 1630 | Ga0495654_0003950 | |||
| 1631 | Ga0495654_0004366 | |||
| 1632 | Ga0495654_0005946 | |||
| 1633 | Ga0495654_0015554 | |||
| 1634 | Ga0495654_0019233 | |||
| 1635 | Ga0495654_0027363 | |||
| 1636 | Ga0495654_0032814 | |||
| 1637 | Ga0495654_0069119 | |||
| 1638 | Ga0495654_0093713 | |||
| 1639 | Ga0495654_0144436 | |||
| 1640 | Ga0495654_0148699 | |||
| 1641 | Ga0495654_0175132 | |||
| 1642 | Ga0495665_0623007 | |||
| 1643 | Ga0495586_0014612 | |||
| 1644 | Ga0495587_0002819 | |||
| 1645 | Ga0495587_0026456 | |||
| 1646 | Ga0495609_0000290 | |||
| 1647 | Ga0495609_0001221 | |||
| 1648 | Ga0495609_0014550 | |||
| 1649 | Ga0495609_0019466 | |||
| 1650 | Ga0495609_0029957 | |||
| 1651 | Ga0495609_0046854 | |||
| 1652 | Ga0495609_0241104 | |||
| 1653 | Ga0495609_0332898 | |||
| 1654 | Ga0495597_0000124 | |||
| 1655 | Ga0495597_0013161 | |||
| 1656 | Ga0495597_0016570 | |||
| 1657 | Ga0495597_0040570 | |||
| 1658 | Ga0495597_0093547 | |||
| 1659 | Ga0495597_0138656 | |||
| 1660 | Ga0495597_0173872 | |||
| 1661 | Ga0495622_0002899 | |||
| 1662 | Ga0495622_0003756 | |||
| 1663 | Ga0495622_0031292 | |||
| 1664 | Ga0495622_0071392 | |||
| 1665 | Ga0495622_0071700 | |||
| 1666 | Ga0495622_0163069 | |||
| 1667 | Ga0495633_0002988 | |||
| 1668 | Ga0495633_0056961 | |||
| 1669 | Ga0495633_0057199 | |||
| 1670 | Ga0495656_0010252 | |||
| 1671 | Ga0495668_0007486 | |||
| 1672 | Ga0495668_0008203 | |||
| 1673 | Ga0495668_0049213 | |||
| 1674 | Ga0495668_0082720 | |||
| 1675 | Ga0495668_0128969 | |||
| 1676 | Ga0495634_0006248 | |||
| 1677 | Ga0495634_0249873 | |||
| 1678 | Ga0495611_0000246 | |||
| 1679 | Ga0495611_0005069 | |||
| 1680 | Ga0495611_0006086 | |||
| 1681 | Ga0495611_0037491 | |||
| 1682 | Ga0495611_0046602 | |||
| 1683 | Ga0495611_0059863 | |||
| 1684 | Ga0495625_0000133 | |||
| 1685 | Ga0495625_0013436 | |||
| 1686 | Ga0495625_0041245 | |||
| 1687 | Ga0495625_0063578 | |||
| 1688 | Ga0495625_0078318 | |||
| 1689 | Ga0495625_0100065 | |||
| 1690 | Ga0495625_0105766 | |||
| 1691 | Ga0495625_0147171 | |||
| 1692 | Ga0495625_0212990 | |||
| 1693 | Ga0495635_0013225 | |||
| 1694 | Ga0495635_0020866 | |||
| 1695 | Ga0495661_0000370 | |||
| 1696 | Ga0495661_0000387 | |||
| 1697 | Ga0495661_0006814 | |||
| 1698 | Ga0495661_0007392 | |||
| 1699 | Ga0495661_0074784 | |||
| 1700 | Ga0495661_0081303 | |||
| 1701 | Ga0495661_0302773 | |||
| 1702 | Ga0495661_0326963 | |||
| 1703 | Ga0495588_0015482 | |||
| 1704 | Ga0495588_0084129 | |||
| 1705 | Ga0495623_0050615 | |||
| 1706 | Ga0495623_0065286 | |||
| 1707 | Ga0495646_0016248 | |||
| 1708 | Ga0495646_0024531 | |||
| 1709 | Ga0495646_0084373 | |||
| 1710 | Ga0495669_0005649 | |||
| 1711 | Ga0495613_0095466 | |||
| 1712 | Ga0495613_0269555 | |||
| 1713 | Ga0495624_0017341 | |||
| 1714 | Ga0495670_0002253 | |||
| 1715 | Ga0495670_0027490 | |||
| 1716 | Ga0495670_0038449 | |||
| 1717 | Ga0495670_0045040 | |||
| 1718 | Ga0495670_0051702 | |||
| 1719 | Ga0495670_0226566 | |||
| 1720 | Ga0495670_0254715 | |||
| 1721 | Ga0495671_0004223 | |||
| 1722 | Ga0495671_0005897 | |||
| 1723 | Ga0495671_0007349 | |||
| 1724 | Ga0495671_0009941 | |||
| 1725 | Ga0495671_0031351 | |||
| 1726 | Ga0495671_0033507 | |||
| 1727 | Ga0495671_0034565 | |||
| 1728 | Ga0495671_0045516 | |||
| 1729 | Ga0495671_0047926 | |||
| 1730 | Ga0495671_0049424 | |||
| 1731 | Ga0495671_0055645 | |||
| 1732 | Ga0495671_0132293 | |||
| 1733 | Ga0495649_0048044 | |||
| 1734 | Ga0495649_0060180 | |||
| 1735 | Ga0495649_0081869 | |||
| 1736 | Ga0495649_0082824 | |||
| 1737 | Ga0495649_0085606 | |||
| 1738 | Ga0495649_0105302 | |||
| 1739 | Ga0495649_0113253 | |||
| 1740 | Ga0495649_0211547 | |||
| 1741 | Ga0495589_0000698 | |||
| 1742 | Ga0495589_0015727 | |||
| 1743 | Ga0495589_0041352 | |||
| 1744 | Ga0495589_0051354 | |||
| 1745 | Ga0495589_0052660 | |||
| 1746 | Ga0495589_0052770 | |||
| 1747 | Ga0495589_0116343 | |||
| 1748 | Ga0495600_0013015 | |||
| 1749 | Ga0495600_0080500 | |||
| 1750 | Ga0495660_0000430 | |||
| 1751 | Ga0495660_0024905 | |||
| 1752 | Ga0495660_0025369 | |||
| 1753 | Ga0495660_0045130 | |||
| 1754 | Ga0495660_0057511 | |||
| 1755 | Ga0495660_0061691 | |||
| 1756 | Ga0495660_0063952 | |||
| 1757 | Ga0495660_0216834 | |||
| 1758 | Ga0495581_0023930 | |||
| 1759 | Ga0495604_0049683 | |||
| 1760 | Ga0495604_0054144 | |||
| 1761 | Ga0495604_0076917 | |||
| 1762 | Ga0495636_0006766 | |||
| 1763 | Ga0495636_0048398 | |||
| 1764 | Ga0495674_0026989 | |||
| 1765 | Ga0495672_0003108 | |||
| 1766 | Ga0495672_0005519 | |||
| 1767 | Ga0495672_0008532 | |||
| 1768 | Ga0495672_0013766 | |||
| 1769 | Ga0495672_0017277 | |||
| 1770 | Ga0495672_0039260 | |||
| 1771 | Ga0495672_0039926 | |||
| 1772 | Ga0495672_0051371 | |||
| 1773 | Ga0495672_0066149 | |||
| 1774 | Ga0495672_0072863 | |||
| 1775 | Ga0495672_0074919 | |||
| 1776 | Ga0495672_0083549 | |||
| 1777 | Ga0495672_0084040 | |||
| 1778 | Ga0495672_0104812 | |||
| 1779 | Ga0495672_0106052 | |||
| 1780 | Ga0495672_0264052 | |||
| 1781 | Ga0495676_0000202 | |||
| 1782 | Ga0495676_0103938 | |||
| 1783 | Ga0495676_0328254 | |||
| 1784 | Ga0495680_0010632 | |||
| 1785 | Ga0495680_0066973 | |||
| 1786 | Ga0495680_0106174 | |||
| 1787 | Ga0495680_0175340 | |||
| 1788 | Ga0495683_0001649 | |||
| 1789 | Ga0495683_0052649 | |||
| 1790 | Ga0495683_0058262 | |||
| 1791 | Ga0495683_0064625 | |||
| 1792 | Ga0495683_0208798 | |||
| 1793 | Ga0495683_0252427 | |||
| 1794 | Ga0495687_005986 | |||
| 1795 | Ga0495687_078465 | |||
| 1796 | Ga0495687_078642 | |||
| 1797 | Ga0495687_111603 | |||
| 1798 | Ga0495675_0002810 | |||
| 1799 | Ga0495675_0024366 | |||
| 1800 | Ga0495677_0001888 | |||
| 1801 | Ga0495679_000643 | |||
| 1802 | Ga0495679_020145 | |||
| 1803 | Ga0495679_024325 | |||
| 1804 | Ga0495685_049997 | |||
| 1805 | Ga0495685_089876 | |||
| 1806 | Ga0495673_0002259 | |||
| 1807 | Ga0495673_0003730 | |||
| 1808 | Ga0495673_0010555 | |||
| 1809 | Ga0495673_0011356 | |||
| 1810 | Ga0495673_0015661 | |||
| 1811 | Ga0495673_0020515 | |||
| 1812 | Ga0495673_0020663 | |||
| 1813 | Ga0495673_0022687 | |||
| 1814 | Ga0495673_0029183 | |||
| 1815 | Ga0495673_0037694 | |||
| 1816 | Ga0495673_0037778 | |||
| 1817 | Ga0495673_0039685 | |||
| 1818 | Ga0495673_0040037 | |||
| 1819 | Ga0495673_0040566 | |||
| 1820 | Ga0495673_0062208 | |||
| 1821 | Ga0495673_0070525 | |||
| 1822 | Ga0495673_0083538 | |||
| 1823 | Ga0495673_0102250 | |||
| 1824 | Ga0495673_0187617 | |||
| 1825 | Ga0495681_0007827 | |||
| 1826 | Ga0495681_0008230 | |||
| 1827 | Ga0495681_0016374 | |||
| 1828 | Ga0495681_0018404 | |||
| 1829 | Ga0495681_0023306 | |||
| 1830 | Ga0495681_0050440 | |||
| 1831 | Ga0495681_0092415 | |||
| 1832 | Ga0495681_0114735 | |||
| 1833 | Ga0495681_0132883 | |||
| 1834 | Ga0495681_0155058 | |||
| 1835 | Ga0495681_0172580 | |||
| 1836 | Ga0495684_0355180 | |||
| 1837 | Ga0495686_0030487 | |||
| 1838 | Ga0495686_0040000 | |||
| 1839 | Ga0495686_0045996 | |||
| 1840 | Ga0495686_0087385 | |||
| 1841 | Ga0495593_0040694 | |||
| 1842 | Ga0495593_0064489 | |||
| 1843 | Ga0495593_0087067 | |||
| 1844 | Ga0495593_0088568 | |||
| 1845 | Ga0495593_0428703 | |||
| 1846 | Ga0495602_0030647 | |||
| 1847 | Ga0495614_0049165 | |||
| 1848 | Ga0495626_0000371 | |||
| 1849 | Ga0495626_0000714 | |||
| 1850 | Ga0495626_0001454 | |||
| 1851 | Ga0495626_0019345 | |||
| 1852 | Ga0495626_0019436 | |||
| 1853 | Ga0495626_0021312 | |||
| 1854 | Ga0495626_0026151 | |||
| 1855 | Ga0495626_0044676 | |||
| 1856 | Ga0495626_0109088 | |||
| 1857 | Ga0495626_0250479 | |||
| 1858 | Ga0496101_0196899 | |||
| 1859 | Ga0496102_0002520 | |||
| 1860 | Ga0496102_0151353 | |||
| 1861 | Ga0496103_0078049 | |||
| 1862 | Ga0496103_0278873 | |||
| 1863 | Ga0496104_0593530 | |||
| 1864 | Ga0496106_0867098 | |||
| 1865 | Ga0496108_1342889 | |||
| 1866 | Ga0496110_0103273 | |||
| 1867 | Ga0496110_0188243 | |||
| 1868 | Ga0496110_0363999 | |||
| 1869 | Ga0496111_0043669 | |||
| 1870 | Ga0496111_0382164 | |||
| 1871 | Ga0496111_0550360 | |||
| 1872 | Ga0496113_0296097 | |||
| 1873 | Ga0496114_0022211 | |||
| 1874 | Ga0496116_0000567 | |||
| 1875 | Ga0496116_0000699 | |||
| 1876 | Ga0496116_0004261 | |||
| 1877 | Ga0496116_0049029 | |||
| 1878 | Ga0496116_0078719 | |||
| 1879 | Ga0496116_0336904 | |||
| 1880 | Ga0496117_0004225 | |||
| 1881 | Ga0496117_0005023 | |||
| 1882 | Ga0496117_0007729 | |||
| 1883 | Ga0496117_0008113 | |||
| 1884 | Ga0496117_0014922 | |||
| 1885 | Ga0496117_0086225 | |||
| 1886 | Ga0496117_0144853 | |||
| 1887 | Ga0496117_0196015 | |||
| 1888 | Ga0496118_0005868 | |||
| 1889 | Ga0496118_0007244 | |||
| 1890 | Ga0496118_0032262 | |||
| 1891 | Ga0496118_0074304 | |||
| 1892 | Ga0496118_0097296 | |||
| 1893 | Ga0496118_0098574 | |||
| 1894 | Ga0496118_0100630 | |||
| 1895 | Ga0496118_0121122 | |||
| 1896 | Ga0496119_0000448 | |||
| 1897 | Ga0496119_0111855 | |||
| 1898 | Ga0496119_0128606 | |||
| 1899 | Ga0496120_0011575 | |||
| 1900 | Ga0496120_0032332 | |||
| 1901 | Ga0496121_0002566 | |||
| 1902 | Ga0496121_0006254 | |||
| 1903 | Ga0496121_0019527 | |||
| 1904 | Ga0496121_0095092 | |||
| 1905 | Ga0496121_0111870 | |||
| 1906 | Ga0496121_0118041 | |||
| 1907 | Ga0496121_0127729 | |||
| 1908 | Ga0496121_0205742 | |||
| 1909 | Ga0496121_0229324 | |||
| 1910 | Ga0496122_0001701 | |||
| 1911 | Ga0496122_0007075 | |||
| 1912 | Ga0496122_0011031 | |||
| 1913 | Ga0496122_0017734 | |||
| 1914 | Ga0496122_0091597 | |||
| 1915 | Ga0496122_0098023 | |||
| 1916 | Ga0496122_0166008 | |||
| 1917 | Ga0496122_0174758 | |||
| 1918 | Ga0496122_0268116 | |||
| 1919 | Ga0496122_0323162 | |||
| 1920 | Ga0496123_0000921 | |||
| 1921 | Ga0496123_0005745 | |||
| 1922 | Ga0496123_0013598 | |||
| 1923 | Ga0496123_0058117 | |||
| 1924 | Ga0496123_0093072 | |||
| 1925 | Ga0496123_0113652 | |||
| 1926 | Ga0496123_0126664 | |||
| 1927 | Ga0496124_0000819 | |||
| 1928 | Ga0496124_0005666 | |||
| 1929 | Ga0496124_0008908 | |||
| 1930 | Ga0496124_0011151 | |||
| 1931 | Ga0496124_0011466 | |||
| 1932 | Ga0496124_0019795 | |||
| 1933 | Ga0496124_0058677 | |||
| 1934 | Ga0496124_0059470 | |||
| 1935 | Ga0496124_0114283 | |||
| 1936 | Ga0496124_0131547 | |||
| 1937 | Ga0496124_0136898 | |||
| 1938 | Ga0496124_0151777 | |||
| 1939 | Ga0496124_0277513 | |||
| 1940 | Ga0496124_0455981 | |||
| 1941 | Ga0496124_0466505 | |||
| 1942 | Ga0496125_0003089 | |||
| 1943 | Ga0496125_0013401 | |||
| 1944 | Ga0496125_0026312 | |||
| 1945 | Ga0496125_0052637 | |||
| 1946 | Ga0496125_0062016 | |||
| 1947 | Ga0496125_0554067 | |||
| 1948 | Ga0496126_0049457 | |||
| 1949 | Ga0496126_0072255 | |||
| 1950 | Ga0496126_0144861 | |||
| 1951 | Ga0496126_0162350 | |||
| 1952 | Ga0495678_002756 | |||
| 1953 | Ga0495678_007238 | |||
| 1954 | Ga0495678_012788 | |||
| 1955 | Ga0495678_015303 | |||
| 1956 | Ga0495678_023461 | |||
| 1957 | Ga0495678_028824 | |||
| 1958 | Ga0495678_041403 | |||
| 1959 | Ga0495678_046690 | |||
| 1960 | Ga0495678_047526 | |||
| 1961 | Ga0495678_065995 | |||
| 1962 | Ga0495678_082378 | |||
| 1963 | Ga0495678_121117 | |||
| 1964 | Ga0495682_0001724 | |||
| 1965 | Ga0495682_0027114 | |||
| 1966 | Ga0501032_0090360 | |||
| 1967 | Ga0501034_0000738 | |||
| 1968 | Ga0501034_0681955 | |||
| 1969 | Ga0501034_0793866 | |||
| 1970 | Ga0501037_0248769 | |||
| 1971 | Ga0501241_005375 | |||
| 1972 | Ga0501226_000004 | |||
| 1973 | nmdc:mga03683_171216_c1 | |||
| 1974 | nmdc:mga00v17_406375_c1 | |||
| 1975 | nmdc:mga00v17_55754_c1 | |||
| 1976 | nmdc:mga08x19_295642_c1 | |||
| 1977 | nmdc:mga0sz30_206282_c1 | |||
| 1978 | Ga0500659_0001983 | |||
| 1979 | Ga0500573_0068504 | |||
| 1980 | 2511256135 | |||
| 1981 | 2511263371 | |||
| 1982 | 2511272757 | |||
| 1983 | 2511277666 | |||
| 1984 | 2511288716 | |||
| 1985 | 2511297418 | |||
| 1986 | 2511303359 | |||
| 1987 | 2511316381 | |||
| 1988 | 2511319382 | |||
| 1989 | 2511323483 | |||
| 1990 | 2511330925 | |||
| 1991 | 2511337836 | |||
| 1992 | 2511344598 | |||
| 1993 | 2511349178 | |||
| 1994 | 2511358647 | |||
| 1995 | 2511365080 | |||
| 1996 | 2511367709 | |||
| 1997 | 2511375593 | |||
| 1998 | 2511414364 | |||
| 1999 | 2512326021 | |||
| 2000 | 2554818000 | |||
| 2001 | 2555667495 | |||
| 2002 | 2583789740 | |||
| 2003 | 2597855724 | |||
| 2004 | 2599327299 | |||
| 2005 | 2599356716 | |||
| 2006 | 2599363252 | |||
| 2007 | 2599369796 | |||
| 2008 | 2599376361 | |||
| 2009 | 2599381821 | |||
| 2010 | 2599388035 | |||
| 2011 | 2599395441 | |||
| 2012 | 2599407206 | |||
| 2013 | 2599463549 | |||
| 2014 | 2599469101 | |||
| 2015 | 2599485626 | |||
| 2016 | 2599492568 | |||
| 2017 | 2599500036 | |||
| 2018 | 2599616729 | |||
| 2019 | 2599806756 | |||
| 2020 | 2599930968 | |||
| 2021 | 2599994770 | |||
| 2022 | 2600027277 | |||
| 2023 | 2600036789 | |||
| 2024 | 2600045022 | |||
| 2025 | 2600061135 | |||
| 2026 | 2600068512 | |||
| 2027 | 2600077741 | |||
| 2028 | 2600216178 | |||
| 2029 | 2600364816 | |||
| 2030 | 2601627113 | |||
| 2031 | 2601776345 | |||
| 2032 | 2601797905 | |||
| 2033 | 2606076612 | |||
| 2034 | 2606128974 | |||
| 2035 | 2608380691 | |||
| 2036 | 2624478293 | |||
| 2037 | 2624489834 | |||
| 2038 | 2643841057 | |||
| 2039 | 2643954832 | |||
| 2040 | 2644024472 | |||
| 2041 | 2644190168 | |||
| 2042 | 2671099894 | |||
| 2043 | 2671772407 | |||
| 2044 | 2678261066 | |||
| 2045 | 2691331290 | |||
| 2046 | 2715749277 | |||
| 2047 | 2715755546 | |||
| 2048 | 2718632227 | |||
| 2049 | 2729146050 | |||
| 2050 | 2738687514 | |||
| 2051 | 2739200530 | |||
| 2052 | 2739259992 | |||
| 2053 | 2739263135 | |||
| 2054 | 2739287079 | |||
| 2055 | 2739292392 | |||
| 2056 | 2739311351 | |||
| 2057 | 2743735143 | |||
| 2058 | 2745006377 | |||
| 2059 | 2765581677 | |||
| 2060 | 2774119486 | |||
| 2061 | 2774134806 | |||
| 2062 | 2784260975 | |||
| 2063 | 2784315897 | |||
| 2064 | 2794594105 | |||
| 2065 | 2807406307 | |||
| 2066 | 2807454660 | |||
| 2067 | 2808906547 | |||
| 2068 | 2808932617 | |||
| 2069 | 2808954738 | |||
| 2070 | 2808955945 | |||
| 2071 | 2812370285 | |||
| 2072 | 2819657302 | |||
| 2073 | 2819705290 | |||
| 2074 | 2826586199 | |||
| 2075 | 2842809859 | |||
| 2076 | 2842817831 | |||
| 2077 | 2842834232 | |||
| 2078 | 2842846291 | |||
| 2079 | 2842851779 | |||
| 2080 | 2844667969 | |||
| 2081 | 2852660380 | |||
| 2082 | 2860343567 | |||
| 2083 | 2878030235 | |||
| 2084 | 2880231185 | |||
| 2085 | 2904519640 | |||
| 2086 | 2904555548 | |||
| 2087 | 2908447100 | |||
| 2088 | 2912964252 | |||
| 2089 | 2917071246 | |||
| 2090 | 2919066081 | |||
| 2091 | 2919157658 | |||
| 2092 | 2919389701 | |||
| 2093 | 2919460058 | |||
| 2094 | 2919488630 | |||
| 2095 | 2919534852 | |||
| 2096 | 2919692070 | |||
| 2097 | 2919698885 | |||
| 2098 | 2923154139 | |||
| 2099 | 2923524373 | |||
| 2100 | 2931371771 | |||
| 2101 | 2931398915 | |||
| 2102 | 2935359073 | |||
| 2103 | 2939641178 | |||
| 2104 | 2939655368 | |||
| 2105 | 2945967659 | |||
| 2106 | 2946012440 | |||
| 2107 | 2969305030 | |||
| 2108 | 2974293280 | |||
| 2109 | 2984291920 | |||
| 2110 | 2998140537 | |||
| 2111 | 3007399691 | |||
| 2112 | 3007420087 | |||
| 2113 | 3007517989 | |||
| 2114 | 3007616489 | |||
| 2115 | 3007621973 | |||
| 2116 | 3007720334 | |||
| 2117 | 3007809365 | |||
| 2118 | 3007859769 | |||
| 2119 | 3007864258 | |||
| 2120 | 3007875214 | |||
| 2121 | 637317890 | |||
| 2122 | 640489750 | |||
| 2123 | 651177763 | |||
| 2124 | 8011352721 | |||
| 2125 | 8015688389 | |||
| 2126 | 8019770374 | |||
| 2127 | 8019777411 | |||
| 2128 | 8030000203 | |||
| 2129 | 8052495117 | |||
| 2130 | 8054930774 | |||
| 2131 | 8055771485 | |||
| 2132 | 8055879904 | |||
| 2133 | 8056116803 | |||
| 2134 | 8056125399 | |||
| 2135 | 8056126542 | |||
| 2136 | 8056142477 | |||
| 2137 | 8056158585 | |||
| 2138 | 8056170515 | |||
| 2139 | 8056176633 | |||
| 2140 | 8056182974 | |||
| 2141 | 8056573363 | |||
| 2142 | 8057802776 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5c9b-assembly1.cif.gz_D | crystal structure of a retropepsin-like aspartic protease from rickettsia conorii | 0.8343 | 45 | 173 |
| 1fmb-assembly1.cif.gz_A | eiav protease complexed with the inhibitor hby-793 | 0.8266 | 66 | 155 |
| 5c9d-assembly1.cif.gz_A | crystal structure of a retropepsin-like aspartic protease from rickettsia conorii | 0.8218 | 52 | 173 |
| 4rvi-assembly2.cif.gz_D | crystal structure of multidrug-resistant clinical isolate a02 hiv-1 protease in complex with non-peptidic inhibitor, grl0519 | 0.8136 | 66 | 155 |
| 5c9f-assembly1.cif.gz_B | crystal structure of a retropepsin-like aspartic protease from rickettsia conorii | 0.8099 | 44 | 170 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54J95_15_120_2.40.70.10 | Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases | 0.8143 | 58 | 155 | 2.40.70.10 |
| af_F4J7U9_265_379_2.40.70.10 | Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases | 0.8114 | 64 | 150 | 2.40.70.10 |
| 5c9fB00 | Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases | 0.8099 | 44 | 170 | 2.40.70.10 |
| 2fmbA00 | Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases | 0.7914 | 66 | 155 | 2.40.70.10 |
| af_A0A0N7KKH0_378_508_2.40.70.10 | Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases | 0.775 | 61 | 160 | 2.40.70.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A658K942-F1-model_v4 | Transporter | 0.9867 | 56 | 173 |
GO:0004190
GO:0006508 |
| AF-A0A3M6FY53-F1-model_v4 | Transporter | 0.9733 | 85 | 173 |
|
| AF-A0A658K942-F1-model_v4 | Transporter | 0.9704 | 56 | 173 |
GO:0004190
GO:0006508 |
| AF-A0A2E9MYH9-F1-model_v4 | TIGR02281 family clan AA aspartic protease | 0.9652 | 15 | 173 |
GO:0004190
GO:0006508 |
| AF-A0A3M6FY53-F1-model_v4 | Transporter | 0.9627 | 85 | 173 |
|